1KD1P

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1kd1P00
3G4SL 1KQSN 1VQ8L 1K9MP 3CMAL 1Q86M 3G4SO 3CD6L 3CCML 3CCQL 1VQ6O 1N8RM 1VQ8O 3CMAO 1VQ7L 1YJWL 3CXCK 1VQOO 1S72O 1K8AM 1Q86P 3G6EO 1YHQL 1N8RP 1VQMO 3CC4L 2OTJO 1VQKO 3CXCN 1M90M 3CCLO 1K8AP 1YJ9L 3OW2K 1YITL 1M90P 1YJ9O 3CCEL 2QEXL 3CD6O 3CCMO 1KC8M 3CCQO 1NJIM 1VQ7O 1VQPL 1VQNL 3CCEO 3CCUL 1YJWO 1VQ5L 2QEXO 1W2BN 1VQLL 3OW2N 1Q82M 1VQPO 3I55L 1VQ5O 3CCJL 1K73P 3CCSL 1VQ4L 1YHQO 1KC8P 1NJIP 1VQ9L 3CC4O 1KD1P 3CCJO 1Q81M 3CC2L 1YI2L 1Q82P 1W2BK 3CC2O 1YI2O 3CC7L 3I56L 1K73M 3G71L 2OTLL 1YITO 1Q81P 1YJNL 1KD1M 3G71O 1Q7YM 1VQNO 1YJNO 3CCUO 3CCVL 1VQLO 1VQ6L 1QVGK 3I55O 1YIJL 3CCVO 1VQOL 3CCSO 3CCRL 3CPWK 1S72L 1JJ2K 1VQ4O 1QVFK 1Q7YP 1VQ9O 1YIJO 3G6EL 1M1KM 3CCRO 2QA4L 1VQML 2OTJL 1KQSK 1QVGN 3CMEL 1K9MM 1VQKL 3CCLL 2QA4O 3CPWN 1JJ2N 1QVFN 3CC7O 3I56O 3CMEO 2OTLO 1M1KP
chains in the Genus database with same CATH superfamily
3G4SL 1KQSN 1VQ8L 1K9MP 3CMAL 4P6IC 1Q86M 3G4SO 3CD6L 3CCML 3CCQL 1VQ6O 1N8RM 1VQ8O 3CMAO 1VQ7L 1YJWL 3CXCK 1VQOO 5DS4A 1S72O 1K8AM 1Q86P 3G6EO 1YHQL 5DS6A 1N8RP 3GODA 1VQMO 4XTKA 3CC4L 2OTJO 1VQKO 3CXCN 1M90M 4N06A 3CCLO 1K8AP 2YZSA 1YJ9L 5DQZA 3OW2K 3NKDA 1YITL 5DS5A 1M90P 1YJ9O 3CCEL 2QEXL 3CD6O 3CCMO 1KC8M 4WJ0A 3CCQO 1NJIM 1VQ7O 1VQPL 1VQNL 3CCEO 3CCUL 1YJWO 1VQ5L 2QEXO 1W2BN 1VQLL 3OW2N 1Q82M 1VQPO 3I55L 1VQ5O 3CCJL 1K73P 3CCSL 1VQ4L 1YHQO 1KC8P 1NJIP 4W8KA 1VQ9L 3CC4O 1KD1P 3CCJO 1Q81M 3CC2L 1YI2L 1Q82P 1W2BK 3CC2O 1YI2O 3CC7L 3I56L 1K73M 3G71L 2OTLL 5DQTA 1YITO 1Q81P 1YJNL 1KD1M 3G71O 5FCLA 1Q7YM 1VQNO 1YJNO 3CCUO 3CCVL 1VQLO 1VQ6L 4QDLA 1QVGK 3I55O 1YIJL 3CCVO 1VQOL 3CCSO 3CCRL 3CPWK 1S72L 1JJ2K 1VQ4O 1QVFK 1Q7YP 1VQ9O 1YIJO 3G6EL 1M1KM 3CCRO 2QA4L 1VQML 5DLJA 2OTJL 1KQSK 1QVGN 3CMEL 1K9MM 1VQKL 3CCLL 2QA4O 3CPWN 1JJ2N 1QVFN 3CC7O 3I56O 3CMEO 2OTLO 1M1KP
chains in the Genus database with same CATH topology
3G4SL 1KQSN 1VQ8L 1K9MP 3CMAL 4P6IC 1Q86M 3G4SO 3CD6L 3CCML 3CCQL 1VQ6O 1N8RM 1VQ8O 3CMAO 1VQ7L 1YJWL 3CXCK 1VQOO 5DS4A 1S72O 1K8AM 1Q86P 3G6EO 1YHQL 5DS6A 1N8RP 3GODA 1VQMO 4XTKA 3CC4L 2OTJO 1VQKO 3CXCN 1M90M 4N06A 3CCLO 1K8AP 2YZSA 1YJ9L 5DQZA 3OW2K 3NKDA 1YITL 5DS5A 1M90P 1YJ9O 3CCEL 2QEXL 3CD6O 3CCMO 1KC8M 4WJ0A 3CCQO 1NJIM 1VQ7O 1VQPL 1VQNL 3CCEO 3CCUL 1YJWO 1VQ5L 2QEXO 1W2BN 1VQLL 3OW2N 1Q82M 1VQPO 3I55L 1VQ5O 3CCJL 1K73P 3CCSL 1VQ4L 1YHQO 1KC8P 1NJIP 4W8KA 1VQ9L 3CC4O 1KD1P 3CCJO 1Q81M 3CC2L 1YI2L 1Q82P 1W2BK 3CC2O 1YI2O 3CC7L 3I56L 1K73M 3G71L 2OTLL 5DQTA 1YITO 1Q81P 1YJNL 1KD1M 3G71O 5FCLA 1Q7YM 1VQNO 1YJNO 3CCUO 3CCVL 1VQLO 1VQ6L 4QDLA 1QVGK 3I55O 1YIJL 3CCVO 1VQOL 3CCSO 3CCRL 3CPWK 1S72L 1JJ2K 1VQ4O 1QVFK 1Q7YP 1VQ9O 1YIJO 3G6EL 1M1KM 3CCRO 2QA4L 1VQML 5DLJA 2OTJL 1KQSK 1QVGN 3CMEL 1K9MM 1VQKL 3CCLL 2QA4O 3CPWN 1JJ2N 1QVFN 3CC7O 3I56O 3CMEO 2OTLO 1M1KP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S L;  1KQS N;  1VQ8 L;  1K9M P;  3CMA L;  1Q86 M;  3G4S O;  3CD6 L;  3CCM L;  3CCQ L;  1VQ6 O;  1N8R M;  1VQ8 O;  3CMA O;  1VQ7 L;  1YJW L;  3CXC K;  1VQO O;  1S72 O;  1K8A M;  1Q86 P;  3G6E O;  1YHQ L;  1N8R P;  1VQM O;  3CC4 L;  2OTJ O;  1VQK O;  3CXC N;  1M90 M;  3CCL O;  1K8A P;  1YJ9 L;  3OW2 K;  1YIT L;  1M90 P;  1YJ9 O;  3CCE L;  2QEX L;  3CD6 O;  3CCM O;  1KC8 M;  3CCQ O;  1NJI M;  1VQ7 O;  1VQP L;  1VQN L;  3CCE O;  3CCU L;  1YJW O;  1VQ5 L;  2QEX O;  1W2B N;  1VQL L;  3OW2 N;  1Q82 M;  1VQP O;  3I55 L;  1VQ5 O;  3CCJ L;  1K73 P;  3CCS L;  1VQ4 L;  1YHQ O;  1KC8 P;  1NJI P;  1VQ9 L;  3CC4 O;  1KD1 P;  3CCJ O;  1Q81 M;  3CC2 L;  1YI2 L;  1Q82 P;  1W2B K;  3CC2 O;  1YI2 O;  3CC7 L;  3I56 L;  1K73 M;  3G71 L;  2OTL L;  1YIT O;  1Q81 P;  1YJN L;  1KD1 M;  3G71 O;  1Q7Y M;  1VQN O;  1YJN O;  3CCU O;  3CCV L;  1VQL O;  1VQ6 L;  1QVG K;  3I55 O;  1YIJ L;  3CCV O;  1VQO L;  3CCS O;  3CCR L;  3CPW K;  1S72 L;  1JJ2 K;  1VQ4 O;  1QVF K;  1Q7Y P;  1VQ9 O;  1YIJ O;  3G6E L;  1M1K M;  3CCR O;  2QA4 L;  1VQM L;  2OTJ L;  1KQS K;  1QVG N;  3CME L;  1K9M M;  1VQK L;  3CCL L;  2QA4 O;  3CPW N;  1JJ2 N;  1QVF N;  3CC7 O;  3I56 O;  3CME O;  2OTL O;  1M1K P; 
#chains in the Genus database with same CATH topology
 3G4S L;  1KQS N;  1VQ8 L;  1K9M P;  3CMA L;  4P6I C;  1Q86 M;  3G4S O;  3CD6 L;  3CCM L;  3CCQ L;  1VQ6 O;  1N8R M;  1VQ8 O;  3CMA O;  1VQ7 L;  1YJW L;  3CXC K;  1VQO O;  5DS4 A;  1S72 O;  1K8A M;  1Q86 P;  3G6E O;  1YHQ L;  5DS6 A;  1N8R P;  3GOD A;  1VQM O;  4XTK A;  3CC4 L;  2OTJ O;  1VQK O;  3CXC N;  1M90 M;  4N06 A;  3CCL O;  1K8A P;  2YZS A;  1YJ9 L;  5DQZ A;  3OW2 K;  3NKD A;  1YIT L;  5DS5 A;  1M90 P;  1YJ9 O;  3CCE L;  2QEX L;  3CD6 O;  3CCM O;  1KC8 M;  4WJ0 A;  3CCQ O;  1NJI M;  1VQ7 O;  1VQP L;  1VQN L;  3CCE O;  3CCU L;  1YJW O;  1VQ5 L;  2QEX O;  1W2B N;  1VQL L;  3OW2 N;  1Q82 M;  1VQP O;  3I55 L;  1VQ5 O;  3CCJ L;  1K73 P;  3CCS L;  1VQ4 L;  1YHQ O;  1KC8 P;  1NJI P;  4W8K A;  1VQ9 L;  3CC4 O;  1KD1 P;  3CCJ O;  1Q81 M;  3CC2 L;  1YI2 L;  1Q82 P;  1W2B K;  3CC2 O;  1YI2 O;  3CC7 L;  3I56 L;  1K73 M;  3G71 L;  2OTL L;  5DQT A;  1YIT O;  1Q81 P;  1YJN L;  1KD1 M;  3G71 O;  5FCL A;  1Q7Y M;  1VQN O;  1YJN O;  3CCU O;  3CCV L;  1VQL O;  1VQ6 L;  4QDL A;  1QVG K;  3I55 O;  1YIJ L;  3CCV O;  1VQO L;  3CCS O;  3CCR L;  3CPW K;  1S72 L;  1JJ2 K;  1VQ4 O;  1QVF K;  1Q7Y P;  1VQ9 O;  1YIJ O;  3G6E L;  1M1K M;  3CCR O;  2QA4 L;  1VQM L;  5DLJ A;  2OTJ L;  1KQS K;  1QVG N;  3CME L;  1K9M M;  1VQK L;  3CCL L;  2QA4 O;  3CPW N;  1JJ2 N;  1QVF N;  3CC7 O;  3I56 O;  3CME O;  2OTL O;  1M1K P; 
#chains in the Genus database with same CATH homology
 3G4S L;  1KQS N;  1VQ8 L;  1K9M P;  3CMA L;  4P6I C;  1Q86 M;  3G4S O;  3CD6 L;  3CCM L;  3CCQ L;  1VQ6 O;  1N8R M;  1VQ8 O;  3CMA O;  1VQ7 L;  1YJW L;  3CXC K;  1VQO O;  5DS4 A;  1S72 O;  1K8A M;  1Q86 P;  3G6E O;  1YHQ L;  5DS6 A;  1N8R P;  3GOD A;  1VQM O;  4XTK A;  3CC4 L;  2OTJ O;  1VQK O;  3CXC N;  1M90 M;  4N06 A;  3CCL O;  1K8A P;  2YZS A;  1YJ9 L;  5DQZ A;  3OW2 K;  3NKD A;  1YIT L;  5DS5 A;  1M90 P;  1YJ9 O;  3CCE L;  2QEX L;  3CD6 O;  3CCM O;  1KC8 M;  4WJ0 A;  3CCQ O;  1NJI M;  1VQ7 O;  1VQP L;  1VQN L;  3CCE O;  3CCU L;  1YJW O;  1VQ5 L;  2QEX O;  1W2B N;  1VQL L;  3OW2 N;  1Q82 M;  1VQP O;  3I55 L;  1VQ5 O;  3CCJ L;  1K73 P;  3CCS L;  1VQ4 L;  1YHQ O;  1KC8 P;  1NJI P;  4W8K A;  1VQ9 L;  3CC4 O;  1KD1 P;  3CCJ O;  1Q81 M;  3CC2 L;  1YI2 L;  1Q82 P;  1W2B K;  3CC2 O;  1YI2 O;  3CC7 L;  3I56 L;  1K73 M;  3G71 L;  2OTL L;  5DQT A;  1YIT O;  1Q81 P;  1YJN L;  1KD1 M;  3G71 O;  5FCL A;  1Q7Y M;  1VQN O;  1YJN O;  3CCU O;  3CCV L;  1VQL O;  1VQ6 L;  4QDL A;  1QVG K;  3I55 O;  1YIJ L;  3CCV O;  1VQO L;  3CCS O;  3CCR L;  3CPW K;  1S72 L;  1JJ2 K;  1VQ4 O;  1QVF K;  1Q7Y P;  1VQ9 O;  1YIJ O;  3G6E L;  1M1K M;  3CCR O;  2QA4 L;  1VQM L;  5DLJ A;  2OTJ L;  1KQS K;  1QVG N;  3CME L;  1K9M M;  1VQK L;  3CCL L;  2QA4 O;  3CPW N;  1JJ2 N;  1QVF N;  3CC7 O;  3I56 O;  3CME O;  2OTL O;  1M1K P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...