1VQNO

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqnO00
1QVFK 1YITO 1KD1M 1KC8P 1YI2L 1YHQL 3CCEL 3I56O 1YJWO 2OTJL 1K8AP 1VQKO 3CC2L 3CCLO 3CPWK 1N8RP 3CCVL 1VQMO 1Q81M 3CCMO 1VQ4L 1YIJO 3CCRO 1JJ2N 3I55L 3OW2N 1QVGK 3CXCK 3CMEO 3CCQO 1KQSN 1K9MM 1VQ7L 2OTLO 3G71O 1M90M 1QVFN 3G4SL 3CC7O 1M1KM 1W2BK 1YJ9L 1VQOL 3CCUL 1VQ8O 2QEXL 1VQNL 3CC4O 3CCJO 3CPWN 1NJIM 3CD6L 3I56L 1VQPO 2QA4O 1YJNO 1KD1P 3CCLL 1VQ6O 3CMAL 1Q86M 1VQML 1S72O 3CCML 1QVGN 1YI2O 3CXCN 1YIJL 1Q82M 1VQLO 3CCEO 1Q81P 3CMEL 1Q7YM 3CCQL 1Q86P 2OTLL 3G71L 1K73M 1VQ9O 1YITL 1VQ5O 1K9MP 3CC7L 3CCSO 1JJ2K 1VQ8L 3OW2K 1M90P 3CC4L 1YJWL 3G6EO 1KC8M 1M1KP 1VQKL 1K73P 1VQPL 1K8AM 2QA4L 1YJNL 1YHQO 1N8RM 3CCRL 1VQ6L 1NJIP 2OTJO 3CC2O 1S72L 1VQLL 3CD6O 3CCVO 1VQ4O 1W2BN 3I55O 1Q82P 3CMAO 1VQ9L 1Q7YP 1VQ5L 1VQ7O 3CCJL 3CCSL 1KQSK 3G4SO 3G6EL 1YJ9O 1VQOO 3CCUO 2QEXO 1VQNO
chains in the Genus database with same CATH superfamily
1QVFK 5DQZA 1YITO 1KD1M 1KC8P 1YI2L 1YHQL 3CCEL 3I56O 1YJWO 2OTJL 1K8AP 1VQKO 3CC2L 3CCLO 3CPWK 1N8RP 3CCVL 1VQMO 1Q81M 3CCMO 1VQ4L 1YIJO 3CCRO 1JJ2N 3I55L 3OW2N 1QVGK 3CXCK 3CMEO 5DLJA 3CCQO 1KQSN 1K9MM 1VQ7L 2OTLO 3G71O 5DS4A 1M90M 1QVFN 3G4SL 3CC7O 1M1KM 1W2BK 5FCLA 1YJ9L 1VQOL 3CCUL 1VQ8O 2QEXL 1VQNL 3CC4O 5DS5A 3CCJO 3CPWN 2YZSA 1NJIM 3CD6L 3I56L 1VQPO 2QA4O 1YJNO 1KD1P 3CCLL 1VQ6O 3GODA 3CMAL 1Q86M 1VQML 1S72O 3CCML 1QVGN 1YI2O 3CXCN 1YIJL 1Q82M 4P6IC 1VQLO 3CCEO 1Q81P 3CMEL 4W8KA 1Q7YM 3CCQL 4QDLA 1Q86P 2OTLL 3G71L 1K73M 1VQ9O 1YITL 1VQ5O 1K9MP 3CC7L 3CCSO 1JJ2K 1VQ8L 3OW2K 1M90P 3CC4L 1YJWL 3G6EO 1KC8M 1M1KP 1VQKL 5DQTA 1K73P 1VQPL 1K8AM 2QA4L 1YJNL 1YHQO 1N8RM 3CCRL 1VQ6L 1NJIP 2OTJO 4XTKA 3CC2O 1S72L 1VQLL 4N06A 3CD6O 3CCVO 1VQ4O 1W2BN 5DS6A 3I55O 1Q82P 3CMAO 3NKDA 4WJ0A 1VQ9L 1Q7YP 1VQ5L 1VQ7O 3CCJL 3CCSL 1KQSK 3G4SO 3G6EL 1YJ9O 1VQOO 3CCUO 2QEXO 1VQNO
chains in the Genus database with same CATH topology
1QVFK 5DQZA 1YITO 1KD1M 1KC8P 1YI2L 1YHQL 3CCEL 3I56O 1YJWO 2OTJL 1K8AP 1VQKO 3CC2L 3CCLO 3CPWK 1N8RP 3CCVL 1VQMO 1Q81M 3CCMO 1VQ4L 1YIJO 3CCRO 1JJ2N 3I55L 3OW2N 1QVGK 3CXCK 3CMEO 5DLJA 3CCQO 1KQSN 1K9MM 1VQ7L 2OTLO 3G71O 5DS4A 1M90M 1QVFN 3G4SL 3CC7O 1M1KM 1W2BK 5FCLA 1YJ9L 1VQOL 3CCUL 1VQ8O 2QEXL 1VQNL 3CC4O 5DS5A 3CCJO 3CPWN 2YZSA 1NJIM 3CD6L 3I56L 1VQPO 2QA4O 1YJNO 1KD1P 3CCLL 1VQ6O 3GODA 3CMAL 1Q86M 1VQML 1S72O 3CCML 1QVGN 1YI2O 3CXCN 1YIJL 1Q82M 4P6IC 1VQLO 3CCEO 1Q81P 3CMEL 4W8KA 1Q7YM 3CCQL 4QDLA 1Q86P 2OTLL 3G71L 1K73M 1VQ9O 1YITL 1VQ5O 1K9MP 3CC7L 3CCSO 1JJ2K 1VQ8L 3OW2K 1M90P 3CC4L 1YJWL 3G6EO 1KC8M 1M1KP 1VQKL 5DQTA 1K73P 1VQPL 1K8AM 2QA4L 1YJNL 1YHQO 1N8RM 3CCRL 1VQ6L 1NJIP 2OTJO 4XTKA 3CC2O 1S72L 1VQLL 4N06A 3CD6O 3CCVO 1VQ4O 1W2BN 5DS6A 3I55O 1Q82P 3CMAO 3NKDA 4WJ0A 1VQ9L 1Q7YP 1VQ5L 1VQ7O 3CCJL 3CCSL 1KQSK 3G4SO 3G6EL 1YJ9O 1VQOO 3CCUO 2QEXO 1VQNO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF K;  1YIT O;  1KD1 M;  1KC8 P;  1YI2 L;  1YHQ L;  3CCE L;  3I56 O;  1YJW O;  2OTJ L;  1K8A P;  1VQK O;  3CC2 L;  3CCL O;  3CPW K;  1N8R P;  3CCV L;  1VQM O;  1Q81 M;  3CCM O;  1VQ4 L;  1YIJ O;  3CCR O;  1JJ2 N;  3I55 L;  3OW2 N;  1QVG K;  3CXC K;  3CME O;  3CCQ O;  1KQS N;  1K9M M;  1VQ7 L;  2OTL O;  3G71 O;  1M90 M;  1QVF N;  3G4S L;  3CC7 O;  1M1K M;  1W2B K;  1YJ9 L;  1VQO L;  3CCU L;  1VQ8 O;  2QEX L;  1VQN L;  3CC4 O;  3CCJ O;  3CPW N;  1NJI M;  3CD6 L;  3I56 L;  1VQP O;  2QA4 O;  1YJN O;  1KD1 P;  3CCL L;  1VQ6 O;  3CMA L;  1Q86 M;  1VQM L;  1S72 O;  3CCM L;  1QVG N;  1YI2 O;  3CXC N;  1YIJ L;  1Q82 M;  1VQL O;  3CCE O;  1Q81 P;  3CME L;  1Q7Y M;  3CCQ L;  1Q86 P;  2OTL L;  3G71 L;  1K73 M;  1VQ9 O;  1YIT L;  1VQ5 O;  1K9M P;  3CC7 L;  3CCS O;  1JJ2 K;  1VQ8 L;  3OW2 K;  1M90 P;  3CC4 L;  1YJW L;  3G6E O;  1KC8 M;  1M1K P;  1VQK L;  1K73 P;  1VQP L;  1K8A M;  2QA4 L;  1YJN L;  1YHQ O;  1N8R M;  3CCR L;  1VQ6 L;  1NJI P;  2OTJ O;  3CC2 O;  1S72 L;  1VQL L;  3CD6 O;  3CCV O;  1VQ4 O;  1W2B N;  3I55 O;  1Q82 P;  3CMA O;  1VQ9 L;  1Q7Y P;  1VQ5 L;  1VQ7 O;  3CCJ L;  3CCS L;  1KQS K;  3G4S O;  3G6E L;  1YJ9 O;  1VQO O;  3CCU O;  2QEX O;  1VQN O; 
#chains in the Genus database with same CATH topology
 1QVF K;  5DQZ A;  1YIT O;  1KD1 M;  1KC8 P;  1YI2 L;  1YHQ L;  3CCE L;  3I56 O;  1YJW O;  2OTJ L;  1K8A P;  1VQK O;  3CC2 L;  3CCL O;  3CPW K;  1N8R P;  3CCV L;  1VQM O;  1Q81 M;  3CCM O;  1VQ4 L;  1YIJ O;  3CCR O;  1JJ2 N;  3I55 L;  3OW2 N;  1QVG K;  3CXC K;  3CME O;  5DLJ A;  3CCQ O;  1KQS N;  1K9M M;  1VQ7 L;  2OTL O;  3G71 O;  5DS4 A;  1M90 M;  1QVF N;  3G4S L;  3CC7 O;  1M1K M;  1W2B K;  5FCL A;  1YJ9 L;  1VQO L;  3CCU L;  1VQ8 O;  2QEX L;  1VQN L;  3CC4 O;  5DS5 A;  3CCJ O;  3CPW N;  2YZS A;  1NJI M;  3CD6 L;  3I56 L;  1VQP O;  2QA4 O;  1YJN O;  1KD1 P;  3CCL L;  1VQ6 O;  3GOD A;  3CMA L;  1Q86 M;  1VQM L;  1S72 O;  3CCM L;  1QVG N;  1YI2 O;  3CXC N;  1YIJ L;  1Q82 M;  4P6I C;  1VQL O;  3CCE O;  1Q81 P;  3CME L;  4W8K A;  1Q7Y M;  3CCQ L;  4QDL A;  1Q86 P;  2OTL L;  3G71 L;  1K73 M;  1VQ9 O;  1YIT L;  1VQ5 O;  1K9M P;  3CC7 L;  3CCS O;  1JJ2 K;  1VQ8 L;  3OW2 K;  1M90 P;  3CC4 L;  1YJW L;  3G6E O;  1KC8 M;  1M1K P;  1VQK L;  5DQT A;  1K73 P;  1VQP L;  1K8A M;  2QA4 L;  1YJN L;  1YHQ O;  1N8R M;  3CCR L;  1VQ6 L;  1NJI P;  2OTJ O;  4XTK A;  3CC2 O;  1S72 L;  1VQL L;  4N06 A;  3CD6 O;  3CCV O;  1VQ4 O;  1W2B N;  5DS6 A;  3I55 O;  1Q82 P;  3CMA O;  3NKD A;  4WJ0 A;  1VQ9 L;  1Q7Y P;  1VQ5 L;  1VQ7 O;  3CCJ L;  3CCS L;  1KQS K;  3G4S O;  3G6E L;  1YJ9 O;  1VQO O;  3CCU O;  2QEX O;  1VQN O; 
#chains in the Genus database with same CATH homology
 1QVF K;  5DQZ A;  1YIT O;  1KD1 M;  1KC8 P;  1YI2 L;  1YHQ L;  3CCE L;  3I56 O;  1YJW O;  2OTJ L;  1K8A P;  1VQK O;  3CC2 L;  3CCL O;  3CPW K;  1N8R P;  3CCV L;  1VQM O;  1Q81 M;  3CCM O;  1VQ4 L;  1YIJ O;  3CCR O;  1JJ2 N;  3I55 L;  3OW2 N;  1QVG K;  3CXC K;  3CME O;  5DLJ A;  3CCQ O;  1KQS N;  1K9M M;  1VQ7 L;  2OTL O;  3G71 O;  5DS4 A;  1M90 M;  1QVF N;  3G4S L;  3CC7 O;  1M1K M;  1W2B K;  5FCL A;  1YJ9 L;  1VQO L;  3CCU L;  1VQ8 O;  2QEX L;  1VQN L;  3CC4 O;  5DS5 A;  3CCJ O;  3CPW N;  2YZS A;  1NJI M;  3CD6 L;  3I56 L;  1VQP O;  2QA4 O;  1YJN O;  1KD1 P;  3CCL L;  1VQ6 O;  3GOD A;  3CMA L;  1Q86 M;  1VQM L;  1S72 O;  3CCM L;  1QVG N;  1YI2 O;  3CXC N;  1YIJ L;  1Q82 M;  4P6I C;  1VQL O;  3CCE O;  1Q81 P;  3CME L;  4W8K A;  1Q7Y M;  3CCQ L;  4QDL A;  1Q86 P;  2OTL L;  3G71 L;  1K73 M;  1VQ9 O;  1YIT L;  1VQ5 O;  1K9M P;  3CC7 L;  3CCS O;  1JJ2 K;  1VQ8 L;  3OW2 K;  1M90 P;  3CC4 L;  1YJW L;  3G6E O;  1KC8 M;  1M1K P;  1VQK L;  5DQT A;  1K73 P;  1VQP L;  1K8A M;  2QA4 L;  1YJN L;  1YHQ O;  1N8R M;  3CCR L;  1VQ6 L;  1NJI P;  2OTJ O;  4XTK A;  3CC2 O;  1S72 L;  1VQL L;  4N06 A;  3CD6 O;  3CCV O;  1VQ4 O;  1W2B N;  5DS6 A;  3I55 O;  1Q82 P;  3CMA O;  3NKD A;  4WJ0 A;  1VQ9 L;  1Q7Y P;  1VQ5 L;  1VQ7 O;  3CCJ L;  3CCS L;  1KQS K;  3G4S O;  3G6E L;  1YJ9 O;  1VQO O;  3CCU O;  2QEX O;  1VQN O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...