1VQOL

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqoL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vqoL01
2QEXL 1YJNO 1KQSN 1VQ9O 1VQKL 3I55L 1K73M 1KC8M 3CXCN 1KC8P 1M90M 1M90P 2OTJO 1KD1M 1KD1P 1YJ9L 3I56O 3CCEL 1YHQL 3G6EO 1VQ4L 1VQOO 3CC7O 2QEXO 1KQSK 1VQKO 3I55O 1NJIP 1QVFN 1YI2L 1VQ5L 3G4SL 1VQPL 1YJ9O 1W2BN 1K73P 1YIJL 3CMEL 3CCEO 1YHQO 1QVGK 1VQ4O 3CMAL 3CCSL 3CC2L 3OW2N 3CPWK 3CD6L 2QA4L 1VQ6L 1YI2O 1JJ2N 1Q86M 1VQ5O 1Q86P 3CCML 3G4SO 1VQPO 3CCQL 3CXCK 3CMEO 2OTLL 1K8AM 1VQ8L 1VQLL 3CMAO 3G71L 3CCVL 3CCSO 3CC2O 1YJWL 3CCJL 1S72L 3CCUL 3CCLL 3CD6O 2QA4O 1Q7YM 1VQ6O 1Q7YP 1VQNL 1Q82M 1Q82P 1VQOL 3CCRL 1K9MM 1K9MP 3CCMO 1VQML 1VQ7L 1QVFK 3CCQO 2OTLO 1N8RM 1VQ8O 1YITL 3CC4L 1N8RP 1VQLO 1W2BK 3G71O 1YIJO 3CCVO 1Q81M 1YJWO 1Q81P 1K8AP 1YJNL 3CCJO 1S72O 3CCUO 1VQ9L 3CCLO 1VQNO 1QVGN 2OTJL 3OW2K 3CCRO 3I56L 1VQMO 1VQ7O 1M1KM 1M1KP 3G6EL 1JJ2K 3CPWN 3CC7L 1YITO 3CC4O 1NJIM
chains in the Genus database with same CATH superfamily
5DQZA 3GODA 2QEXL 3NKDA 4W8KA 1YJNO 1KQSN 1VQ9O 1VQKL 3I55L 1K73M 1KC8M 3CXCN 4XTKA 1KC8P 1M90M 1M90P 2OTJO 1KD1M 1KD1P 1YJ9L 3I56O 3CCEL 1YHQL 3G6EO 5DQTA 1VQ4L 1VQOO 3CC7O 5DS4A 5DS5A 2QEXO 1KQSK 1VQKO 3I55O 1NJIP 1QVFN 1YI2L 1VQ5L 3G4SL 1VQPL 1YJ9O 1W2BN 1K73P 1YIJL 3CMEL 3CCEO 1YHQO 1QVGK 1VQ4O 4N06A 3CMAL 3CCSL 3CC2L 3OW2N 3CPWK 3CD6L 2QA4L 1VQ6L 1YI2O 5DS6A 1JJ2N 1Q86M 1VQ5O 1Q86P 3CCML 3G4SO 1VQPO 3CCQL 3CXCK 3CMEO 2OTLL 1K8AM 1VQ8L 1VQLL 2YZSA 5DLJA 3CMAO 3G71L 3CCVL 3CCSO 3CC2O 1YJWL 3CCJL 1S72L 3CCUL 3CCLL 3CD6O 2QA4O 1Q7YM 1VQ6O 1Q7YP 1VQNL 1Q82M 1Q82P 4P6IC 1VQOL 3CCRL 1K9MM 1K9MP 3CCMO 1VQML 1VQ7L 1QVFK 3CCQO 2OTLO 1N8RM 1VQ8O 1YITL 3CC4L 1N8RP 1VQLO 1W2BK 3G71O 1YIJO 3CCVO 1Q81M 1YJWO 1Q81P 1K8AP 1YJNL 3CCJO 1S72O 3CCUO 1VQ9L 3CCLO 1VQNO 1QVGN 4QDLA 2OTJL 3OW2K 3CCRO 5FCLA 3I56L 1VQMO 1VQ7O 1M1KM 4WJ0A 1M1KP 3G6EL 1JJ2K 3CPWN 3CC7L 1YITO 3CC4O 1NJIM
chains in the Genus database with same CATH topology
5DQZA 3GODA 2QEXL 3NKDA 4W8KA 1YJNO 1KQSN 1VQ9O 1VQKL 3I55L 1K73M 1KC8M 3CXCN 4XTKA 1KC8P 1M90M 1M90P 2OTJO 1KD1M 1KD1P 1YJ9L 3I56O 3CCEL 1YHQL 3G6EO 5DQTA 1VQ4L 1VQOO 3CC7O 5DS4A 5DS5A 2QEXO 1KQSK 1VQKO 3I55O 1NJIP 1QVFN 1YI2L 1VQ5L 3G4SL 1VQPL 1YJ9O 1W2BN 1K73P 1YIJL 3CMEL 3CCEO 1YHQO 1QVGK 1VQ4O 4N06A 3CMAL 3CCSL 3CC2L 3OW2N 3CPWK 3CD6L 2QA4L 1VQ6L 1YI2O 5DS6A 1JJ2N 1Q86M 1VQ5O 1Q86P 3CCML 3G4SO 1VQPO 3CCQL 3CXCK 3CMEO 2OTLL 1K8AM 1VQ8L 1VQLL 2YZSA 5DLJA 3CMAO 3G71L 3CCVL 3CCSO 3CC2O 1YJWL 3CCJL 1S72L 3CCUL 3CCLL 3CD6O 2QA4O 1Q7YM 1VQ6O 1Q7YP 1VQNL 1Q82M 1Q82P 4P6IC 1VQOL 3CCRL 1K9MM 1K9MP 3CCMO 1VQML 1VQ7L 1QVFK 3CCQO 2OTLO 1N8RM 1VQ8O 1YITL 3CC4L 1N8RP 1VQLO 1W2BK 3G71O 1YIJO 3CCVO 1Q81M 1YJWO 1Q81P 1K8AP 1YJNL 3CCJO 1S72O 3CCUO 1VQ9L 3CCLO 1VQNO 1QVGN 4QDLA 2OTJL 3OW2K 3CCRO 5FCLA 3I56L 1VQMO 1VQ7O 1M1KM 4WJ0A 1M1KP 3G6EL 1JJ2K 3CPWN 3CC7L 1YITO 3CC4O 1NJIM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX L;  1YJN O;  1KQS N;  1VQ9 O;  1VQK L;  3I55 L;  1K73 M;  1KC8 M;  3CXC N;  1KC8 P;  1M90 M;  1M90 P;  2OTJ O;  1KD1 M;  1KD1 P;  1YJ9 L;  3I56 O;  3CCE L;  1YHQ L;  3G6E O;  1VQ4 L;  1VQO O;  3CC7 O;  2QEX O;  1KQS K;  1VQK O;  3I55 O;  1NJI P;  1QVF N;  1YI2 L;  1VQ5 L;  3G4S L;  1VQP L;  1YJ9 O;  1W2B N;  1K73 P;  1YIJ L;  3CME L;  3CCE O;  1YHQ O;  1QVG K;  1VQ4 O;  3CMA L;  3CCS L;  3CC2 L;  3OW2 N;  3CPW K;  3CD6 L;  2QA4 L;  1VQ6 L;  1YI2 O;  1JJ2 N;  1Q86 M;  1VQ5 O;  1Q86 P;  3CCM L;  3G4S O;  1VQP O;  3CCQ L;  3CXC K;  3CME O;  2OTL L;  1K8A M;  1VQ8 L;  1VQL L;  3CMA O;  3G71 L;  3CCV L;  3CCS O;  3CC2 O;  1YJW L;  3CCJ L;  1S72 L;  3CCU L;  3CCL L;  3CD6 O;  2QA4 O;  1Q7Y M;  1VQ6 O;  1Q7Y P;  1VQN L;  1Q82 M;  1Q82 P;  1VQO L;  3CCR L;  1K9M M;  1K9M P;  3CCM O;  1VQM L;  1VQ7 L;  1QVF K;  3CCQ O;  2OTL O;  1N8R M;  1VQ8 O;  1YIT L;  3CC4 L;  1N8R P;  1VQL O;  1W2B K;  3G71 O;  1YIJ O;  3CCV O;  1Q81 M;  1YJW O;  1Q81 P;  1K8A P;  1YJN L;  3CCJ O;  1S72 O;  3CCU O;  1VQ9 L;  3CCL O;  1VQN O;  1QVG N;  2OTJ L;  3OW2 K;  3CCR O;  3I56 L;  1VQM O;  1VQ7 O;  1M1K M;  1M1K P;  3G6E L;  1JJ2 K;  3CPW N;  3CC7 L;  1YIT O;  3CC4 O;  1NJI M; 
#chains in the Genus database with same CATH topology
 5DQZ A;  3GOD A;  2QEX L;  3NKD A;  4W8K A;  1YJN O;  1KQS N;  1VQ9 O;  1VQK L;  3I55 L;  1K73 M;  1KC8 M;  3CXC N;  4XTK A;  1KC8 P;  1M90 M;  1M90 P;  2OTJ O;  1KD1 M;  1KD1 P;  1YJ9 L;  3I56 O;  3CCE L;  1YHQ L;  3G6E O;  5DQT A;  1VQ4 L;  1VQO O;  3CC7 O;  5DS4 A;  5DS5 A;  2QEX O;  1KQS K;  1VQK O;  3I55 O;  1NJI P;  1QVF N;  1YI2 L;  1VQ5 L;  3G4S L;  1VQP L;  1YJ9 O;  1W2B N;  1K73 P;  1YIJ L;  3CME L;  3CCE O;  1YHQ O;  1QVG K;  1VQ4 O;  4N06 A;  3CMA L;  3CCS L;  3CC2 L;  3OW2 N;  3CPW K;  3CD6 L;  2QA4 L;  1VQ6 L;  1YI2 O;  5DS6 A;  1JJ2 N;  1Q86 M;  1VQ5 O;  1Q86 P;  3CCM L;  3G4S O;  1VQP O;  3CCQ L;  3CXC K;  3CME O;  2OTL L;  1K8A M;  1VQ8 L;  1VQL L;  2YZS A;  5DLJ A;  3CMA O;  3G71 L;  3CCV L;  3CCS O;  3CC2 O;  1YJW L;  3CCJ L;  1S72 L;  3CCU L;  3CCL L;  3CD6 O;  2QA4 O;  1Q7Y M;  1VQ6 O;  1Q7Y P;  1VQN L;  1Q82 M;  1Q82 P;  4P6I C;  1VQO L;  3CCR L;  1K9M M;  1K9M P;  3CCM O;  1VQM L;  1VQ7 L;  1QVF K;  3CCQ O;  2OTL O;  1N8R M;  1VQ8 O;  1YIT L;  3CC4 L;  1N8R P;  1VQL O;  1W2B K;  3G71 O;  1YIJ O;  3CCV O;  1Q81 M;  1YJW O;  1Q81 P;  1K8A P;  1YJN L;  3CCJ O;  1S72 O;  3CCU O;  1VQ9 L;  3CCL O;  1VQN O;  1QVG N;  4QDL A;  2OTJ L;  3OW2 K;  3CCR O;  5FCL A;  3I56 L;  1VQM O;  1VQ7 O;  1M1K M;  4WJ0 A;  1M1K P;  3G6E L;  1JJ2 K;  3CPW N;  3CC7 L;  1YIT O;  3CC4 O;  1NJI M; 
#chains in the Genus database with same CATH homology
 5DQZ A;  3GOD A;  2QEX L;  3NKD A;  4W8K A;  1YJN O;  1KQS N;  1VQ9 O;  1VQK L;  3I55 L;  1K73 M;  1KC8 M;  3CXC N;  4XTK A;  1KC8 P;  1M90 M;  1M90 P;  2OTJ O;  1KD1 M;  1KD1 P;  1YJ9 L;  3I56 O;  3CCE L;  1YHQ L;  3G6E O;  5DQT A;  1VQ4 L;  1VQO O;  3CC7 O;  5DS4 A;  5DS5 A;  2QEX O;  1KQS K;  1VQK O;  3I55 O;  1NJI P;  1QVF N;  1YI2 L;  1VQ5 L;  3G4S L;  1VQP L;  1YJ9 O;  1W2B N;  1K73 P;  1YIJ L;  3CME L;  3CCE O;  1YHQ O;  1QVG K;  1VQ4 O;  4N06 A;  3CMA L;  3CCS L;  3CC2 L;  3OW2 N;  3CPW K;  3CD6 L;  2QA4 L;  1VQ6 L;  1YI2 O;  5DS6 A;  1JJ2 N;  1Q86 M;  1VQ5 O;  1Q86 P;  3CCM L;  3G4S O;  1VQP O;  3CCQ L;  3CXC K;  3CME O;  2OTL L;  1K8A M;  1VQ8 L;  1VQL L;  2YZS A;  5DLJ A;  3CMA O;  3G71 L;  3CCV L;  3CCS O;  3CC2 O;  1YJW L;  3CCJ L;  1S72 L;  3CCU L;  3CCL L;  3CD6 O;  2QA4 O;  1Q7Y M;  1VQ6 O;  1Q7Y P;  1VQN L;  1Q82 M;  1Q82 P;  4P6I C;  1VQO L;  3CCR L;  1K9M M;  1K9M P;  3CCM O;  1VQM L;  1VQ7 L;  1QVF K;  3CCQ O;  2OTL O;  1N8R M;  1VQ8 O;  1YIT L;  3CC4 L;  1N8R P;  1VQL O;  1W2B K;  3G71 O;  1YIJ O;  3CCV O;  1Q81 M;  1YJW O;  1Q81 P;  1K8A P;  1YJN L;  3CCJ O;  1S72 O;  3CCU O;  1VQ9 L;  3CCL O;  1VQN O;  1QVG N;  4QDL A;  2OTJ L;  3OW2 K;  3CCR O;  5FCL A;  3I56 L;  1VQM O;  1VQ7 O;  1M1K M;  4WJ0 A;  1M1K P;  3G6E L;  1JJ2 K;  3CPW N;  3CC7 L;  1YIT O;  3CC4 O;  1NJI M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...