1KC8P

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1kc8P00
3CPWN 3G71L 1VQNO 1Q81M 1K73M 1VQMO 3CCEO 1KQSN 3G4SO 1W2BK 3G4SL 1K8AP 3CCRO 1YHQL 1VQ9O 1VQ6O 1VQ6L 3OW2K 1Q82M 3G6EL 1K9MP 1N8RP 1YJ9O 3CCJO 3CCJL 1QVGK 1JJ2K 2QA4O 2QA4L 3CCMO 3CCML 3CCLO 1JJ2N 1VQ5O 1KD1P 3CCUO 3I55L 3CCUL 1K8AM 1M90P 3G71O 1YI2O 1YI2L 1K9MM 3CMAL 1YHQO 1N8RM 3CMEL 1W2BN 3G6EO 3OW2N 2OTJO 1VQOO 1KD1M 2OTJL 1VQOL 1Q7YP 1M90M 1VQLO 1VQLL 3CD6O 1QVGN 3CD6L 1NJIM 3CC2L 3I55O 1YIJL 2QEXL 3CMAO 1QVFK 3CCVO 3I56L 3CCVL 1YITL 1VQKL 1Q86P 1YJNO 1QVFN 3CMEO 1YJNL 1Q7YM 3CXCK 2OTLO 1S72O 2OTLL 1S72L 1VQ4O 3CPWK 1VQ4L 3CXCN 1VQ7L 1YJWO 1YJWL 3CCSO 3CC4O 3CCSL 1KQSK 3CC4L 1VQNL 3CC2O 3CCQO 3CCQL 1M1KP 1VQML 3CCEL 1YIJO 1NJIP 1KC8P 1Q86M 2QEXO 1VQ8O 3CCRL 1VQ8L 1VQ9L 1Q81P 1K73P 1VQPO 3I56O 1VQPL 1YITO 1VQKO 1YJ9L 1Q82P 3CC7O 3CC7L 3CCLL 1M1KM 1VQ5L 1VQ7O 1KC8M
chains in the Genus database with same CATH superfamily
3CPWN 3G71L 1VQNO 1Q81M 1K73M 1VQMO 3CCEO 1KQSN 3G4SO 1W2BK 3G4SL 1K8AP 3CCRO 1YHQL 1VQ9O 4XTKA 1VQ6O 1VQ6L 3OW2K 1Q82M 3G6EL 1K9MP 1N8RP 1YJ9O 3CCJO 3CCJL 1QVGK 1JJ2K 4QDLA 5DLJA 2QA4O 2QA4L 3CCMO 4WJ0A 3CCML 3CCLO 1JJ2N 1VQ5O 1KD1P 5DS4A 3CCUO 3I55L 3CCUL 1K8AM 1M90P 3G71O 1YI2O 1YI2L 4P6IC 1K9MM 3CMAL 1YHQO 1N8RM 3CMEL 4N06A 1W2BN 3G6EO 5DS6A 3OW2N 2OTJO 5DS5A 1VQOO 1KD1M 1VQOL 1Q7YP 2OTJL 1M90M 3NKDA 1VQLO 1VQLL 3CD6O 1QVGN 3CD6L 1NJIM 3CC2L 3I55O 1YIJL 2QEXL 3CMAO 5FCLA 1QVFK 3CCVO 3I56L 3CCVL 1YITL 1VQKL 1Q86P 5DQTA 1YJNO 1QVFN 3CMEO 1YJNL 1Q7YM 5DQZA 3CXCK 2OTLO 1S72O 2OTLL 1S72L 1VQ4O 3CPWK 1VQ4L 3CXCN 1VQ7L 1YJWO 1YJWL 3CCSO 3CC4O 3CCSL 1KQSK 3CC4L 1VQNL 4W8KA 3CC2O 3CCQO 3CCQL 1M1KP 1VQML 3CCEL 1YIJO 1NJIP 1KC8P 1Q86M 2QEXO 1VQ8O 3CCRL 1VQ8L 1VQ9L 1Q81P 1K73P 1VQPO 3I56O 1VQPL 1YITO 1VQKO 3GODA 1YJ9L 1Q82P 3CC7O 3CC7L 3CCLL 1M1KM 1VQ5L 1VQ7O 2YZSA 1KC8M
chains in the Genus database with same CATH topology
3CPWN 3G71L 1VQNO 1Q81M 1K73M 1VQMO 3CCEO 1KQSN 3G4SO 1W2BK 3G4SL 1K8AP 3CCRO 1YHQL 1VQ9O 4XTKA 1VQ6O 1VQ6L 3OW2K 1Q82M 3G6EL 1K9MP 1N8RP 1YJ9O 3CCJO 3CCJL 1QVGK 1JJ2K 4QDLA 5DLJA 2QA4O 2QA4L 3CCMO 4WJ0A 3CCML 3CCLO 1JJ2N 1VQ5O 1KD1P 5DS4A 3CCUO 3I55L 3CCUL 1K8AM 1M90P 3G71O 1YI2O 1YI2L 4P6IC 1K9MM 3CMAL 1YHQO 1N8RM 3CMEL 4N06A 1W2BN 3G6EO 5DS6A 3OW2N 2OTJO 5DS5A 1VQOO 1KD1M 1VQOL 1Q7YP 2OTJL 1M90M 3NKDA 1VQLO 1VQLL 3CD6O 1QVGN 3CD6L 1NJIM 3CC2L 3I55O 1YIJL 2QEXL 3CMAO 5FCLA 1QVFK 3CCVO 3I56L 3CCVL 1YITL 1VQKL 1Q86P 5DQTA 1YJNO 1QVFN 3CMEO 1YJNL 1Q7YM 5DQZA 3CXCK 2OTLO 1S72O 2OTLL 1S72L 1VQ4O 3CPWK 1VQ4L 3CXCN 1VQ7L 1YJWO 1YJWL 3CCSO 3CC4O 3CCSL 1KQSK 3CC4L 1VQNL 4W8KA 3CC2O 3CCQO 3CCQL 1M1KP 1VQML 3CCEL 1YIJO 1NJIP 1KC8P 1Q86M 2QEXO 1VQ8O 3CCRL 1VQ8L 1VQ9L 1Q81P 1K73P 1VQPO 3I56O 1VQPL 1YITO 1VQKO 3GODA 1YJ9L 1Q82P 3CC7O 3CC7L 3CCLL 1M1KM 1VQ5L 1VQ7O 2YZSA 1KC8M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW N;  3G71 L;  1VQN O;  1Q81 M;  1K73 M;  1VQM O;  3CCE O;  1KQS N;  3G4S O;  1W2B K;  3G4S L;  1K8A P;  3CCR O;  1YHQ L;  1VQ9 O;  1VQ6 O;  1VQ6 L;  3OW2 K;  1Q82 M;  3G6E L;  1K9M P;  1N8R P;  1YJ9 O;  3CCJ O;  3CCJ L;  1QVG K;  1JJ2 K;  2QA4 O;  2QA4 L;  3CCM O;  3CCM L;  3CCL O;  1JJ2 N;  1VQ5 O;  1KD1 P;  3CCU O;  3I55 L;  3CCU L;  1K8A M;  1M90 P;  3G71 O;  1YI2 O;  1YI2 L;  1K9M M;  3CMA L;  1YHQ O;  1N8R M;  3CME L;  1W2B N;  3G6E O;  3OW2 N;  2OTJ O;  1VQO O;  1KD1 M;  2OTJ L;  1VQO L;  1Q7Y P;  1M90 M;  1VQL O;  1VQL L;  3CD6 O;  1QVG N;  3CD6 L;  1NJI M;  3CC2 L;  3I55 O;  1YIJ L;  2QEX L;  3CMA O;  1QVF K;  3CCV O;  3I56 L;  3CCV L;  1YIT L;  1VQK L;  1Q86 P;  1YJN O;  1QVF N;  3CME O;  1YJN L;  1Q7Y M;  3CXC K;  2OTL O;  1S72 O;  2OTL L;  1S72 L;  1VQ4 O;  3CPW K;  1VQ4 L;  3CXC N;  1VQ7 L;  1YJW O;  1YJW L;  3CCS O;  3CC4 O;  3CCS L;  1KQS K;  3CC4 L;  1VQN L;  3CC2 O;  3CCQ O;  3CCQ L;  1M1K P;  1VQM L;  3CCE L;  1YIJ O;  1NJI P;  1KC8 P;  1Q86 M;  2QEX O;  1VQ8 O;  3CCR L;  1VQ8 L;  1VQ9 L;  1Q81 P;  1K73 P;  1VQP O;  3I56 O;  1VQP L;  1YIT O;  1VQK O;  1YJ9 L;  1Q82 P;  3CC7 O;  3CC7 L;  3CCL L;  1M1K M;  1VQ5 L;  1VQ7 O;  1KC8 M; 
#chains in the Genus database with same CATH topology
 3CPW N;  3G71 L;  1VQN O;  1Q81 M;  1K73 M;  1VQM O;  3CCE O;  1KQS N;  3G4S O;  1W2B K;  3G4S L;  1K8A P;  3CCR O;  1YHQ L;  1VQ9 O;  4XTK A;  1VQ6 O;  1VQ6 L;  3OW2 K;  1Q82 M;  3G6E L;  1K9M P;  1N8R P;  1YJ9 O;  3CCJ O;  3CCJ L;  1QVG K;  1JJ2 K;  4QDL A;  5DLJ A;  2QA4 O;  2QA4 L;  3CCM O;  4WJ0 A;  3CCM L;  3CCL O;  1JJ2 N;  1VQ5 O;  1KD1 P;  5DS4 A;  3CCU O;  3I55 L;  3CCU L;  1K8A M;  1M90 P;  3G71 O;  1YI2 O;  1YI2 L;  4P6I C;  1K9M M;  3CMA L;  1YHQ O;  1N8R M;  3CME L;  4N06 A;  1W2B N;  3G6E O;  5DS6 A;  3OW2 N;  2OTJ O;  5DS5 A;  1VQO O;  1KD1 M;  1VQO L;  1Q7Y P;  2OTJ L;  1M90 M;  3NKD A;  1VQL O;  1VQL L;  3CD6 O;  1QVG N;  3CD6 L;  1NJI M;  3CC2 L;  3I55 O;  1YIJ L;  2QEX L;  3CMA O;  5FCL A;  1QVF K;  3CCV O;  3I56 L;  3CCV L;  1YIT L;  1VQK L;  1Q86 P;  5DQT A;  1YJN O;  1QVF N;  3CME O;  1YJN L;  1Q7Y M;  5DQZ A;  3CXC K;  2OTL O;  1S72 O;  2OTL L;  1S72 L;  1VQ4 O;  3CPW K;  1VQ4 L;  3CXC N;  1VQ7 L;  1YJW O;  1YJW L;  3CCS O;  3CC4 O;  3CCS L;  1KQS K;  3CC4 L;  1VQN L;  4W8K A;  3CC2 O;  3CCQ O;  3CCQ L;  1M1K P;  1VQM L;  3CCE L;  1YIJ O;  1NJI P;  1KC8 P;  1Q86 M;  2QEX O;  1VQ8 O;  3CCR L;  1VQ8 L;  1VQ9 L;  1Q81 P;  1K73 P;  1VQP O;  3I56 O;  1VQP L;  1YIT O;  1VQK O;  3GOD A;  1YJ9 L;  1Q82 P;  3CC7 O;  3CC7 L;  3CCL L;  1M1K M;  1VQ5 L;  1VQ7 O;  2YZS A;  1KC8 M; 
#chains in the Genus database with same CATH homology
 3CPW N;  3G71 L;  1VQN O;  1Q81 M;  1K73 M;  1VQM O;  3CCE O;  1KQS N;  3G4S O;  1W2B K;  3G4S L;  1K8A P;  3CCR O;  1YHQ L;  1VQ9 O;  4XTK A;  1VQ6 O;  1VQ6 L;  3OW2 K;  1Q82 M;  3G6E L;  1K9M P;  1N8R P;  1YJ9 O;  3CCJ O;  3CCJ L;  1QVG K;  1JJ2 K;  4QDL A;  5DLJ A;  2QA4 O;  2QA4 L;  3CCM O;  4WJ0 A;  3CCM L;  3CCL O;  1JJ2 N;  1VQ5 O;  1KD1 P;  5DS4 A;  3CCU O;  3I55 L;  3CCU L;  1K8A M;  1M90 P;  3G71 O;  1YI2 O;  1YI2 L;  4P6I C;  1K9M M;  3CMA L;  1YHQ O;  1N8R M;  3CME L;  4N06 A;  1W2B N;  3G6E O;  5DS6 A;  3OW2 N;  2OTJ O;  5DS5 A;  1VQO O;  1KD1 M;  1VQO L;  1Q7Y P;  2OTJ L;  1M90 M;  3NKD A;  1VQL O;  1VQL L;  3CD6 O;  1QVG N;  3CD6 L;  1NJI M;  3CC2 L;  3I55 O;  1YIJ L;  2QEX L;  3CMA O;  5FCL A;  1QVF K;  3CCV O;  3I56 L;  3CCV L;  1YIT L;  1VQK L;  1Q86 P;  5DQT A;  1YJN O;  1QVF N;  3CME O;  1YJN L;  1Q7Y M;  5DQZ A;  3CXC K;  2OTL O;  1S72 O;  2OTL L;  1S72 L;  1VQ4 O;  3CPW K;  1VQ4 L;  3CXC N;  1VQ7 L;  1YJW O;  1YJW L;  3CCS O;  3CC4 O;  3CCS L;  1KQS K;  3CC4 L;  1VQN L;  4W8K A;  3CC2 O;  3CCQ O;  3CCQ L;  1M1K P;  1VQM L;  3CCE L;  1YIJ O;  1NJI P;  1KC8 P;  1Q86 M;  2QEX O;  1VQ8 O;  3CCR L;  1VQ8 L;  1VQ9 L;  1Q81 P;  1K73 P;  1VQP O;  3I56 O;  1VQP L;  1YIT O;  1VQK O;  3GOD A;  1YJ9 L;  1Q82 P;  3CC7 O;  3CC7 L;  3CCL L;  1M1K M;  1VQ5 L;  1VQ7 O;  2YZS A;  1KC8 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...