1YITO

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1yitO00
3CCLO 3G6EO 1Q86M 1VQKO 1KQSN 2OTJL 3CCJL 3CXCN 2QEXL 1QVFK 1YI2O 1N8RP 1VQ5O 1Q7YP 3CCVO 1VQML 3CCQO 1VQLL 1M90M 1QVFN 3G4SL 1YIJO 3CC2L 3CCUL 3CD6L 1VQPO 1M1KP 1S72L 3CC4O 1VQ7L 1Q82P 1N8RM 1Q7YM 3CMEL 3CCRL 2QA4L 1VQ8L 3CPWK 3I56O 3CC7L 1YITL 3I55O 1VQOO 3CPWN 3CCML 1M1KM 3CCQL 1YJWL 1Q82M 1NJIP 2OTLL 1VQ6L 1YJ9L 1KD1P 1VQ4L 1Q81P 1VQ9L 3CCEO 2OTJO 3CCJO 3CCSL 1YHQL 1K8AP 1VQMO 1VQLO 3CMAL 1YJNL 3G4SO 1NJIM 3CCLL 3G6EL 1VQKL 1K73P 1KD1M 3CD6O 3I55L 1YI2L 1VQNO 1Q81M 1VQ5L 3CCVL 1S72O 3G71O 1K8AM 2QA4O 1YIJL 3CC7O 1YITO 1VQPL 2QEXO 1QVGK 1K9MP 3CCEL 1K73M 3CC4L 3CCMO 1KC8P 1QVGN 1JJ2K 1YJWO 3OW2K 1Q86P 2OTLO 3CC2O 1VQ6O 3CCUO 1YJ9O 1JJ2N 3I56L 1VQ4O 3OW2N 1VQOL 1VQ9O 1VQ7O 1W2BK 3CCSO 1YHQO 1M90P 1VQNL 1K9MM 3CMEO 1W2BN 3CCRO 3G71L 3CMAO 1YJNO 1VQ8O 1KQSK 1KC8M 3CXCK
chains in the Genus database with same CATH superfamily
4WJ0A 3CCLO 4QDLA 3G6EO 5DS5A 1Q86M 1VQKO 1KQSN 2OTJL 3CCJL 4P6IC 3CXCN 2QEXL 2YZSA 1QVFK 1YI2O 1N8RP 1VQ5O 1Q7YP 3CCVO 1VQML 3CCQO 1VQLL 1M90M 1QVFN 3G4SL 1YIJO 3CC2L 3CCUL 5DQZA 3CD6L 1VQPO 1M1KP 1VQ7L 3CC4O 1S72L 1Q82P 1N8RM 1Q7YM 3CMEL 5DQTA 3CCRL 2QA4L 1VQ8L 3CPWK 3NKDA 3I56O 3CC7L 1YITL 3I55O 1VQOO 3CPWN 3CCML 1M1KM 4N06A 3CCQL 1YJWL 1Q82M 1NJIP 2OTLL 1VQ6L 1YJ9L 1KD1P 1VQ4L 1Q81P 1VQ9L 3CCEO 2OTJO 3CCJO 3CCSL 1YHQL 4W8KA 1K8AP 1VQMO 1VQLO 3CMAL 1YJNL 3G4SO 1NJIM 3CCLL 3G6EL 1VQKL 1K73P 1KD1M 3CD6O 3I55L 1YI2L 1VQNO 1Q81M 1VQ5L 3CCVL 1S72O 3G71O 5DS4A 5DS6A 1K8AM 2QA4O 1YIJL 3CC7O 1YITO 1VQPL 2QEXO 1QVGK 1K9MP 5DLJA 3CCEL 1K73M 3CC4L 3CCMO 1KC8P 1QVGN 1JJ2K 1YJWO 3OW2K 1Q86P 2OTLO 3CC2O 1VQ6O 3CCUO 1YJ9O 4XTKA 1JJ2N 3I56L 1VQ4O 5FCLA 3OW2N 1VQOL 1VQ9O 1VQ7O 1W2BK 3CCSO 1YHQO 1M90P 3GODA 1VQNL 1K9MM 3CMEO 1W2BN 3CCRO 3G71L 3CMAO 1YJNO 1VQ8O 1KQSK 1KC8M 3CXCK
chains in the Genus database with same CATH topology
4WJ0A 3CCLO 4QDLA 3G6EO 5DS5A 1Q86M 1VQKO 1KQSN 2OTJL 3CCJL 4P6IC 3CXCN 2QEXL 2YZSA 1QVFK 1YI2O 1N8RP 1VQ5O 1Q7YP 3CCVO 1VQML 3CCQO 1VQLL 1M90M 1QVFN 3G4SL 1YIJO 3CC2L 3CCUL 5DQZA 3CD6L 1VQPO 1M1KP 1VQ7L 3CC4O 1S72L 1Q82P 1N8RM 1Q7YM 3CMEL 5DQTA 3CCRL 2QA4L 1VQ8L 3CPWK 3NKDA 3I56O 3CC7L 1YITL 3I55O 1VQOO 3CPWN 3CCML 1M1KM 4N06A 3CCQL 1YJWL 1Q82M 1NJIP 2OTLL 1VQ6L 1YJ9L 1KD1P 1VQ4L 1Q81P 1VQ9L 3CCEO 2OTJO 3CCJO 3CCSL 1YHQL 4W8KA 1K8AP 1VQMO 1VQLO 3CMAL 1YJNL 3G4SO 1NJIM 3CCLL 3G6EL 1VQKL 1K73P 1KD1M 3CD6O 3I55L 1YI2L 1VQNO 1Q81M 1VQ5L 3CCVL 1S72O 3G71O 5DS4A 5DS6A 1K8AM 2QA4O 1YIJL 3CC7O 1YITO 1VQPL 2QEXO 1QVGK 1K9MP 5DLJA 3CCEL 1K73M 3CC4L 3CCMO 1KC8P 1QVGN 1JJ2K 1YJWO 3OW2K 1Q86P 2OTLO 3CC2O 1VQ6O 3CCUO 1YJ9O 4XTKA 1JJ2N 3I56L 1VQ4O 5FCLA 3OW2N 1VQOL 1VQ9O 1VQ7O 1W2BK 3CCSO 1YHQO 1M90P 3GODA 1VQNL 1K9MM 3CMEO 1W2BN 3CCRO 3G71L 3CMAO 1YJNO 1VQ8O 1KQSK 1KC8M 3CXCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL O;  3G6E O;  1Q86 M;  1VQK O;  1KQS N;  2OTJ L;  3CCJ L;  3CXC N;  2QEX L;  1QVF K;  1YI2 O;  1N8R P;  1VQ5 O;  1Q7Y P;  3CCV O;  1VQM L;  3CCQ O;  1VQL L;  1M90 M;  1QVF N;  3G4S L;  1YIJ O;  3CC2 L;  3CCU L;  3CD6 L;  1VQP O;  1M1K P;  1S72 L;  3CC4 O;  1VQ7 L;  1Q82 P;  1N8R M;  1Q7Y M;  3CME L;  3CCR L;  2QA4 L;  1VQ8 L;  3CPW K;  3I56 O;  3CC7 L;  1YIT L;  3I55 O;  1VQO O;  3CPW N;  3CCM L;  1M1K M;  3CCQ L;  1YJW L;  1Q82 M;  1NJI P;  2OTL L;  1VQ6 L;  1YJ9 L;  1KD1 P;  1VQ4 L;  1Q81 P;  1VQ9 L;  3CCE O;  2OTJ O;  3CCJ O;  3CCS L;  1YHQ L;  1K8A P;  1VQM O;  1VQL O;  3CMA L;  1YJN L;  3G4S O;  1NJI M;  3CCL L;  3G6E L;  1VQK L;  1K73 P;  1KD1 M;  3CD6 O;  3I55 L;  1YI2 L;  1VQN O;  1Q81 M;  1VQ5 L;  3CCV L;  1S72 O;  3G71 O;  1K8A M;  2QA4 O;  1YIJ L;  3CC7 O;  1YIT O;  1VQP L;  2QEX O;  1QVG K;  1K9M P;  3CCE L;  1K73 M;  3CC4 L;  3CCM O;  1KC8 P;  1QVG N;  1JJ2 K;  1YJW O;  3OW2 K;  1Q86 P;  2OTL O;  3CC2 O;  1VQ6 O;  3CCU O;  1YJ9 O;  1JJ2 N;  3I56 L;  1VQ4 O;  3OW2 N;  1VQO L;  1VQ9 O;  1VQ7 O;  1W2B K;  3CCS O;  1YHQ O;  1M90 P;  1VQN L;  1K9M M;  3CME O;  1W2B N;  3CCR O;  3G71 L;  3CMA O;  1YJN O;  1VQ8 O;  1KQS K;  1KC8 M;  3CXC K; 
#chains in the Genus database with same CATH topology
 4WJ0 A;  3CCL O;  4QDL A;  3G6E O;  5DS5 A;  1Q86 M;  1VQK O;  1KQS N;  2OTJ L;  3CCJ L;  4P6I C;  3CXC N;  2QEX L;  2YZS A;  1QVF K;  1YI2 O;  1N8R P;  1VQ5 O;  1Q7Y P;  3CCV O;  1VQM L;  3CCQ O;  1VQL L;  1M90 M;  1QVF N;  3G4S L;  1YIJ O;  3CC2 L;  3CCU L;  5DQZ A;  3CD6 L;  1VQP O;  1M1K P;  1VQ7 L;  3CC4 O;  1S72 L;  1Q82 P;  1N8R M;  1Q7Y M;  3CME L;  5DQT A;  3CCR L;  2QA4 L;  1VQ8 L;  3CPW K;  3NKD A;  3I56 O;  3CC7 L;  1YIT L;  3I55 O;  1VQO O;  3CPW N;  3CCM L;  1M1K M;  4N06 A;  3CCQ L;  1YJW L;  1Q82 M;  1NJI P;  2OTL L;  1VQ6 L;  1YJ9 L;  1KD1 P;  1VQ4 L;  1Q81 P;  1VQ9 L;  3CCE O;  2OTJ O;  3CCJ O;  3CCS L;  1YHQ L;  4W8K A;  1K8A P;  1VQM O;  1VQL O;  3CMA L;  1YJN L;  3G4S O;  1NJI M;  3CCL L;  3G6E L;  1VQK L;  1K73 P;  1KD1 M;  3CD6 O;  3I55 L;  1YI2 L;  1VQN O;  1Q81 M;  1VQ5 L;  3CCV L;  1S72 O;  3G71 O;  5DS4 A;  5DS6 A;  1K8A M;  2QA4 O;  1YIJ L;  3CC7 O;  1YIT O;  1VQP L;  2QEX O;  1QVG K;  1K9M P;  5DLJ A;  3CCE L;  1K73 M;  3CC4 L;  3CCM O;  1KC8 P;  1QVG N;  1JJ2 K;  1YJW O;  3OW2 K;  1Q86 P;  2OTL O;  3CC2 O;  1VQ6 O;  3CCU O;  1YJ9 O;  4XTK A;  1JJ2 N;  3I56 L;  1VQ4 O;  5FCL A;  3OW2 N;  1VQO L;  1VQ9 O;  1VQ7 O;  1W2B K;  3CCS O;  1YHQ O;  1M90 P;  3GOD A;  1VQN L;  1K9M M;  3CME O;  1W2B N;  3CCR O;  3G71 L;  3CMA O;  1YJN O;  1VQ8 O;  1KQS K;  1KC8 M;  3CXC K; 
#chains in the Genus database with same CATH homology
 4WJ0 A;  3CCL O;  4QDL A;  3G6E O;  5DS5 A;  1Q86 M;  1VQK O;  1KQS N;  2OTJ L;  3CCJ L;  4P6I C;  3CXC N;  2QEX L;  2YZS A;  1QVF K;  1YI2 O;  1N8R P;  1VQ5 O;  1Q7Y P;  3CCV O;  1VQM L;  3CCQ O;  1VQL L;  1M90 M;  1QVF N;  3G4S L;  1YIJ O;  3CC2 L;  3CCU L;  5DQZ A;  3CD6 L;  1VQP O;  1M1K P;  1VQ7 L;  3CC4 O;  1S72 L;  1Q82 P;  1N8R M;  1Q7Y M;  3CME L;  5DQT A;  3CCR L;  2QA4 L;  1VQ8 L;  3CPW K;  3NKD A;  3I56 O;  3CC7 L;  1YIT L;  3I55 O;  1VQO O;  3CPW N;  3CCM L;  1M1K M;  4N06 A;  3CCQ L;  1YJW L;  1Q82 M;  1NJI P;  2OTL L;  1VQ6 L;  1YJ9 L;  1KD1 P;  1VQ4 L;  1Q81 P;  1VQ9 L;  3CCE O;  2OTJ O;  3CCJ O;  3CCS L;  1YHQ L;  4W8K A;  1K8A P;  1VQM O;  1VQL O;  3CMA L;  1YJN L;  3G4S O;  1NJI M;  3CCL L;  3G6E L;  1VQK L;  1K73 P;  1KD1 M;  3CD6 O;  3I55 L;  1YI2 L;  1VQN O;  1Q81 M;  1VQ5 L;  3CCV L;  1S72 O;  3G71 O;  5DS4 A;  5DS6 A;  1K8A M;  2QA4 O;  1YIJ L;  3CC7 O;  1YIT O;  1VQP L;  2QEX O;  1QVG K;  1K9M P;  5DLJ A;  3CCE L;  1K73 M;  3CC4 L;  3CCM O;  1KC8 P;  1QVG N;  1JJ2 K;  1YJW O;  3OW2 K;  1Q86 P;  2OTL O;  3CC2 O;  1VQ6 O;  3CCU O;  1YJ9 O;  4XTK A;  1JJ2 N;  3I56 L;  1VQ4 O;  5FCL A;  3OW2 N;  1VQO L;  1VQ9 O;  1VQ7 O;  1W2B K;  3CCS O;  1YHQ O;  1M90 P;  3GOD A;  1VQN L;  1K9M M;  3CME O;  1W2B N;  3CCR O;  3G71 L;  3CMA O;  1YJN O;  1VQ8 O;  1KQS K;  1KC8 M;  3CXC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...