1M90M

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1m90M02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1m90M01
3I56L 3CC4O 3G6EL 3G71O 3CCSO 3CD6O 1Q82M 1VQOL 1QVGK 3CMAO 1K9MP 1YJWL 1YHQL 1YI2O 1K73P 1VQNL 1YJNL 1VQ8O 1VQPL 1M1KM 1YIJO 1VQKO 3I55L 1Q86M 3CXCK 3CC2L 1Q81P 3CCRO 2QEXL 3G71L 3G4SL 1M90M 3CCVO 1YITO 1VQLO 1JJ2K 1K8AP 1VQ9L 1YJ9O 1QVFK 2QA4L 1YI2L 1KD1M 1KQSN 1JJ2N 3CCUO 3CCLO 3CCJO 1VQMO 1VQKL 1Q7YP 3CC7O 1QVGN 3CCQO 3OW2K 3CCRL 3CCMO 1Q82P 1VQ7L 1S72L 3CCVL 1YITL 3OW2N 1VQLL 1K73M 3CC4L 1VQ4O 3CCSL 3CPWK 1W2BK 1YJ9L 1NJIP 3CD6L 2OTJO 3CXCN 3CCUL 3I56O 1VQML 3CPWN 3CMAL 1W2BN 1M1KP 3CMEO 3CC7L 1VQOO 1VQ8L 1N8RP 1YIJL 1QVFN 1M90P 1KC8P 1YHQO 1VQNO 1YJNO 1VQPO 1K9MM 3CCEO 3CC2O 1VQ5O 2QEXO 3CMEL 1VQ6O 3G4SO 2OTLO 3CCLL 3CCJL 1Q81M 3G6EO 1VQ9O 1NJIM 1Q86P 2QA4O 3CCQL 3CCML 2OTLL 1K8AM 1YJWO 1VQ4L 3CCEL 1VQ5L 1N8RM 2OTJL 1Q7YM 1VQ6L 3I55O 1KD1P 1VQ7O 1S72O 1KC8M 1KQSK
chains in the Genus database with same CATH superfamily
3I56L 3CC4O 3G6EL 3G71O 3CCSO 3CD6O 1Q82M 1VQOL 4N06A 1QVGK 4W8KA 3CMAO 1K9MP 1YJWL 1YHQL 1YI2O 1K73P 4XTKA 1VQNL 1YJNL 1VQ8O 1VQPL 4WJ0A 1M1KM 1YIJO 1VQKO 3I55L 1Q86M 3CXCK 3CC2L 1Q81P 3CCRO 2QEXL 3G71L 2YZSA 3G4SL 1M90M 3CCVO 1YITO 1VQLO 1JJ2K 1K8AP 1VQ9L 1YJ9O 1QVFK 5DLJA 2QA4L 1YI2L 1KD1M 1KQSN 1JJ2N 3CCUO 3CCLO 3CCJO 1VQMO 1VQKL 1Q7YP 3CC7O 1QVGN 3CCQO 3OW2K 3CCRL 3CCMO 1Q82P 1VQ7L 1S72L 4QDLA 3CCVL 3OW2N 1YITL 1K73M 1VQLL 3CC4L 1VQ4O 3CCSL 3CPWK 1W2BK 1YJ9L 1NJIP 3CD6L 5FCLA 2OTJO 3CXCN 3CCUL 3I56O 1VQML 3CMAL 3CPWN 1W2BN 1M1KP 3CMEO 4P6IC 3CC7L 1VQOO 1VQ8L 1N8RP 1YIJL 1QVFN 1M90P 1KC8P 3NKDA 1YHQO 1VQNO 1YJNO 1VQPO 1K9MM 5DS5A 3CCEO 3CC2O 1VQ5O 5DQTA 2QEXO 3CMEL 1VQ6O 5DS4A 3G4SO 2OTLO 3CCLL 3GODA 3CCJL 1Q81M 3G6EO 1VQ9O 1NJIM 1Q86P 1KC8M 2QA4O 3CCQL 5DQZA 3CCML 2OTLL 1K8AM 1YJWO 1VQ4L 3CCEL 1VQ5L 1N8RM 2OTJL 1Q7YM 1VQ6L 3I55O 1KD1P 1VQ7O 1S72O 5DS6A 1KQSK
chains in the Genus database with same CATH topology
3I56L 3CC4O 3G6EL 3G71O 3CCSO 3CD6O 1Q82M 1VQOL 4N06A 1QVGK 4W8KA 3CMAO 1K9MP 1YJWL 1YHQL 1YI2O 1K73P 4XTKA 1VQNL 1YJNL 1VQ8O 1VQPL 4WJ0A 1M1KM 1YIJO 1VQKO 3I55L 1Q86M 3CXCK 3CC2L 1Q81P 3CCRO 2QEXL 3G71L 2YZSA 3G4SL 1M90M 3CCVO 1YITO 1VQLO 1JJ2K 1K8AP 1VQ9L 1YJ9O 1QVFK 5DLJA 2QA4L 1YI2L 1KD1M 1KQSN 1JJ2N 3CCUO 3CCLO 3CCJO 1VQMO 1VQKL 1Q7YP 3CC7O 1QVGN 3CCQO 3OW2K 3CCRL 3CCMO 1Q82P 1VQ7L 1S72L 4QDLA 3CCVL 3OW2N 1YITL 1K73M 1VQLL 3CC4L 1VQ4O 3CCSL 3CPWK 1W2BK 1YJ9L 1NJIP 3CD6L 5FCLA 2OTJO 3CXCN 3CCUL 3I56O 1VQML 3CMAL 3CPWN 1W2BN 1M1KP 3CMEO 4P6IC 3CC7L 1VQOO 1VQ8L 1N8RP 1YIJL 1QVFN 1M90P 1KC8P 3NKDA 1YHQO 1VQNO 1YJNO 1VQPO 1K9MM 5DS5A 3CCEO 3CC2O 1VQ5O 5DQTA 2QEXO 3CMEL 1VQ6O 5DS4A 3G4SO 2OTLO 3CCLL 3GODA 3CCJL 1Q81M 3G6EO 1VQ9O 1NJIM 1Q86P 1KC8M 2QA4O 3CCQL 5DQZA 3CCML 2OTLL 1K8AM 1YJWO 1VQ4L 3CCEL 1VQ5L 1N8RM 2OTJL 1Q7YM 1VQ6L 3I55O 1KD1P 1VQ7O 1S72O 5DS6A 1KQSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 L;  3CC4 O;  3G6E L;  3G71 O;  3CCS O;  3CD6 O;  1Q82 M;  1VQO L;  1QVG K;  3CMA O;  1K9M P;  1YJW L;  1YHQ L;  1YI2 O;  1K73 P;  1VQN L;  1YJN L;  1VQ8 O;  1VQP L;  1M1K M;  1YIJ O;  1VQK O;  3I55 L;  1Q86 M;  3CXC K;  3CC2 L;  1Q81 P;  3CCR O;  2QEX L;  3G71 L;  3G4S L;  1M90 M;  3CCV O;  1YIT O;  1VQL O;  1JJ2 K;  1K8A P;  1VQ9 L;  1YJ9 O;  1QVF K;  2QA4 L;  1YI2 L;  1KD1 M;  1KQS N;  1JJ2 N;  3CCU O;  3CCL O;  3CCJ O;  1VQM O;  1VQK L;  1Q7Y P;  3CC7 O;  1QVG N;  3CCQ O;  3OW2 K;  3CCR L;  3CCM O;  1Q82 P;  1VQ7 L;  1S72 L;  3CCV L;  1YIT L;  3OW2 N;  1VQL L;  1K73 M;  3CC4 L;  1VQ4 O;  3CCS L;  3CPW K;  1W2B K;  1YJ9 L;  1NJI P;  3CD6 L;  2OTJ O;  3CXC N;  3CCU L;  3I56 O;  1VQM L;  3CPW N;  3CMA L;  1W2B N;  1M1K P;  3CME O;  3CC7 L;  1VQO O;  1VQ8 L;  1N8R P;  1YIJ L;  1QVF N;  1M90 P;  1KC8 P;  1YHQ O;  1VQN O;  1YJN O;  1VQP O;  1K9M M;  3CCE O;  3CC2 O;  1VQ5 O;  2QEX O;  3CME L;  1VQ6 O;  3G4S O;  2OTL O;  3CCL L;  3CCJ L;  1Q81 M;  3G6E O;  1VQ9 O;  1NJI M;  1Q86 P;  2QA4 O;  3CCQ L;  3CCM L;  2OTL L;  1K8A M;  1YJW O;  1VQ4 L;  3CCE L;  1VQ5 L;  1N8R M;  2OTJ L;  1Q7Y M;  1VQ6 L;  3I55 O;  1KD1 P;  1VQ7 O;  1S72 O;  1KC8 M;  1KQS K; 
#chains in the Genus database with same CATH topology
 3I56 L;  3CC4 O;  3G6E L;  3G71 O;  3CCS O;  3CD6 O;  1Q82 M;  1VQO L;  4N06 A;  1QVG K;  4W8K A;  3CMA O;  1K9M P;  1YJW L;  1YHQ L;  1YI2 O;  1K73 P;  4XTK A;  1VQN L;  1YJN L;  1VQ8 O;  1VQP L;  4WJ0 A;  1M1K M;  1YIJ O;  1VQK O;  3I55 L;  1Q86 M;  3CXC K;  3CC2 L;  1Q81 P;  3CCR O;  2QEX L;  3G71 L;  2YZS A;  3G4S L;  1M90 M;  3CCV O;  1YIT O;  1VQL O;  1JJ2 K;  1K8A P;  1VQ9 L;  1YJ9 O;  1QVF K;  5DLJ A;  2QA4 L;  1YI2 L;  1KD1 M;  1KQS N;  1JJ2 N;  3CCU O;  3CCL O;  3CCJ O;  1VQM O;  1VQK L;  1Q7Y P;  3CC7 O;  1QVG N;  3CCQ O;  3OW2 K;  3CCR L;  3CCM O;  1Q82 P;  1VQ7 L;  1S72 L;  4QDL A;  3CCV L;  3OW2 N;  1YIT L;  1K73 M;  1VQL L;  3CC4 L;  1VQ4 O;  3CCS L;  3CPW K;  1W2B K;  1YJ9 L;  1NJI P;  3CD6 L;  5FCL A;  2OTJ O;  3CXC N;  3CCU L;  3I56 O;  1VQM L;  3CMA L;  3CPW N;  1W2B N;  1M1K P;  3CME O;  4P6I C;  3CC7 L;  1VQO O;  1VQ8 L;  1N8R P;  1YIJ L;  1QVF N;  1M90 P;  1KC8 P;  3NKD A;  1YHQ O;  1VQN O;  1YJN O;  1VQP O;  1K9M M;  5DS5 A;  3CCE O;  3CC2 O;  1VQ5 O;  5DQT A;  2QEX O;  3CME L;  1VQ6 O;  5DS4 A;  3G4S O;  2OTL O;  3CCL L;  3GOD A;  3CCJ L;  1Q81 M;  3G6E O;  1VQ9 O;  1NJI M;  1Q86 P;  1KC8 M;  2QA4 O;  3CCQ L;  5DQZ A;  3CCM L;  2OTL L;  1K8A M;  1YJW O;  1VQ4 L;  3CCE L;  1VQ5 L;  1N8R M;  2OTJ L;  1Q7Y M;  1VQ6 L;  3I55 O;  1KD1 P;  1VQ7 O;  1S72 O;  5DS6 A;  1KQS K; 
#chains in the Genus database with same CATH homology
 3I56 L;  3CC4 O;  3G6E L;  3G71 O;  3CCS O;  3CD6 O;  1Q82 M;  1VQO L;  4N06 A;  1QVG K;  4W8K A;  3CMA O;  1K9M P;  1YJW L;  1YHQ L;  1YI2 O;  1K73 P;  4XTK A;  1VQN L;  1YJN L;  1VQ8 O;  1VQP L;  4WJ0 A;  1M1K M;  1YIJ O;  1VQK O;  3I55 L;  1Q86 M;  3CXC K;  3CC2 L;  1Q81 P;  3CCR O;  2QEX L;  3G71 L;  2YZS A;  3G4S L;  1M90 M;  3CCV O;  1YIT O;  1VQL O;  1JJ2 K;  1K8A P;  1VQ9 L;  1YJ9 O;  1QVF K;  5DLJ A;  2QA4 L;  1YI2 L;  1KD1 M;  1KQS N;  1JJ2 N;  3CCU O;  3CCL O;  3CCJ O;  1VQM O;  1VQK L;  1Q7Y P;  3CC7 O;  1QVG N;  3CCQ O;  3OW2 K;  3CCR L;  3CCM O;  1Q82 P;  1VQ7 L;  1S72 L;  4QDL A;  3CCV L;  3OW2 N;  1YIT L;  1K73 M;  1VQL L;  3CC4 L;  1VQ4 O;  3CCS L;  3CPW K;  1W2B K;  1YJ9 L;  1NJI P;  3CD6 L;  5FCL A;  2OTJ O;  3CXC N;  3CCU L;  3I56 O;  1VQM L;  3CMA L;  3CPW N;  1W2B N;  1M1K P;  3CME O;  4P6I C;  3CC7 L;  1VQO O;  1VQ8 L;  1N8R P;  1YIJ L;  1QVF N;  1M90 P;  1KC8 P;  3NKD A;  1YHQ O;  1VQN O;  1YJN O;  1VQP O;  1K9M M;  5DS5 A;  3CCE O;  3CC2 O;  1VQ5 O;  5DQT A;  2QEX O;  3CME L;  1VQ6 O;  5DS4 A;  3G4S O;  2OTL O;  3CCL L;  3GOD A;  3CCJ L;  1Q81 M;  3G6E O;  1VQ9 O;  1NJI M;  1Q86 P;  1KC8 M;  2QA4 O;  3CCQ L;  5DQZ A;  3CCM L;  2OTL L;  1K8A M;  1YJW O;  1VQ4 L;  3CCE L;  1VQ5 L;  1N8R M;  2OTJ L;  1Q7Y M;  1VQ6 L;  3I55 O;  1KD1 P;  1VQ7 O;  1S72 O;  5DS6 A;  1KQS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...