3G6EO

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3g6eO00
1KQSK 3I55O 3CCRO 1KQSN 3G4SO 1YITO 1VQ6O 1KD1P 3CCRL 1K8AP 3CC7O 1YI2L 1JJ2N 1YJWO 3CCMO 1VQNL 3G4SL 3CC7L 3CCLL 3CCUO 1YJWL 1M90P 1VQ8L 3CC4L 3CMEO 3CCJO 1KD1M 1YHQO 1VQ7L 3CMEL 1Q86M 1K9MM 2OTJO 1VQPL 3OW2K 1YHQL 1VQLL 3OW2N 2QA4O 2QEXL 3CCEO 2OTLL 3I56L 1JJ2K 3I55L 1VQOO 1VQKO 1S72O 1Q81P 1YJNO 1VQ9O 1YITL 1VQ6L 1Q86P 1VQOL 1K9MP 1S72L 1M1KM 3CCML 3CXCK 3CMAO 3CD6O 3CCUL 1Q81M 3G71O 3CXCN 3CCVO 3CCSO 3CCJL 3G71L 3CCVL 2OTJL 1M1KP 1KC8M 1W2BK 3CCQO 2QA4L 1VQMO 1N8RM 3CCEL 1W2BN 1Q82M 3CC2O 1VQKL 1VQML 1NJIP 1Q7YM 1YJNL 1YIJO 1VQ9L 1YJ9O 3CC2L 3CPWK 1QVFK 1KC8P 3CPWN 1YIJL 1VQ5O 1YJ9L 1QVFN 3CMAL 1K73M 3CD6L 1QVGN 1N8RP 1NJIM 1YI2O 1VQNO 1VQ5L 1Q82P 3CCSL 1Q7YP 3CCLO 1VQ8O 3CC4O 1VQ7O 3G6EO 1VQ4O 3CCQL 1K73P 1VQPO 1K8AM 3G6EL 1VQLO 1VQ4L 2QEXO 2OTLO 3I56O 1M90M 1QVGK
chains in the Genus database with same CATH superfamily
1KQSK 3I55O 3CCRO 1KQSN 3G4SO 1YITO 1VQ6O 1KD1P 3CCRL 1K8AP 3CC7O 1YI2L 1JJ2N 1YJWO 3CCMO 1VQNL 3G4SL 3CC7L 3CCLL 3CCUO 1YJWL 1M90P 1VQ8L 3CC4L 3CMEO 3CCJO 1KD1M 1YHQO 1VQ7L 3CMEL 1Q86M 1K9MM 2OTJO 1VQPL 3OW2K 5FCLA 1YHQL 1VQLL 3OW2N 2QA4O 2QEXL 3CCEO 2OTLL 3I56L 1JJ2K 3I55L 1VQOO 1VQKO 1S72O 1Q81P 1YJNO 1VQ9O 1YITL 1VQ6L 1Q86P 1VQOL 1K9MP 4P6IC 1S72L 3GODA 1M1KM 3CCML 3CXCK 3CMAO 3CD6O 3CCUL 1Q81M 3G71O 3CXCN 3CCVO 3CCSO 3CCJL 3G71L 3CCVL 4QDLA 2OTJL 1M1KP 1KC8M 5DQTA 1W2BK 3CCQO 2QA4L 1VQMO 1N8RM 3CCEL 1W2BN 1Q82M 3CC2O 1VQKL 1VQML 1NJIP 1Q7YM 5DS4A 1YJNL 1YIJO 1VQ9L 1YJ9O 3CC2L 3CPWK 4XTKA 1QVFK 1KC8P 3CPWN 1YIJL 1VQ5O 1YJ9L 1QVFN 3CMAL 2YZSA 1K73M 3CD6L 1QVGN 1N8RP 1NJIM 1YI2O 1VQNO 1VQ5L 1Q82P 3CCSL 4W8KA 5DS6A 1Q7YP 3CCLO 4WJ0A 1VQ8O 3CC4O 1VQ7O 3G6EO 1VQ4O 4N06A 3CCQL 1K73P 1VQPO 1K8AM 3G6EL 1VQLO 1VQ4L 3NKDA 5DQZA 5DS5A 5DLJA 2QEXO 2OTLO 3I56O 1M90M 1QVGK
chains in the Genus database with same CATH topology
1KQSK 3I55O 3CCRO 1KQSN 3G4SO 1YITO 1VQ6O 1KD1P 3CCRL 1K8AP 3CC7O 1YI2L 1JJ2N 1YJWO 3CCMO 1VQNL 3G4SL 3CC7L 3CCLL 3CCUO 1YJWL 1M90P 1VQ8L 3CC4L 3CMEO 3CCJO 1KD1M 1YHQO 1VQ7L 3CMEL 1Q86M 1K9MM 2OTJO 1VQPL 3OW2K 5FCLA 1YHQL 1VQLL 3OW2N 2QA4O 2QEXL 3CCEO 2OTLL 3I56L 1JJ2K 3I55L 1VQOO 1VQKO 1S72O 1Q81P 1YJNO 1VQ9O 1YITL 1VQ6L 1Q86P 1VQOL 1K9MP 4P6IC 1S72L 3GODA 1M1KM 3CCML 3CXCK 3CMAO 3CD6O 3CCUL 1Q81M 3G71O 3CXCN 3CCVO 3CCSO 3CCJL 3G71L 3CCVL 4QDLA 2OTJL 1M1KP 1KC8M 5DQTA 1W2BK 3CCQO 2QA4L 1VQMO 1N8RM 3CCEL 1W2BN 1Q82M 3CC2O 1VQKL 1VQML 1NJIP 1Q7YM 5DS4A 1YJNL 1YIJO 1VQ9L 1YJ9O 3CC2L 3CPWK 4XTKA 1QVFK 1KC8P 3CPWN 1YIJL 1VQ5O 1YJ9L 1QVFN 3CMAL 2YZSA 1K73M 3CD6L 1QVGN 1N8RP 1NJIM 1YI2O 1VQNO 1VQ5L 1Q82P 3CCSL 4W8KA 5DS6A 1Q7YP 3CCLO 4WJ0A 1VQ8O 3CC4O 1VQ7O 3G6EO 1VQ4O 4N06A 3CCQL 1K73P 1VQPO 1K8AM 3G6EL 1VQLO 1VQ4L 3NKDA 5DQZA 5DS5A 5DLJA 2QEXO 2OTLO 3I56O 1M90M 1QVGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS K;  3I55 O;  3CCR O;  1KQS N;  3G4S O;  1YIT O;  1VQ6 O;  1KD1 P;  3CCR L;  1K8A P;  3CC7 O;  1YI2 L;  1JJ2 N;  1YJW O;  3CCM O;  1VQN L;  3G4S L;  3CC7 L;  3CCL L;  3CCU O;  1YJW L;  1M90 P;  1VQ8 L;  3CC4 L;  3CME O;  3CCJ O;  1KD1 M;  1YHQ O;  1VQ7 L;  3CME L;  1Q86 M;  1K9M M;  2OTJ O;  1VQP L;  3OW2 K;  1YHQ L;  1VQL L;  3OW2 N;  2QA4 O;  2QEX L;  3CCE O;  2OTL L;  3I56 L;  1JJ2 K;  3I55 L;  1VQO O;  1VQK O;  1S72 O;  1Q81 P;  1YJN O;  1VQ9 O;  1YIT L;  1VQ6 L;  1Q86 P;  1VQO L;  1K9M P;  1S72 L;  1M1K M;  3CCM L;  3CXC K;  3CMA O;  3CD6 O;  3CCU L;  1Q81 M;  3G71 O;  3CXC N;  3CCV O;  3CCS O;  3CCJ L;  3G71 L;  3CCV L;  2OTJ L;  1M1K P;  1KC8 M;  1W2B K;  3CCQ O;  2QA4 L;  1VQM O;  1N8R M;  3CCE L;  1W2B N;  1Q82 M;  3CC2 O;  1VQK L;  1VQM L;  1NJI P;  1Q7Y M;  1YJN L;  1YIJ O;  1VQ9 L;  1YJ9 O;  3CC2 L;  3CPW K;  1QVF K;  1KC8 P;  3CPW N;  1YIJ L;  1VQ5 O;  1YJ9 L;  1QVF N;  3CMA L;  1K73 M;  3CD6 L;  1QVG N;  1N8R P;  1NJI M;  1YI2 O;  1VQN O;  1VQ5 L;  1Q82 P;  3CCS L;  1Q7Y P;  3CCL O;  1VQ8 O;  3CC4 O;  1VQ7 O;  3G6E O;  1VQ4 O;  3CCQ L;  1K73 P;  1VQP O;  1K8A M;  3G6E L;  1VQL O;  1VQ4 L;  2QEX O;  2OTL O;  3I56 O;  1M90 M;  1QVG K; 
#chains in the Genus database with same CATH topology
 1KQS K;  3I55 O;  3CCR O;  1KQS N;  3G4S O;  1YIT O;  1VQ6 O;  1KD1 P;  3CCR L;  1K8A P;  3CC7 O;  1YI2 L;  1JJ2 N;  1YJW O;  3CCM O;  1VQN L;  3G4S L;  3CC7 L;  3CCL L;  3CCU O;  1YJW L;  1M90 P;  1VQ8 L;  3CC4 L;  3CME O;  3CCJ O;  1KD1 M;  1YHQ O;  1VQ7 L;  3CME L;  1Q86 M;  1K9M M;  2OTJ O;  1VQP L;  3OW2 K;  5FCL A;  1YHQ L;  1VQL L;  3OW2 N;  2QA4 O;  2QEX L;  3CCE O;  2OTL L;  3I56 L;  1JJ2 K;  3I55 L;  1VQO O;  1VQK O;  1S72 O;  1Q81 P;  1YJN O;  1VQ9 O;  1YIT L;  1VQ6 L;  1Q86 P;  1VQO L;  1K9M P;  4P6I C;  1S72 L;  3GOD A;  1M1K M;  3CCM L;  3CXC K;  3CMA O;  3CD6 O;  3CCU L;  1Q81 M;  3G71 O;  3CXC N;  3CCV O;  3CCS O;  3CCJ L;  3G71 L;  3CCV L;  4QDL A;  2OTJ L;  1M1K P;  1KC8 M;  5DQT A;  1W2B K;  3CCQ O;  2QA4 L;  1VQM O;  1N8R M;  3CCE L;  1W2B N;  1Q82 M;  3CC2 O;  1VQK L;  1VQM L;  1NJI P;  1Q7Y M;  5DS4 A;  1YJN L;  1YIJ O;  1VQ9 L;  1YJ9 O;  3CC2 L;  3CPW K;  4XTK A;  1QVF K;  1KC8 P;  3CPW N;  1YIJ L;  1VQ5 O;  1YJ9 L;  1QVF N;  3CMA L;  2YZS A;  1K73 M;  3CD6 L;  1QVG N;  1N8R P;  1NJI M;  1YI2 O;  1VQN O;  1VQ5 L;  1Q82 P;  3CCS L;  4W8K A;  5DS6 A;  1Q7Y P;  3CCL O;  4WJ0 A;  1VQ8 O;  3CC4 O;  1VQ7 O;  3G6E O;  1VQ4 O;  4N06 A;  3CCQ L;  1K73 P;  1VQP O;  1K8A M;  3G6E L;  1VQL O;  1VQ4 L;  3NKD A;  5DQZ A;  5DS5 A;  5DLJ A;  2QEX O;  2OTL O;  3I56 O;  1M90 M;  1QVG K; 
#chains in the Genus database with same CATH homology
 1KQS K;  3I55 O;  3CCR O;  1KQS N;  3G4S O;  1YIT O;  1VQ6 O;  1KD1 P;  3CCR L;  1K8A P;  3CC7 O;  1YI2 L;  1JJ2 N;  1YJW O;  3CCM O;  1VQN L;  3G4S L;  3CC7 L;  3CCL L;  3CCU O;  1YJW L;  1M90 P;  1VQ8 L;  3CC4 L;  3CME O;  3CCJ O;  1KD1 M;  1YHQ O;  1VQ7 L;  3CME L;  1Q86 M;  1K9M M;  2OTJ O;  1VQP L;  3OW2 K;  5FCL A;  1YHQ L;  1VQL L;  3OW2 N;  2QA4 O;  2QEX L;  3CCE O;  2OTL L;  3I56 L;  1JJ2 K;  3I55 L;  1VQO O;  1VQK O;  1S72 O;  1Q81 P;  1YJN O;  1VQ9 O;  1YIT L;  1VQ6 L;  1Q86 P;  1VQO L;  1K9M P;  4P6I C;  1S72 L;  3GOD A;  1M1K M;  3CCM L;  3CXC K;  3CMA O;  3CD6 O;  3CCU L;  1Q81 M;  3G71 O;  3CXC N;  3CCV O;  3CCS O;  3CCJ L;  3G71 L;  3CCV L;  4QDL A;  2OTJ L;  1M1K P;  1KC8 M;  5DQT A;  1W2B K;  3CCQ O;  2QA4 L;  1VQM O;  1N8R M;  3CCE L;  1W2B N;  1Q82 M;  3CC2 O;  1VQK L;  1VQM L;  1NJI P;  1Q7Y M;  5DS4 A;  1YJN L;  1YIJ O;  1VQ9 L;  1YJ9 O;  3CC2 L;  3CPW K;  4XTK A;  1QVF K;  1KC8 P;  3CPW N;  1YIJ L;  1VQ5 O;  1YJ9 L;  1QVF N;  3CMA L;  2YZS A;  1K73 M;  3CD6 L;  1QVG N;  1N8R P;  1NJI M;  1YI2 O;  1VQN O;  1VQ5 L;  1Q82 P;  3CCS L;  4W8K A;  5DS6 A;  1Q7Y P;  3CCL O;  4WJ0 A;  1VQ8 O;  3CC4 O;  1VQ7 O;  3G6E O;  1VQ4 O;  4N06 A;  3CCQ L;  1K73 P;  1VQP O;  1K8A M;  3G6E L;  1VQL O;  1VQ4 L;  3NKD A;  5DQZ A;  5DS5 A;  5DLJ A;  2QEX O;  2OTL O;  3I56 O;  1M90 M;  1QVG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...