3CPWN

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cpwN00
3CCSL 1YIJL 1VQMO 1VQML 3CCJO 1YITL 1M1KP 3CCJL 3CCML 1Q7YM 1KD1P 3CC7O 1Q82P 1Q81P 3CD6L 3I55L 3CCUO 1YHQO 1JJ2K 3CMEO 1K9MM 1VQ5L 3CCUL 1YHQL 3CMEL 1VQ9O 1NJIP 1VQ9L 3CPWK 1S72O 3OW2N 1YJWO 1KC8P 3CCLO 1YJWL 3CCEO 3I56O 2OTLO 1VQNO 1K8AM 1VQ4O 3CXCK 1W2BK 2OTLL 3CC2O 1VQNL 3CC2L 1VQ8O 1QVFN 3G71O 1KQSK 3CPWN 3CC7L 3G71L 3G4SO 1Q86P 1N8RP 1M1KM 1YJNO 1M90P 3G4SL 1VQ6O 2OTJO 1YJ9O 2QEXO 1W2BN 2OTJL 1YJ9L 1KD1M 1Q82M 1QVFK 1VQ7O 1Q81M 1K73P 1S72L 1VQKO 1VQ7L 1JJ2N 3CCRO 3CCLL 3CCVO 3I56L 1VQLO 3CCEL 3CCVL 1VQLL 2QA4O 1VQ4L 1QVGK 1NJIM 1VQ8L 3CMAO 1KC8M 1Q7YP 1YI2O 3CMAL 1YI2L 1K9MP 1YITO 1VQOO 3CXCN 1YJNL 1VQ6L 2QEXL 3CCMO 1VQOL 1QVGN 1KQSN 3CC4O 3OW2K 1VQKL 3CD6O 3I55O 1VQ5O 1Q86M 1N8RM 3CC4L 3CCRL 1M90M 1VQPO 3CCQO 3G6EO 1VQPL 3CCQL 1K8AP 2QA4L 3G6EL 3CCSO 1YIJO 1K73M
chains in the Genus database with same CATH superfamily
3CCSL 1YIJL 1VQMO 1VQML 3CCJO 1YITL 1M1KP 3CCJL 3CCML 1Q7YM 5FCLA 4P6IC 3CC7O 1Q82P 1KD1P 1Q81P 3CD6L 3I55L 3CCUO 1YHQO 1JJ2K 3CMEO 1K9MM 1VQ5L 5DS6A 3CCUL 1YHQL 3CMEL 4WJ0A 5DQZA 1VQ9O 1NJIP 1VQ9L 3CPWK 1S72O 3OW2N 2YZSA 1YJWO 5DS5A 1KC8P 3CCLO 1YJWL 3CCEO 3I56O 2OTLO 1VQNO 3NKDA 1K8AM 1VQ4O 3CXCK 1W2BK 2OTLL 3CC2O 1VQNL 3CC2L 1VQ8O 1QVFN 3G71O 1KQSK 3CPWN 3CC7L 3G71L 3G4SO 4QDLA 1Q86P 1N8RP 1M1KM 1YJNO 1M90P 3G4SL 1VQ6O 2OTJO 1YJ9O 4W8KA 2QEXO 1W2BN 2OTJL 1YJ9L 1KD1M 1Q82M 1QVFK 1VQ7O 1Q81M 1K73P 1S72L 1VQKO 1VQ7L 1JJ2N 3CCRO 3CCLL 3CCVO 3I56L 1VQLO 3CCEL 5DS4A 3CCVL 1VQLL 2QA4O 1VQ4L 1QVGK 1NJIM 5DQTA 1VQ8L 3CMAO 1KC8M 1Q7YP 1YI2O 3CMAL 1YI2L 1K9MP 1YITO 1VQOO 3CXCN 1YJNL 1VQ6L 5DLJA 2QEXL 3CCMO 1VQOL 1QVGN 4XTKA 1KQSN 3GODA 3CC4O 3OW2K 4N06A 1VQKL 3CD6O 3I55O 1VQ5O 1Q86M 1N8RM 3CC4L 3CCRL 1M90M 1VQPO 3CCQO 3G6EO 1VQPL 3CCQL 1K8AP 2QA4L 3G6EL 3CCSO 1YIJO 1K73M
chains in the Genus database with same CATH topology
3CCSL 1YIJL 1VQMO 1VQML 3CCJO 1YITL 1M1KP 3CCJL 3CCML 1Q7YM 5FCLA 4P6IC 3CC7O 1Q82P 1KD1P 1Q81P 3CD6L 3I55L 3CCUO 1YHQO 1JJ2K 3CMEO 1K9MM 1VQ5L 5DS6A 3CCUL 1YHQL 3CMEL 4WJ0A 5DQZA 1VQ9O 1NJIP 1VQ9L 3CPWK 1S72O 3OW2N 2YZSA 1YJWO 5DS5A 1KC8P 3CCLO 1YJWL 3CCEO 3I56O 2OTLO 1VQNO 3NKDA 1K8AM 1VQ4O 3CXCK 1W2BK 2OTLL 3CC2O 1VQNL 3CC2L 1VQ8O 1QVFN 3G71O 1KQSK 3CPWN 3CC7L 3G71L 3G4SO 4QDLA 1Q86P 1N8RP 1M1KM 1YJNO 1M90P 3G4SL 1VQ6O 2OTJO 1YJ9O 4W8KA 2QEXO 1W2BN 2OTJL 1YJ9L 1KD1M 1Q82M 1QVFK 1VQ7O 1Q81M 1K73P 1S72L 1VQKO 1VQ7L 1JJ2N 3CCRO 3CCLL 3CCVO 3I56L 1VQLO 3CCEL 5DS4A 3CCVL 1VQLL 2QA4O 1VQ4L 1QVGK 1NJIM 5DQTA 1VQ8L 3CMAO 1KC8M 1Q7YP 1YI2O 3CMAL 1YI2L 1K9MP 1YITO 1VQOO 3CXCN 1YJNL 1VQ6L 5DLJA 2QEXL 3CCMO 1VQOL 1QVGN 4XTKA 1KQSN 3GODA 3CC4O 3OW2K 4N06A 1VQKL 3CD6O 3I55O 1VQ5O 1Q86M 1N8RM 3CC4L 3CCRL 1M90M 1VQPO 3CCQO 3G6EO 1VQPL 3CCQL 1K8AP 2QA4L 3G6EL 3CCSO 1YIJO 1K73M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS L;  1YIJ L;  1VQM O;  1VQM L;  3CCJ O;  1YIT L;  1M1K P;  3CCJ L;  3CCM L;  1Q7Y M;  1KD1 P;  3CC7 O;  1Q82 P;  1Q81 P;  3CD6 L;  3I55 L;  3CCU O;  1YHQ O;  1JJ2 K;  3CME O;  1K9M M;  1VQ5 L;  3CCU L;  1YHQ L;  3CME L;  1VQ9 O;  1NJI P;  1VQ9 L;  3CPW K;  1S72 O;  3OW2 N;  1YJW O;  1KC8 P;  3CCL O;  1YJW L;  3CCE O;  3I56 O;  2OTL O;  1VQN O;  1K8A M;  1VQ4 O;  3CXC K;  1W2B K;  2OTL L;  3CC2 O;  1VQN L;  3CC2 L;  1VQ8 O;  1QVF N;  3G71 O;  1KQS K;  3CPW N;  3CC7 L;  3G71 L;  3G4S O;  1Q86 P;  1N8R P;  1M1K M;  1YJN O;  1M90 P;  3G4S L;  1VQ6 O;  2OTJ O;  1YJ9 O;  2QEX O;  1W2B N;  2OTJ L;  1YJ9 L;  1KD1 M;  1Q82 M;  1QVF K;  1VQ7 O;  1Q81 M;  1K73 P;  1S72 L;  1VQK O;  1VQ7 L;  1JJ2 N;  3CCR O;  3CCL L;  3CCV O;  3I56 L;  1VQL O;  3CCE L;  3CCV L;  1VQL L;  2QA4 O;  1VQ4 L;  1QVG K;  1NJI M;  1VQ8 L;  3CMA O;  1KC8 M;  1Q7Y P;  1YI2 O;  3CMA L;  1YI2 L;  1K9M P;  1YIT O;  1VQO O;  3CXC N;  1YJN L;  1VQ6 L;  2QEX L;  3CCM O;  1VQO L;  1QVG N;  1KQS N;  3CC4 O;  3OW2 K;  1VQK L;  3CD6 O;  3I55 O;  1VQ5 O;  1Q86 M;  1N8R M;  3CC4 L;  3CCR L;  1M90 M;  1VQP O;  3CCQ O;  3G6E O;  1VQP L;  3CCQ L;  1K8A P;  2QA4 L;  3G6E L;  3CCS O;  1YIJ O;  1K73 M; 
#chains in the Genus database with same CATH topology
 3CCS L;  1YIJ L;  1VQM O;  1VQM L;  3CCJ O;  1YIT L;  1M1K P;  3CCJ L;  3CCM L;  1Q7Y M;  5FCL A;  4P6I C;  3CC7 O;  1Q82 P;  1KD1 P;  1Q81 P;  3CD6 L;  3I55 L;  3CCU O;  1YHQ O;  1JJ2 K;  3CME O;  1K9M M;  1VQ5 L;  5DS6 A;  3CCU L;  1YHQ L;  3CME L;  4WJ0 A;  5DQZ A;  1VQ9 O;  1NJI P;  1VQ9 L;  3CPW K;  1S72 O;  3OW2 N;  2YZS A;  1YJW O;  5DS5 A;  1KC8 P;  3CCL O;  1YJW L;  3CCE O;  3I56 O;  2OTL O;  1VQN O;  3NKD A;  1K8A M;  1VQ4 O;  3CXC K;  1W2B K;  2OTL L;  3CC2 O;  1VQN L;  3CC2 L;  1VQ8 O;  1QVF N;  3G71 O;  1KQS K;  3CPW N;  3CC7 L;  3G71 L;  3G4S O;  4QDL A;  1Q86 P;  1N8R P;  1M1K M;  1YJN O;  1M90 P;  3G4S L;  1VQ6 O;  2OTJ O;  1YJ9 O;  4W8K A;  2QEX O;  1W2B N;  2OTJ L;  1YJ9 L;  1KD1 M;  1Q82 M;  1QVF K;  1VQ7 O;  1Q81 M;  1K73 P;  1S72 L;  1VQK O;  1VQ7 L;  1JJ2 N;  3CCR O;  3CCL L;  3CCV O;  3I56 L;  1VQL O;  3CCE L;  5DS4 A;  3CCV L;  1VQL L;  2QA4 O;  1VQ4 L;  1QVG K;  1NJI M;  5DQT A;  1VQ8 L;  3CMA O;  1KC8 M;  1Q7Y P;  1YI2 O;  3CMA L;  1YI2 L;  1K9M P;  1YIT O;  1VQO O;  3CXC N;  1YJN L;  1VQ6 L;  5DLJ A;  2QEX L;  3CCM O;  1VQO L;  1QVG N;  4XTK A;  1KQS N;  3GOD A;  3CC4 O;  3OW2 K;  4N06 A;  1VQK L;  3CD6 O;  3I55 O;  1VQ5 O;  1Q86 M;  1N8R M;  3CC4 L;  3CCR L;  1M90 M;  1VQP O;  3CCQ O;  3G6E O;  1VQP L;  3CCQ L;  1K8A P;  2QA4 L;  3G6E L;  3CCS O;  1YIJ O;  1K73 M; 
#chains in the Genus database with same CATH homology
 3CCS L;  1YIJ L;  1VQM O;  1VQM L;  3CCJ O;  1YIT L;  1M1K P;  3CCJ L;  3CCM L;  1Q7Y M;  5FCL A;  4P6I C;  3CC7 O;  1Q82 P;  1KD1 P;  1Q81 P;  3CD6 L;  3I55 L;  3CCU O;  1YHQ O;  1JJ2 K;  3CME O;  1K9M M;  1VQ5 L;  5DS6 A;  3CCU L;  1YHQ L;  3CME L;  4WJ0 A;  5DQZ A;  1VQ9 O;  1NJI P;  1VQ9 L;  3CPW K;  1S72 O;  3OW2 N;  2YZS A;  1YJW O;  5DS5 A;  1KC8 P;  3CCL O;  1YJW L;  3CCE O;  3I56 O;  2OTL O;  1VQN O;  3NKD A;  1K8A M;  1VQ4 O;  3CXC K;  1W2B K;  2OTL L;  3CC2 O;  1VQN L;  3CC2 L;  1VQ8 O;  1QVF N;  3G71 O;  1KQS K;  3CPW N;  3CC7 L;  3G71 L;  3G4S O;  4QDL A;  1Q86 P;  1N8R P;  1M1K M;  1YJN O;  1M90 P;  3G4S L;  1VQ6 O;  2OTJ O;  1YJ9 O;  4W8K A;  2QEX O;  1W2B N;  2OTJ L;  1YJ9 L;  1KD1 M;  1Q82 M;  1QVF K;  1VQ7 O;  1Q81 M;  1K73 P;  1S72 L;  1VQK O;  1VQ7 L;  1JJ2 N;  3CCR O;  3CCL L;  3CCV O;  3I56 L;  1VQL O;  3CCE L;  5DS4 A;  3CCV L;  1VQL L;  2QA4 O;  1VQ4 L;  1QVG K;  1NJI M;  5DQT A;  1VQ8 L;  3CMA O;  1KC8 M;  1Q7Y P;  1YI2 O;  3CMA L;  1YI2 L;  1K9M P;  1YIT O;  1VQO O;  3CXC N;  1YJN L;  1VQ6 L;  5DLJ A;  2QEX L;  3CCM O;  1VQO L;  1QVG N;  4XTK A;  1KQS N;  3GOD A;  3CC4 O;  3OW2 K;  4N06 A;  1VQK L;  3CD6 O;  3I55 O;  1VQ5 O;  1Q86 M;  1N8R M;  3CC4 L;  3CCR L;  1M90 M;  1VQP O;  3CCQ O;  3G6E O;  1VQP L;  3CCQ L;  1K8A P;  2QA4 L;  3G6E L;  3CCS O;  1YIJ O;  1K73 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...