3CMEO

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cmeO00
1YIJO 2OTJL 3G71L 1JJ2K 1VQNO 3CC2O 1VQML 1QVFN 1K9MP 3CCVL 1Q86M 1VQ7L 1Q7YP 2OTJO 3G71O 1YJNO 3G6EL 3CD6O 1Q82P 1W2BK 1K73P 1VQPL 3CCVO 3CMEL 1VQKL 3CC7L 3CCRO 3CCQL 1VQ5O 1KD1P 1YHQL 2OTLL 2QA4O 3CCJL 3I56L 1QVGN 1KC8M 1YITO 1QVFK 1M1KM 3G4SL 1VQ6O 1VQ8L 3OW2N 1N8RM 1Q86P 2QEXL 1VQOL 1Q81M 3I56O 3CCSL 3I55L 1YJ9L 3CPWN 1VQMO 3CXCN 1VQ8O 1S72L 1VQ7O 3G6EO 1NJIM 3CCEL 1YJ9O 1VQPO 3CCUL 1YI2L 1QVGK 1K8AM 1M90M 3CMEO 1VQKO 1VQ9L 3CC7O 3CCQO 1VQ4L 1KC8P 1YJWL 1YHQO 3CMAL 3OW2K 1KQSN 1M1KP 2OTLO 3CCJO 1N8RP 1Q81P 3CPWK 1VQ4O 3G4SO 3CCLL 2QEXO 1VQOO 3CCSO 1YJNL 1JJ2N 3I55O 3CD6L 1K9MM 1NJIP 1VQLL 1Q7YM 1S72O 3CCLO 1K8AP 1M90P 3CCRL 1VQ5L 1KQSK 1Q82M 3CCEO 2QA4L 1K73M 3CCML 3CC4L 3CCUO 1YI2O 1YIJL 1W2BN 1VQLO 1VQ9O 1VQNL 3CC2L 1KD1M 3CXCK 1YITL 1YJWO 3CMAO 1VQ6L 3CC4O 3CCMO
chains in the Genus database with same CATH superfamily
1YIJO 2OTJL 3G71L 1JJ2K 1VQNO 3CC2O 1VQML 1QVFN 1K9MP 3CCVL 1Q86M 1VQ7L 1Q7YP 2OTJO 3G71O 1YJNO 3G6EL 4P6IC 4N06A 1Q82P 3CD6O 1W2BK 1K73P 1VQPL 3CCVO 3CMEL 1VQKL 3CC7L 3CCRO 3CCQL 1VQ5O 1KD1P 5DLJA 1YHQL 2OTLL 2QA4O 3CCJL 5DS6A 3I56L 1QVGN 1KC8M 1YITO 5FCLA 1QVFK 1M1KM 4W8KA 3G4SL 1VQ6O 1VQ8L 3OW2N 1N8RM 5DQTA 1Q86P 2QEXL 1VQOL 2YZSA 4QDLA 1Q81M 3I56O 3CCSL 3I55L 1YJ9L 5DS5A 3CPWN 1VQMO 3CXCN 1VQ8O 1S72L 1VQ7O 3GODA 3G6EO 1NJIM 3CCEL 1YJ9O 1VQPO 3CCUL 1YI2L 1QVGK 1K8AM 1M90M 3CMEO 1VQKO 1VQ9L 3CC7O 3CCQO 1VQ4L 1KC8P 1YJWL 1YHQO 3CMAL 3OW2K 1KQSN 1M1KP 2OTLO 3CCJO 1N8RP 5DQZA 1Q81P 3CPWK 1VQ4O 3G4SO 3CCLL 2QEXO 1VQOO 3CCSO 1YJNL 1JJ2N 3I55O 3CD6L 1K9MM 1NJIP 5DS4A 1VQLL 1Q7YM 1S72O 3CCLO 1K8AP 1M90P 3CCRL 1VQ5L 1KQSK 1Q82M 3CCEO 4WJ0A 2QA4L 1K73M 3CCML 3CC4L 3CCUO 1YI2O 1YIJL 1W2BN 1VQLO 4XTKA 1VQ9O 1VQNL 3CC2L 1KD1M 3NKDA 3CXCK 1YITL 1YJWO 3CMAO 1VQ6L 3CC4O 3CCMO
chains in the Genus database with same CATH topology
1YIJO 2OTJL 3G71L 1JJ2K 1VQNO 3CC2O 1VQML 1QVFN 1K9MP 3CCVL 1Q86M 1VQ7L 1Q7YP 2OTJO 3G71O 1YJNO 3G6EL 4P6IC 4N06A 1Q82P 3CD6O 1W2BK 1K73P 1VQPL 3CCVO 3CMEL 1VQKL 3CC7L 3CCRO 3CCQL 1VQ5O 1KD1P 5DLJA 1YHQL 2OTLL 2QA4O 3CCJL 5DS6A 3I56L 1QVGN 1KC8M 1YITO 5FCLA 1QVFK 1M1KM 4W8KA 3G4SL 1VQ6O 1VQ8L 3OW2N 1N8RM 5DQTA 1Q86P 2QEXL 1VQOL 2YZSA 4QDLA 1Q81M 3I56O 3CCSL 3I55L 1YJ9L 5DS5A 3CPWN 1VQMO 3CXCN 1VQ8O 1S72L 1VQ7O 3GODA 3G6EO 1NJIM 3CCEL 1YJ9O 1VQPO 3CCUL 1YI2L 1QVGK 1K8AM 1M90M 3CMEO 1VQKO 1VQ9L 3CC7O 3CCQO 1VQ4L 1KC8P 1YJWL 1YHQO 3CMAL 3OW2K 1KQSN 1M1KP 2OTLO 3CCJO 1N8RP 5DQZA 1Q81P 3CPWK 1VQ4O 3G4SO 3CCLL 2QEXO 1VQOO 3CCSO 1YJNL 1JJ2N 3I55O 3CD6L 1K9MM 1NJIP 5DS4A 1VQLL 1Q7YM 1S72O 3CCLO 1K8AP 1M90P 3CCRL 1VQ5L 1KQSK 1Q82M 3CCEO 4WJ0A 2QA4L 1K73M 3CCML 3CC4L 3CCUO 1YI2O 1YIJL 1W2BN 1VQLO 4XTKA 1VQ9O 1VQNL 3CC2L 1KD1M 3NKDA 3CXCK 1YITL 1YJWO 3CMAO 1VQ6L 3CC4O 3CCMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ O;  2OTJ L;  3G71 L;  1JJ2 K;  1VQN O;  3CC2 O;  1VQM L;  1QVF N;  1K9M P;  3CCV L;  1Q86 M;  1VQ7 L;  1Q7Y P;  2OTJ O;  3G71 O;  1YJN O;  3G6E L;  3CD6 O;  1Q82 P;  1W2B K;  1K73 P;  1VQP L;  3CCV O;  3CME L;  1VQK L;  3CC7 L;  3CCR O;  3CCQ L;  1VQ5 O;  1KD1 P;  1YHQ L;  2OTL L;  2QA4 O;  3CCJ L;  3I56 L;  1QVG N;  1KC8 M;  1YIT O;  1QVF K;  1M1K M;  3G4S L;  1VQ6 O;  1VQ8 L;  3OW2 N;  1N8R M;  1Q86 P;  2QEX L;  1VQO L;  1Q81 M;  3I56 O;  3CCS L;  3I55 L;  1YJ9 L;  3CPW N;  1VQM O;  3CXC N;  1VQ8 O;  1S72 L;  1VQ7 O;  3G6E O;  1NJI M;  3CCE L;  1YJ9 O;  1VQP O;  3CCU L;  1YI2 L;  1QVG K;  1K8A M;  1M90 M;  3CME O;  1VQK O;  1VQ9 L;  3CC7 O;  3CCQ O;  1VQ4 L;  1KC8 P;  1YJW L;  1YHQ O;  3CMA L;  3OW2 K;  1KQS N;  1M1K P;  2OTL O;  3CCJ O;  1N8R P;  1Q81 P;  3CPW K;  1VQ4 O;  3G4S O;  3CCL L;  2QEX O;  1VQO O;  3CCS O;  1YJN L;  1JJ2 N;  3I55 O;  3CD6 L;  1K9M M;  1NJI P;  1VQL L;  1Q7Y M;  1S72 O;  3CCL O;  1K8A P;  1M90 P;  3CCR L;  1VQ5 L;  1KQS K;  1Q82 M;  3CCE O;  2QA4 L;  1K73 M;  3CCM L;  3CC4 L;  3CCU O;  1YI2 O;  1YIJ L;  1W2B N;  1VQL O;  1VQ9 O;  1VQN L;  3CC2 L;  1KD1 M;  3CXC K;  1YIT L;  1YJW O;  3CMA O;  1VQ6 L;  3CC4 O;  3CCM O; 
#chains in the Genus database with same CATH topology
 1YIJ O;  2OTJ L;  3G71 L;  1JJ2 K;  1VQN O;  3CC2 O;  1VQM L;  1QVF N;  1K9M P;  3CCV L;  1Q86 M;  1VQ7 L;  1Q7Y P;  2OTJ O;  3G71 O;  1YJN O;  3G6E L;  4P6I C;  4N06 A;  1Q82 P;  3CD6 O;  1W2B K;  1K73 P;  1VQP L;  3CCV O;  3CME L;  1VQK L;  3CC7 L;  3CCR O;  3CCQ L;  1VQ5 O;  1KD1 P;  5DLJ A;  1YHQ L;  2OTL L;  2QA4 O;  3CCJ L;  5DS6 A;  3I56 L;  1QVG N;  1KC8 M;  1YIT O;  5FCL A;  1QVF K;  1M1K M;  4W8K A;  3G4S L;  1VQ6 O;  1VQ8 L;  3OW2 N;  1N8R M;  5DQT A;  1Q86 P;  2QEX L;  1VQO L;  2YZS A;  4QDL A;  1Q81 M;  3I56 O;  3CCS L;  3I55 L;  1YJ9 L;  5DS5 A;  3CPW N;  1VQM O;  3CXC N;  1VQ8 O;  1S72 L;  1VQ7 O;  3GOD A;  3G6E O;  1NJI M;  3CCE L;  1YJ9 O;  1VQP O;  3CCU L;  1YI2 L;  1QVG K;  1K8A M;  1M90 M;  3CME O;  1VQK O;  1VQ9 L;  3CC7 O;  3CCQ O;  1VQ4 L;  1KC8 P;  1YJW L;  1YHQ O;  3CMA L;  3OW2 K;  1KQS N;  1M1K P;  2OTL O;  3CCJ O;  1N8R P;  5DQZ A;  1Q81 P;  3CPW K;  1VQ4 O;  3G4S O;  3CCL L;  2QEX O;  1VQO O;  3CCS O;  1YJN L;  1JJ2 N;  3I55 O;  3CD6 L;  1K9M M;  1NJI P;  5DS4 A;  1VQL L;  1Q7Y M;  1S72 O;  3CCL O;  1K8A P;  1M90 P;  3CCR L;  1VQ5 L;  1KQS K;  1Q82 M;  3CCE O;  4WJ0 A;  2QA4 L;  1K73 M;  3CCM L;  3CC4 L;  3CCU O;  1YI2 O;  1YIJ L;  1W2B N;  1VQL O;  4XTK A;  1VQ9 O;  1VQN L;  3CC2 L;  1KD1 M;  3NKD A;  3CXC K;  1YIT L;  1YJW O;  3CMA O;  1VQ6 L;  3CC4 O;  3CCM O; 
#chains in the Genus database with same CATH homology
 1YIJ O;  2OTJ L;  3G71 L;  1JJ2 K;  1VQN O;  3CC2 O;  1VQM L;  1QVF N;  1K9M P;  3CCV L;  1Q86 M;  1VQ7 L;  1Q7Y P;  2OTJ O;  3G71 O;  1YJN O;  3G6E L;  4P6I C;  4N06 A;  1Q82 P;  3CD6 O;  1W2B K;  1K73 P;  1VQP L;  3CCV O;  3CME L;  1VQK L;  3CC7 L;  3CCR O;  3CCQ L;  1VQ5 O;  1KD1 P;  5DLJ A;  1YHQ L;  2OTL L;  2QA4 O;  3CCJ L;  5DS6 A;  3I56 L;  1QVG N;  1KC8 M;  1YIT O;  5FCL A;  1QVF K;  1M1K M;  4W8K A;  3G4S L;  1VQ6 O;  1VQ8 L;  3OW2 N;  1N8R M;  5DQT A;  1Q86 P;  2QEX L;  1VQO L;  2YZS A;  4QDL A;  1Q81 M;  3I56 O;  3CCS L;  3I55 L;  1YJ9 L;  5DS5 A;  3CPW N;  1VQM O;  3CXC N;  1VQ8 O;  1S72 L;  1VQ7 O;  3GOD A;  3G6E O;  1NJI M;  3CCE L;  1YJ9 O;  1VQP O;  3CCU L;  1YI2 L;  1QVG K;  1K8A M;  1M90 M;  3CME O;  1VQK O;  1VQ9 L;  3CC7 O;  3CCQ O;  1VQ4 L;  1KC8 P;  1YJW L;  1YHQ O;  3CMA L;  3OW2 K;  1KQS N;  1M1K P;  2OTL O;  3CCJ O;  1N8R P;  5DQZ A;  1Q81 P;  3CPW K;  1VQ4 O;  3G4S O;  3CCL L;  2QEX O;  1VQO O;  3CCS O;  1YJN L;  1JJ2 N;  3I55 O;  3CD6 L;  1K9M M;  1NJI P;  5DS4 A;  1VQL L;  1Q7Y M;  1S72 O;  3CCL O;  1K8A P;  1M90 P;  3CCR L;  1VQ5 L;  1KQS K;  1Q82 M;  3CCE O;  4WJ0 A;  2QA4 L;  1K73 M;  3CCM L;  3CC4 L;  3CCU O;  1YI2 O;  1YIJ L;  1W2B N;  1VQL O;  4XTK A;  1VQ9 O;  1VQN L;  3CC2 L;  1KD1 M;  3NKD A;  3CXC K;  1YIT L;  1YJW O;  3CMA O;  1VQ6 L;  3CC4 O;  3CCM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...