1VQ9O

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq9O00
1YJWL 3CC7L 3CMAO 1YJNL 1K9MP 1VQNO 1KQSK 3CD6L 1VQ6L 2OTJL 3CCEL 1KC8P 1N8RM 2QEXO 1K8AM 1S72L 3CCQO 2QA4L 3CCSO 3CCML 3I55L 1QVGK 1NJIP 3CC4O 1YJ9O 1JJ2N 3CMEL 1VQOO 1VQ4L 1Q81P 1YITL 3CCRL 1M90P 3G6EO 1K9MM 1VQ8L 1QVFK 1YI2L 1VQ7O 3I56O 1VQPO 1KC8M 1VQ5L 1VQLL 3G4SO 1YHQO 1YJWO 3CC7O 3CCJO 3CXCN 1Q86P 1Q7YP 1VQKO 1NJIM 1VQ9L 3G71O 3CCLL 1W2BN 2OTJO 2QEXL 3CCUL 1M1KP 1Q81M 1M90M 1Q82P 3CCVL 2QA4O 1VQMO 3OW2N 3CCMO 3I55O 3CPWN 3CC2L 1YJ9L 2OTLO 1VQOL 1N8RP 1YIJL 1VQ4O 1K73P 1Q86M 3G6EL 1Q7YM 1VQ8O 1KD1P 1YI2O 3CMAL 1QVFN 1VQPL 1YJNO 1VQNL 1M1KM 3CD6O 1VQ6O 1KQSN 3CCEO 1Q82M 3G4SL 1VQLO 1YHQL 3CXCK 3CCJL 1S72O 3CCQL 3CCSL 1VQKL 3G71L 1VQ9O 1W2BK 3CCLO 1JJ2K 3CC4L 1QVGN 3CCUO 3CMEO 1K73M 3CCVO 1K8AP 3OW2K 1YITO 3CCRO 1VQML 1KD1M 3CPWK 1VQ7L 3CC2O 3I56L 2OTLL 1VQ5O 1YIJO
chains in the Genus database with same CATH superfamily
3NKDA 1YJWL 3CC7L 3CMAO 1YJNL 1K9MP 1VQNO 1KQSK 3CD6L 1VQ6L 2OTJL 3CCEL 1KC8P 1N8RM 2QEXO 1K8AM 1S72L 3CCQO 2QA4L 3CCSO 3CCML 3I55L 1QVGK 1NJIP 3CC4O 1YJ9O 1JJ2N 3CMEL 1VQOO 1VQ4L 1Q81P 1YITL 3CCRL 1M90P 4W8KA 3G6EO 1K9MM 1VQ8L 1QVFK 1YI2L 4WJ0A 1VQ7O 3I56O 1VQPO 1KC8M 1VQ5L 1VQLL 3G4SO 1YHQO 1YJWO 3CC7O 3CCJO 3CXCN 1Q86P 1Q7YP 1VQKO 1NJIM 1VQ9L 3G71O 3CCLL 4QDLA 1W2BN 2OTJO 2QEXL 3CCUL 1M1KP 1Q81M 1M90M 1Q82P 3CCVL 2QA4O 1VQMO 3OW2N 3CCMO 3I55O 3CPWN 5DLJA 4N06A 3CC2L 1YJ9L 2OTLO 5DQTA 5DS4A 1VQOL 1N8RP 1YIJL 1VQ4O 5DS5A 1K73P 5FCLA 1Q86M 3G6EL 1Q7YM 1VQ8O 1KD1P 1YI2O 3CMAL 1QVFN 1VQPL 1YJNO 1VQNL 4P6IC 3GODA 1M1KM 3CD6O 1VQ6O 1KQSN 3CCEO 1Q82M 2YZSA 3G4SL 1VQLO 1YHQL 3CXCK 3CCJL 1S72O 3CCQL 3CCSL 1VQKL 3G71L 1VQ9O 1W2BK 3CCLO 4XTKA 1JJ2K 3CC4L 1QVGN 3CCUO 3CMEO 1K73M 3CCVO 1K8AP 3OW2K 1YITO 3CCRO 1VQML 1KD1M 3CPWK 5DS6A 1VQ7L 3CC2O 3I56L 2OTLL 5DQZA 1VQ5O 1YIJO
chains in the Genus database with same CATH topology
3NKDA 1YJWL 3CC7L 3CMAO 1YJNL 1K9MP 1VQNO 1KQSK 3CD6L 1VQ6L 2OTJL 3CCEL 1KC8P 1N8RM 2QEXO 1K8AM 1S72L 3CCQO 2QA4L 3CCSO 3CCML 3I55L 1QVGK 1NJIP 3CC4O 1YJ9O 1JJ2N 3CMEL 1VQOO 1VQ4L 1Q81P 1YITL 3CCRL 1M90P 4W8KA 3G6EO 1K9MM 1VQ8L 1QVFK 1YI2L 4WJ0A 1VQ7O 3I56O 1VQPO 1KC8M 1VQ5L 1VQLL 3G4SO 1YHQO 1YJWO 3CC7O 3CCJO 3CXCN 1Q86P 1Q7YP 1VQKO 1NJIM 1VQ9L 3G71O 3CCLL 4QDLA 1W2BN 2OTJO 2QEXL 3CCUL 1M1KP 1Q81M 1M90M 1Q82P 3CCVL 2QA4O 1VQMO 3OW2N 3CCMO 3I55O 3CPWN 5DLJA 4N06A 3CC2L 1YJ9L 2OTLO 5DQTA 5DS4A 1VQOL 1N8RP 1YIJL 1VQ4O 5DS5A 1K73P 5FCLA 1Q86M 3G6EL 1Q7YM 1VQ8O 1KD1P 1YI2O 3CMAL 1QVFN 1VQPL 1YJNO 1VQNL 4P6IC 3GODA 1M1KM 3CD6O 1VQ6O 1KQSN 3CCEO 1Q82M 2YZSA 3G4SL 1VQLO 1YHQL 3CXCK 3CCJL 1S72O 3CCQL 3CCSL 1VQKL 3G71L 1VQ9O 1W2BK 3CCLO 4XTKA 1JJ2K 3CC4L 1QVGN 3CCUO 3CMEO 1K73M 3CCVO 1K8AP 3OW2K 1YITO 3CCRO 1VQML 1KD1M 3CPWK 5DS6A 1VQ7L 3CC2O 3I56L 2OTLL 5DQZA 1VQ5O 1YIJO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW L;  3CC7 L;  3CMA O;  1YJN L;  1K9M P;  1VQN O;  1KQS K;  3CD6 L;  1VQ6 L;  2OTJ L;  3CCE L;  1KC8 P;  1N8R M;  2QEX O;  1K8A M;  1S72 L;  3CCQ O;  2QA4 L;  3CCS O;  3CCM L;  3I55 L;  1QVG K;  1NJI P;  3CC4 O;  1YJ9 O;  1JJ2 N;  3CME L;  1VQO O;  1VQ4 L;  1Q81 P;  1YIT L;  3CCR L;  1M90 P;  3G6E O;  1K9M M;  1VQ8 L;  1QVF K;  1YI2 L;  1VQ7 O;  3I56 O;  1VQP O;  1KC8 M;  1VQ5 L;  1VQL L;  3G4S O;  1YHQ O;  1YJW O;  3CC7 O;  3CCJ O;  3CXC N;  1Q86 P;  1Q7Y P;  1VQK O;  1NJI M;  1VQ9 L;  3G71 O;  3CCL L;  1W2B N;  2OTJ O;  2QEX L;  3CCU L;  1M1K P;  1Q81 M;  1M90 M;  1Q82 P;  3CCV L;  2QA4 O;  1VQM O;  3OW2 N;  3CCM O;  3I55 O;  3CPW N;  3CC2 L;  1YJ9 L;  2OTL O;  1VQO L;  1N8R P;  1YIJ L;  1VQ4 O;  1K73 P;  1Q86 M;  3G6E L;  1Q7Y M;  1VQ8 O;  1KD1 P;  1YI2 O;  3CMA L;  1QVF N;  1VQP L;  1YJN O;  1VQN L;  1M1K M;  3CD6 O;  1VQ6 O;  1KQS N;  3CCE O;  1Q82 M;  3G4S L;  1VQL O;  1YHQ L;  3CXC K;  3CCJ L;  1S72 O;  3CCQ L;  3CCS L;  1VQK L;  3G71 L;  1VQ9 O;  1W2B K;  3CCL O;  1JJ2 K;  3CC4 L;  1QVG N;  3CCU O;  3CME O;  1K73 M;  3CCV O;  1K8A P;  3OW2 K;  1YIT O;  3CCR O;  1VQM L;  1KD1 M;  3CPW K;  1VQ7 L;  3CC2 O;  3I56 L;  2OTL L;  1VQ5 O;  1YIJ O; 
#chains in the Genus database with same CATH topology
 3NKD A;  1YJW L;  3CC7 L;  3CMA O;  1YJN L;  1K9M P;  1VQN O;  1KQS K;  3CD6 L;  1VQ6 L;  2OTJ L;  3CCE L;  1KC8 P;  1N8R M;  2QEX O;  1K8A M;  1S72 L;  3CCQ O;  2QA4 L;  3CCS O;  3CCM L;  3I55 L;  1QVG K;  1NJI P;  3CC4 O;  1YJ9 O;  1JJ2 N;  3CME L;  1VQO O;  1VQ4 L;  1Q81 P;  1YIT L;  3CCR L;  1M90 P;  4W8K A;  3G6E O;  1K9M M;  1VQ8 L;  1QVF K;  1YI2 L;  4WJ0 A;  1VQ7 O;  3I56 O;  1VQP O;  1KC8 M;  1VQ5 L;  1VQL L;  3G4S O;  1YHQ O;  1YJW O;  3CC7 O;  3CCJ O;  3CXC N;  1Q86 P;  1Q7Y P;  1VQK O;  1NJI M;  1VQ9 L;  3G71 O;  3CCL L;  4QDL A;  1W2B N;  2OTJ O;  2QEX L;  3CCU L;  1M1K P;  1Q81 M;  1M90 M;  1Q82 P;  3CCV L;  2QA4 O;  1VQM O;  3OW2 N;  3CCM O;  3I55 O;  3CPW N;  5DLJ A;  4N06 A;  3CC2 L;  1YJ9 L;  2OTL O;  5DQT A;  5DS4 A;  1VQO L;  1N8R P;  1YIJ L;  1VQ4 O;  5DS5 A;  1K73 P;  5FCL A;  1Q86 M;  3G6E L;  1Q7Y M;  1VQ8 O;  1KD1 P;  1YI2 O;  3CMA L;  1QVF N;  1VQP L;  1YJN O;  1VQN L;  4P6I C;  3GOD A;  1M1K M;  3CD6 O;  1VQ6 O;  1KQS N;  3CCE O;  1Q82 M;  2YZS A;  3G4S L;  1VQL O;  1YHQ L;  3CXC K;  3CCJ L;  1S72 O;  3CCQ L;  3CCS L;  1VQK L;  3G71 L;  1VQ9 O;  1W2B K;  3CCL O;  4XTK A;  1JJ2 K;  3CC4 L;  1QVG N;  3CCU O;  3CME O;  1K73 M;  3CCV O;  1K8A P;  3OW2 K;  1YIT O;  3CCR O;  1VQM L;  1KD1 M;  3CPW K;  5DS6 A;  1VQ7 L;  3CC2 O;  3I56 L;  2OTL L;  5DQZ A;  1VQ5 O;  1YIJ O; 
#chains in the Genus database with same CATH homology
 3NKD A;  1YJW L;  3CC7 L;  3CMA O;  1YJN L;  1K9M P;  1VQN O;  1KQS K;  3CD6 L;  1VQ6 L;  2OTJ L;  3CCE L;  1KC8 P;  1N8R M;  2QEX O;  1K8A M;  1S72 L;  3CCQ O;  2QA4 L;  3CCS O;  3CCM L;  3I55 L;  1QVG K;  1NJI P;  3CC4 O;  1YJ9 O;  1JJ2 N;  3CME L;  1VQO O;  1VQ4 L;  1Q81 P;  1YIT L;  3CCR L;  1M90 P;  4W8K A;  3G6E O;  1K9M M;  1VQ8 L;  1QVF K;  1YI2 L;  4WJ0 A;  1VQ7 O;  3I56 O;  1VQP O;  1KC8 M;  1VQ5 L;  1VQL L;  3G4S O;  1YHQ O;  1YJW O;  3CC7 O;  3CCJ O;  3CXC N;  1Q86 P;  1Q7Y P;  1VQK O;  1NJI M;  1VQ9 L;  3G71 O;  3CCL L;  4QDL A;  1W2B N;  2OTJ O;  2QEX L;  3CCU L;  1M1K P;  1Q81 M;  1M90 M;  1Q82 P;  3CCV L;  2QA4 O;  1VQM O;  3OW2 N;  3CCM O;  3I55 O;  3CPW N;  5DLJ A;  4N06 A;  3CC2 L;  1YJ9 L;  2OTL O;  5DQT A;  5DS4 A;  1VQO L;  1N8R P;  1YIJ L;  1VQ4 O;  5DS5 A;  1K73 P;  5FCL A;  1Q86 M;  3G6E L;  1Q7Y M;  1VQ8 O;  1KD1 P;  1YI2 O;  3CMA L;  1QVF N;  1VQP L;  1YJN O;  1VQN L;  4P6I C;  3GOD A;  1M1K M;  3CD6 O;  1VQ6 O;  1KQS N;  3CCE O;  1Q82 M;  2YZS A;  3G4S L;  1VQL O;  1YHQ L;  3CXC K;  3CCJ L;  1S72 O;  3CCQ L;  3CCS L;  1VQK L;  3G71 L;  1VQ9 O;  1W2B K;  3CCL O;  4XTK A;  1JJ2 K;  3CC4 L;  1QVG N;  3CCU O;  3CME O;  1K73 M;  3CCV O;  1K8A P;  3OW2 K;  1YIT O;  3CCR O;  1VQM L;  1KD1 M;  3CPW K;  5DS6 A;  1VQ7 L;  3CC2 O;  3I56 L;  2OTL L;  5DQZ A;  1VQ5 O;  1YIJ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...