1VQML

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqmL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vqmL01
1K73M 3CCUL 1YI2O 3CXCK 2QA4L 1VQ9O 3CPWN 2QEXO 3I55L 3CCUO 2OTLO 3CCQL 2QA4O 3CC2O 3CMEL 3CD6O 3CPWK 2OTJL 1NJIM 3G71L 3CCQO 1Q7YP 3CCJL 3I56O 3CCSL 1QVGN 1K8AM 1QVFN 1JJ2K 1YI2L 1VQOL 1YJ9O 3CCEO 3CC4L 1YJNO 3G6EO 3CCSO 3CCRL 1QVGK 1VQOO 2OTLL 1QVFK 1VQ8L 3CC4O 3CC2L 3CD6L 3CCRO 3CCML 1NJIP 1YIJO 1VQ4L 3I56L 1N8RM 1VQ8O 1K8AP 3CCLL 1YJ9L 3CCEL 3CCVL 3CCMO 1YJNL 1VQ4O 3G6EL 3CCLO 1YHQL 1VQLL 1KD1M 1VQ5L 1KQSN 3CCVO 1VQ7L 3OW2N 1YHQO 1YIJL 1VQLO 1VQ5O 1Q81M 1N8RP 1Q86M 3G4SL 1W2BN 1VQKL 1VQ7O 1KQSK 1K9MP 3OW2K 3G4SO 1KC8P 1VQKO 1YJWO 1KD1P 1W2BK 1K9MM 1VQPL 1KC8M 1M1KP 1VQMO 1Q81P 1Q86P 1M90M 1S72L 1VQPO 3CMAL 1M1KM 1VQ6L 1JJ2N 1S72O 1Q82P 1YJWL 3CMAO 3I55O 1VQNL 1VQ6O 1YITL 3CC7L 3CXCN 1Q82M 1VQML 3CMEO 1K73P 1VQNO 1VQ9L 1YITO 2OTJO 2QEXL 1M90P 3G71O 1Q7YM 3CC7O 3CCJO
chains in the Genus database with same CATH superfamily
1K73M 3CCUL 1YI2O 4QDLA 3CXCK 2QA4L 1VQ9O 4N06A 3CPWN 2QEXO 3I55L 3CCUO 2OTLO 3CCQL 2QA4O 3CC2O 3CMEL 3CD6O 5DQTA 3CPWK 2OTJL 1NJIM 3G71L 3CCQO 1Q7YP 3CCJL 3I56O 3CCSL 1QVGN 1K8AM 1QVFN 5DLJA 1JJ2K 1YI2L 1VQOL 1YJ9O 3CCEO 3CC4L 1YJNO 3G6EO 4WJ0A 3CCSO 3CCRL 4P6IC 1VQOO 1QVGK 2OTLL 1QVFK 1VQ8L 3CC4O 3CC2L 3CD6L 3NKDA 3CCRO 3CCML 1NJIP 1YIJO 1VQ4L 3I56L 1N8RM 1VQ8O 1K8AP 3CCLL 1YJ9L 3CCEL 3CCVL 3CCMO 1YJNL 1VQ4O 3G6EL 3CCLO 1YHQL 1VQLL 1KD1M 1VQ5L 1KQSN 3CCVO 1VQ7L 5DS4A 3OW2N 2YZSA 4XTKA 1YHQO 1YIJL 1VQLO 1VQ5O 1Q81M 1N8RP 1Q86M 3G4SL 1W2BN 1VQKL 1VQ7O 1KQSK 1K9MP 3GODA 3OW2K 3G4SO 1KC8P 1VQKO 1YJWO 1KD1P 1W2BK 1K9MM 1VQPL 1KC8M 1M1KP 1VQMO 1Q81P 1Q86P 1M90M 1S72L 1VQPO 5DS5A 3CMAL 1M1KM 1VQ6L 1JJ2N 5FCLA 1S72O 1Q82P 1YJWL 3CMAO 3I55O 1VQNL 1VQ6O 1YITL 5DS6A 5DQZA 3CC7L 3CXCN 1Q82M 1VQML 3CMEO 1K73P 1VQNO 1VQ9L 1YITO 2OTJO 2QEXL 1M90P 3G71O 1Q7YM 3CC7O 3CCJO 4W8KA
chains in the Genus database with same CATH topology
1K73M 3CCUL 1YI2O 4QDLA 3CXCK 2QA4L 1VQ9O 4N06A 3CPWN 2QEXO 3I55L 3CCUO 2OTLO 3CCQL 2QA4O 3CC2O 3CMEL 3CD6O 5DQTA 3CPWK 2OTJL 1NJIM 3G71L 3CCQO 1Q7YP 3CCJL 3I56O 3CCSL 1QVGN 1K8AM 1QVFN 5DLJA 1JJ2K 1YI2L 1VQOL 1YJ9O 3CCEO 3CC4L 1YJNO 3G6EO 4WJ0A 3CCSO 3CCRL 4P6IC 1VQOO 1QVGK 2OTLL 1QVFK 1VQ8L 3CC4O 3CC2L 3CD6L 3NKDA 3CCRO 3CCML 1NJIP 1YIJO 1VQ4L 3I56L 1N8RM 1VQ8O 1K8AP 3CCLL 1YJ9L 3CCEL 3CCVL 3CCMO 1YJNL 1VQ4O 3G6EL 3CCLO 1YHQL 1VQLL 1KD1M 1VQ5L 1KQSN 3CCVO 1VQ7L 5DS4A 3OW2N 2YZSA 4XTKA 1YHQO 1YIJL 1VQLO 1VQ5O 1Q81M 1N8RP 1Q86M 3G4SL 1W2BN 1VQKL 1VQ7O 1KQSK 1K9MP 3GODA 3OW2K 3G4SO 1KC8P 1VQKO 1YJWO 1KD1P 1W2BK 1K9MM 1VQPL 1KC8M 1M1KP 1VQMO 1Q81P 1Q86P 1M90M 1S72L 1VQPO 5DS5A 3CMAL 1M1KM 1VQ6L 1JJ2N 5FCLA 1S72O 1Q82P 1YJWL 3CMAO 3I55O 1VQNL 1VQ6O 1YITL 5DS6A 5DQZA 3CC7L 3CXCN 1Q82M 1VQML 3CMEO 1K73P 1VQNO 1VQ9L 1YITO 2OTJO 2QEXL 1M90P 3G71O 1Q7YM 3CC7O 3CCJO 4W8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 M;  3CCU L;  1YI2 O;  3CXC K;  2QA4 L;  1VQ9 O;  3CPW N;  2QEX O;  3I55 L;  3CCU O;  2OTL O;  3CCQ L;  2QA4 O;  3CC2 O;  3CME L;  3CD6 O;  3CPW K;  2OTJ L;  1NJI M;  3G71 L;  3CCQ O;  1Q7Y P;  3CCJ L;  3I56 O;  3CCS L;  1QVG N;  1K8A M;  1QVF N;  1JJ2 K;  1YI2 L;  1VQO L;  1YJ9 O;  3CCE O;  3CC4 L;  1YJN O;  3G6E O;  3CCS O;  3CCR L;  1QVG K;  1VQO O;  2OTL L;  1QVF K;  1VQ8 L;  3CC4 O;  3CC2 L;  3CD6 L;  3CCR O;  3CCM L;  1NJI P;  1YIJ O;  1VQ4 L;  3I56 L;  1N8R M;  1VQ8 O;  1K8A P;  3CCL L;  1YJ9 L;  3CCE L;  3CCV L;  3CCM O;  1YJN L;  1VQ4 O;  3G6E L;  3CCL O;  1YHQ L;  1VQL L;  1KD1 M;  1VQ5 L;  1KQS N;  3CCV O;  1VQ7 L;  3OW2 N;  1YHQ O;  1YIJ L;  1VQL O;  1VQ5 O;  1Q81 M;  1N8R P;  1Q86 M;  3G4S L;  1W2B N;  1VQK L;  1VQ7 O;  1KQS K;  1K9M P;  3OW2 K;  3G4S O;  1KC8 P;  1VQK O;  1YJW O;  1KD1 P;  1W2B K;  1K9M M;  1VQP L;  1KC8 M;  1M1K P;  1VQM O;  1Q81 P;  1Q86 P;  1M90 M;  1S72 L;  1VQP O;  3CMA L;  1M1K M;  1VQ6 L;  1JJ2 N;  1S72 O;  1Q82 P;  1YJW L;  3CMA O;  3I55 O;  1VQN L;  1VQ6 O;  1YIT L;  3CC7 L;  3CXC N;  1Q82 M;  1VQM L;  3CME O;  1K73 P;  1VQN O;  1VQ9 L;  1YIT O;  2OTJ O;  2QEX L;  1M90 P;  3G71 O;  1Q7Y M;  3CC7 O;  3CCJ O; 
#chains in the Genus database with same CATH topology
 1K73 M;  3CCU L;  1YI2 O;  4QDL A;  3CXC K;  2QA4 L;  1VQ9 O;  4N06 A;  3CPW N;  2QEX O;  3I55 L;  3CCU O;  2OTL O;  3CCQ L;  2QA4 O;  3CC2 O;  3CME L;  3CD6 O;  5DQT A;  3CPW K;  2OTJ L;  1NJI M;  3G71 L;  3CCQ O;  1Q7Y P;  3CCJ L;  3I56 O;  3CCS L;  1QVG N;  1K8A M;  1QVF N;  5DLJ A;  1JJ2 K;  1YI2 L;  1VQO L;  1YJ9 O;  3CCE O;  3CC4 L;  1YJN O;  3G6E O;  4WJ0 A;  3CCS O;  3CCR L;  4P6I C;  1VQO O;  1QVG K;  2OTL L;  1QVF K;  1VQ8 L;  3CC4 O;  3CC2 L;  3CD6 L;  3NKD A;  3CCR O;  3CCM L;  1NJI P;  1YIJ O;  1VQ4 L;  3I56 L;  1N8R M;  1VQ8 O;  1K8A P;  3CCL L;  1YJ9 L;  3CCE L;  3CCV L;  3CCM O;  1YJN L;  1VQ4 O;  3G6E L;  3CCL O;  1YHQ L;  1VQL L;  1KD1 M;  1VQ5 L;  1KQS N;  3CCV O;  1VQ7 L;  5DS4 A;  3OW2 N;  2YZS A;  4XTK A;  1YHQ O;  1YIJ L;  1VQL O;  1VQ5 O;  1Q81 M;  1N8R P;  1Q86 M;  3G4S L;  1W2B N;  1VQK L;  1VQ7 O;  1KQS K;  1K9M P;  3GOD A;  3OW2 K;  3G4S O;  1KC8 P;  1VQK O;  1YJW O;  1KD1 P;  1W2B K;  1K9M M;  1VQP L;  1KC8 M;  1M1K P;  1VQM O;  1Q81 P;  1Q86 P;  1M90 M;  1S72 L;  1VQP O;  5DS5 A;  3CMA L;  1M1K M;  1VQ6 L;  1JJ2 N;  5FCL A;  1S72 O;  1Q82 P;  1YJW L;  3CMA O;  3I55 O;  1VQN L;  1VQ6 O;  1YIT L;  5DS6 A;  5DQZ A;  3CC7 L;  3CXC N;  1Q82 M;  1VQM L;  3CME O;  1K73 P;  1VQN O;  1VQ9 L;  1YIT O;  2OTJ O;  2QEX L;  1M90 P;  3G71 O;  1Q7Y M;  3CC7 O;  3CCJ O;  4W8K A; 
#chains in the Genus database with same CATH homology
 1K73 M;  3CCU L;  1YI2 O;  4QDL A;  3CXC K;  2QA4 L;  1VQ9 O;  4N06 A;  3CPW N;  2QEX O;  3I55 L;  3CCU O;  2OTL O;  3CCQ L;  2QA4 O;  3CC2 O;  3CME L;  3CD6 O;  5DQT A;  3CPW K;  2OTJ L;  1NJI M;  3G71 L;  3CCQ O;  1Q7Y P;  3CCJ L;  3I56 O;  3CCS L;  1QVG N;  1K8A M;  1QVF N;  5DLJ A;  1JJ2 K;  1YI2 L;  1VQO L;  1YJ9 O;  3CCE O;  3CC4 L;  1YJN O;  3G6E O;  4WJ0 A;  3CCS O;  3CCR L;  4P6I C;  1VQO O;  1QVG K;  2OTL L;  1QVF K;  1VQ8 L;  3CC4 O;  3CC2 L;  3CD6 L;  3NKD A;  3CCR O;  3CCM L;  1NJI P;  1YIJ O;  1VQ4 L;  3I56 L;  1N8R M;  1VQ8 O;  1K8A P;  3CCL L;  1YJ9 L;  3CCE L;  3CCV L;  3CCM O;  1YJN L;  1VQ4 O;  3G6E L;  3CCL O;  1YHQ L;  1VQL L;  1KD1 M;  1VQ5 L;  1KQS N;  3CCV O;  1VQ7 L;  5DS4 A;  3OW2 N;  2YZS A;  4XTK A;  1YHQ O;  1YIJ L;  1VQL O;  1VQ5 O;  1Q81 M;  1N8R P;  1Q86 M;  3G4S L;  1W2B N;  1VQK L;  1VQ7 O;  1KQS K;  1K9M P;  3GOD A;  3OW2 K;  3G4S O;  1KC8 P;  1VQK O;  1YJW O;  1KD1 P;  1W2B K;  1K9M M;  1VQP L;  1KC8 M;  1M1K P;  1VQM O;  1Q81 P;  1Q86 P;  1M90 M;  1S72 L;  1VQP O;  5DS5 A;  3CMA L;  1M1K M;  1VQ6 L;  1JJ2 N;  5FCL A;  1S72 O;  1Q82 P;  1YJW L;  3CMA O;  3I55 O;  1VQN L;  1VQ6 O;  1YIT L;  5DS6 A;  5DQZ A;  3CC7 L;  3CXC N;  1Q82 M;  1VQM L;  3CME O;  1K73 P;  1VQN O;  1VQ9 L;  1YIT O;  2OTJ O;  2QEX L;  1M90 P;  3G71 O;  1Q7Y M;  3CC7 O;  3CCJ O;  4W8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...