1VQLO

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqlO00
1KQSK 1VQ4L 1YITL 1W2BN 3CCVO 1YJNL 1Q7YM 1YHQL 1K8AM 1VQML 3CCEO 1YJWO 2OTJL 1VQNL 2QA4L 3CCUL 1QVGK 1YIJL 1VQ9L 3OW2K 1YITO 1YHQO 1JJ2K 1VQMO 2OTLL 3CCVL 2QA4O 1YIJO 3CCEL 1VQ5O 1YJWL 3CCSO 1KC8P 3CC2O 1VQ8O 3I55O 3G6EO 1S72O 1KC8M 1VQ6O 3CPWK 1VQLO 3CCMO 1W2BK 1VQ5L 1KQSN 1K73P 3CCSL 3CCJO 1YI2O 1Q86P 3CC2L 1K73M 1VQ8L 3I55L 3G6EL 3CCRO 1S72L 3CXCK 1KD1P 1Q86M 1VQ6L 1QVGN 1KD1M 1VQLL 3OW2N 3CCML 3CD6O 1QVFK 1VQKO 3CC4O 1Q82P 2OTLO 3CCJL 1YI2L 1M1KM 3CMEO 1Q82M 1VQOO 3CMAL 3CCRL 3CCQO 3G71O 1VQPL 3I56O 1N8RP 3CC7O 1VQ7O 1YJ9O 3CD6L 1VQKL 1K9MM 3CC4L 1Q81P 1N8RM 3CMAO 2QEXO 1Q81M 1VQPO 3CCLO 3CMEL 1VQOL 1JJ2N 3CCQL 3G71L 3G4SO 1M1KP 3I56L 3CC7L 1VQ7L 1YJ9L 3CXCN 1VQ4O 1YJNO 1M90P 2QEXL 1NJIP 2OTJO 1M90M 1VQNO 3CCLL 1K9MP 1QVFN 3CCUO 1NJIM 1VQ9O 3G4SL 1Q7YP 3CPWN 1K8AP
chains in the Genus database with same CATH superfamily
1KQSK 1VQ4L 1YITL 1W2BN 3CCVO 1YJNL 1Q7YM 1YHQL 1K8AM 3NKDA 1VQML 3CCEO 1YJWO 2OTJL 1VQNL 2QA4L 3CCUL 1QVGK 5DS6A 1YIJL 1VQ9L 3OW2K 1YITO 1YHQO 5DS5A 1JJ2K 1VQMO 2OTLL 3CCVL 2QA4O 1YIJO 3CCEL 1VQ5O 1YJWL 3CCSO 1KC8P 3CC2O 1VQ8O 3I55O 3G6EO 1S72O 1KC8M 1VQ6O 4W8KA 3CPWK 1VQLO 3GODA 3CCMO 1W2BK 2YZSA 1VQ5L 1KQSN 1K73P 3CCSL 3CCJO 1YI2O 1Q86P 4P6IC 3CC2L 1K73M 1VQ8L 4XTKA 3I55L 3G6EL 3CCRO 1S72L 3CXCK 1KD1P 1Q86M 1VQ6L 1QVGN 1KD1M 1VQLL 3OW2N 3CCML 4WJ0A 3CD6O 1QVFK 1VQKO 3CC4O 1Q82P 2OTLO 3CCJL 1YI2L 1M1KM 3CMEO 4N06A 1Q82M 1VQOO 3CMAL 3CCRL 3CCQO 5DQZA 3G71O 1VQPL 3I56O 1N8RP 3CC7O 1VQ7O 5FCLA 1YJ9O 3CD6L 1VQKL 1K9MM 5DS4A 3CC4L 1Q81P 1N8RM 3CMAO 4QDLA 2QEXO 1Q81M 1VQPO 3CCLO 3CMEL 1VQOL 1JJ2N 3CCQL 3G71L 3G4SO 5DLJA 1M1KP 3I56L 3CC7L 1VQ7L 1YJ9L 3CXCN 1VQ4O 1YJNO 1M90P 2QEXL 1NJIP 5DQTA 2OTJO 1M90M 1VQNO 3CCLL 1K9MP 1QVFN 3CCUO 1NJIM 1VQ9O 3G4SL 1Q7YP 3CPWN 1K8AP
chains in the Genus database with same CATH topology
1KQSK 1VQ4L 1YITL 1W2BN 3CCVO 1YJNL 1Q7YM 1YHQL 1K8AM 3NKDA 1VQML 3CCEO 1YJWO 2OTJL 1VQNL 2QA4L 3CCUL 1QVGK 5DS6A 1YIJL 1VQ9L 3OW2K 1YITO 1YHQO 5DS5A 1JJ2K 1VQMO 2OTLL 3CCVL 2QA4O 1YIJO 3CCEL 1VQ5O 1YJWL 3CCSO 1KC8P 3CC2O 1VQ8O 3I55O 3G6EO 1S72O 1KC8M 1VQ6O 4W8KA 3CPWK 1VQLO 3GODA 3CCMO 1W2BK 2YZSA 1VQ5L 1KQSN 1K73P 3CCSL 3CCJO 1YI2O 1Q86P 4P6IC 3CC2L 1K73M 1VQ8L 4XTKA 3I55L 3G6EL 3CCRO 1S72L 3CXCK 1KD1P 1Q86M 1VQ6L 1QVGN 1KD1M 1VQLL 3OW2N 3CCML 4WJ0A 3CD6O 1QVFK 1VQKO 3CC4O 1Q82P 2OTLO 3CCJL 1YI2L 1M1KM 3CMEO 4N06A 1Q82M 1VQOO 3CMAL 3CCRL 3CCQO 5DQZA 3G71O 1VQPL 3I56O 1N8RP 3CC7O 1VQ7O 5FCLA 1YJ9O 3CD6L 1VQKL 1K9MM 5DS4A 3CC4L 1Q81P 1N8RM 3CMAO 4QDLA 2QEXO 1Q81M 1VQPO 3CCLO 3CMEL 1VQOL 1JJ2N 3CCQL 3G71L 3G4SO 5DLJA 1M1KP 3I56L 3CC7L 1VQ7L 1YJ9L 3CXCN 1VQ4O 1YJNO 1M90P 2QEXL 1NJIP 5DQTA 2OTJO 1M90M 1VQNO 3CCLL 1K9MP 1QVFN 3CCUO 1NJIM 1VQ9O 3G4SL 1Q7YP 3CPWN 1K8AP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS K;  1VQ4 L;  1YIT L;  1W2B N;  3CCV O;  1YJN L;  1Q7Y M;  1YHQ L;  1K8A M;  1VQM L;  3CCE O;  1YJW O;  2OTJ L;  1VQN L;  2QA4 L;  3CCU L;  1QVG K;  1YIJ L;  1VQ9 L;  3OW2 K;  1YIT O;  1YHQ O;  1JJ2 K;  1VQM O;  2OTL L;  3CCV L;  2QA4 O;  1YIJ O;  3CCE L;  1VQ5 O;  1YJW L;  3CCS O;  1KC8 P;  3CC2 O;  1VQ8 O;  3I55 O;  3G6E O;  1S72 O;  1KC8 M;  1VQ6 O;  3CPW K;  1VQL O;  3CCM O;  1W2B K;  1VQ5 L;  1KQS N;  1K73 P;  3CCS L;  3CCJ O;  1YI2 O;  1Q86 P;  3CC2 L;  1K73 M;  1VQ8 L;  3I55 L;  3G6E L;  3CCR O;  1S72 L;  3CXC K;  1KD1 P;  1Q86 M;  1VQ6 L;  1QVG N;  1KD1 M;  1VQL L;  3OW2 N;  3CCM L;  3CD6 O;  1QVF K;  1VQK O;  3CC4 O;  1Q82 P;  2OTL O;  3CCJ L;  1YI2 L;  1M1K M;  3CME O;  1Q82 M;  1VQO O;  3CMA L;  3CCR L;  3CCQ O;  3G71 O;  1VQP L;  3I56 O;  1N8R P;  3CC7 O;  1VQ7 O;  1YJ9 O;  3CD6 L;  1VQK L;  1K9M M;  3CC4 L;  1Q81 P;  1N8R M;  3CMA O;  2QEX O;  1Q81 M;  1VQP O;  3CCL O;  3CME L;  1VQO L;  1JJ2 N;  3CCQ L;  3G71 L;  3G4S O;  1M1K P;  3I56 L;  3CC7 L;  1VQ7 L;  1YJ9 L;  3CXC N;  1VQ4 O;  1YJN O;  1M90 P;  2QEX L;  1NJI P;  2OTJ O;  1M90 M;  1VQN O;  3CCL L;  1K9M P;  1QVF N;  3CCU O;  1NJI M;  1VQ9 O;  3G4S L;  1Q7Y P;  3CPW N;  1K8A P; 
#chains in the Genus database with same CATH topology
 1KQS K;  1VQ4 L;  1YIT L;  1W2B N;  3CCV O;  1YJN L;  1Q7Y M;  1YHQ L;  1K8A M;  3NKD A;  1VQM L;  3CCE O;  1YJW O;  2OTJ L;  1VQN L;  2QA4 L;  3CCU L;  1QVG K;  5DS6 A;  1YIJ L;  1VQ9 L;  3OW2 K;  1YIT O;  1YHQ O;  5DS5 A;  1JJ2 K;  1VQM O;  2OTL L;  3CCV L;  2QA4 O;  1YIJ O;  3CCE L;  1VQ5 O;  1YJW L;  3CCS O;  1KC8 P;  3CC2 O;  1VQ8 O;  3I55 O;  3G6E O;  1S72 O;  1KC8 M;  1VQ6 O;  4W8K A;  3CPW K;  1VQL O;  3GOD A;  3CCM O;  1W2B K;  2YZS A;  1VQ5 L;  1KQS N;  1K73 P;  3CCS L;  3CCJ O;  1YI2 O;  1Q86 P;  4P6I C;  3CC2 L;  1K73 M;  1VQ8 L;  4XTK A;  3I55 L;  3G6E L;  3CCR O;  1S72 L;  3CXC K;  1KD1 P;  1Q86 M;  1VQ6 L;  1QVG N;  1KD1 M;  1VQL L;  3OW2 N;  3CCM L;  4WJ0 A;  3CD6 O;  1QVF K;  1VQK O;  3CC4 O;  1Q82 P;  2OTL O;  3CCJ L;  1YI2 L;  1M1K M;  3CME O;  4N06 A;  1Q82 M;  1VQO O;  3CMA L;  3CCR L;  3CCQ O;  5DQZ A;  3G71 O;  1VQP L;  3I56 O;  1N8R P;  3CC7 O;  1VQ7 O;  5FCL A;  1YJ9 O;  3CD6 L;  1VQK L;  1K9M M;  5DS4 A;  3CC4 L;  1Q81 P;  1N8R M;  3CMA O;  4QDL A;  2QEX O;  1Q81 M;  1VQP O;  3CCL O;  3CME L;  1VQO L;  1JJ2 N;  3CCQ L;  3G71 L;  3G4S O;  5DLJ A;  1M1K P;  3I56 L;  3CC7 L;  1VQ7 L;  1YJ9 L;  3CXC N;  1VQ4 O;  1YJN O;  1M90 P;  2QEX L;  1NJI P;  5DQT A;  2OTJ O;  1M90 M;  1VQN O;  3CCL L;  1K9M P;  1QVF N;  3CCU O;  1NJI M;  1VQ9 O;  3G4S L;  1Q7Y P;  3CPW N;  1K8A P; 
#chains in the Genus database with same CATH homology
 1KQS K;  1VQ4 L;  1YIT L;  1W2B N;  3CCV O;  1YJN L;  1Q7Y M;  1YHQ L;  1K8A M;  3NKD A;  1VQM L;  3CCE O;  1YJW O;  2OTJ L;  1VQN L;  2QA4 L;  3CCU L;  1QVG K;  5DS6 A;  1YIJ L;  1VQ9 L;  3OW2 K;  1YIT O;  1YHQ O;  5DS5 A;  1JJ2 K;  1VQM O;  2OTL L;  3CCV L;  2QA4 O;  1YIJ O;  3CCE L;  1VQ5 O;  1YJW L;  3CCS O;  1KC8 P;  3CC2 O;  1VQ8 O;  3I55 O;  3G6E O;  1S72 O;  1KC8 M;  1VQ6 O;  4W8K A;  3CPW K;  1VQL O;  3GOD A;  3CCM O;  1W2B K;  2YZS A;  1VQ5 L;  1KQS N;  1K73 P;  3CCS L;  3CCJ O;  1YI2 O;  1Q86 P;  4P6I C;  3CC2 L;  1K73 M;  1VQ8 L;  4XTK A;  3I55 L;  3G6E L;  3CCR O;  1S72 L;  3CXC K;  1KD1 P;  1Q86 M;  1VQ6 L;  1QVG N;  1KD1 M;  1VQL L;  3OW2 N;  3CCM L;  4WJ0 A;  3CD6 O;  1QVF K;  1VQK O;  3CC4 O;  1Q82 P;  2OTL O;  3CCJ L;  1YI2 L;  1M1K M;  3CME O;  4N06 A;  1Q82 M;  1VQO O;  3CMA L;  3CCR L;  3CCQ O;  5DQZ A;  3G71 O;  1VQP L;  3I56 O;  1N8R P;  3CC7 O;  1VQ7 O;  5FCL A;  1YJ9 O;  3CD6 L;  1VQK L;  1K9M M;  5DS4 A;  3CC4 L;  1Q81 P;  1N8R M;  3CMA O;  4QDL A;  2QEX O;  1Q81 M;  1VQP O;  3CCL O;  3CME L;  1VQO L;  1JJ2 N;  3CCQ L;  3G71 L;  3G4S O;  5DLJ A;  1M1K P;  3I56 L;  3CC7 L;  1VQ7 L;  1YJ9 L;  3CXC N;  1VQ4 O;  1YJN O;  1M90 P;  2QEX L;  1NJI P;  5DQT A;  2OTJ O;  1M90 M;  1VQN O;  3CCL L;  1K9M P;  1QVF N;  3CCU O;  1NJI M;  1VQ9 O;  3G4S L;  1Q7Y P;  3CPW N;  1K8A P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...