3CC2L

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cc2L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3cc2L01
1NJIM 1YJNL 3CCJL 2OTLO 3CMAO 1Q7YM 1VQ9O 3CPWN 1Q81P 3CC7O 2OTLL 3G71O 3CMAL 1M1KM 1VQ9L 1QVFN 1NJIP 3OW2N 3CC7L 3G71L 3CCSO 1VQKO 1VQ7O 3CCSL 1VQKL 2QEXO 1VQ7L 3CCQO 1Q81M 1QVGK 3CCQL 3CD6O 1JJ2N 1KQSK 3CC2O 3CD6L 1W2BK 1VQ6O 1VQPO 3CC2L 3I55O 1S72O 1K8AP 1VQ6L 1VQMO 1VQPL 1QVGN 1YIJO 3I55L 1S72L 3CXCK 1M90P 1VQ5O 1VQML 1YIJL 1KQSN 1K9MP 3CCUO 1KD1M 1VQOO 1VQ5L 1VQ4O 3CCEO 3CCUL 1VQOL 1VQ4L 1K8AM 3CCEL 1KD1P 1VQLO 3CMEO 3CC4L 1M90M 1YHQO 1VQLL 1VQNO 3CMEL 1YJWO 1K9MM 1KC8P 1YHQL 3CCLO 1VQNL 1N8RP 1YJWL 1QVFK 1YI2L 3CCLL 3OW2K 1VQ8L 3I56O 1Q86M 3G4SL 1Q82P 1W2BN 1YITO 3I56L 3CCVL 3CCRO 1K73M 3CC4O 1KC8M 2QA4O 1YITL 1N8RM 1Q86P 2OTJO 3CCRL 3CXCN 2QA4L 3G6EO 1JJ2K 2OTJL 1Q7YP 1K73P 3G6EL 3CPWK 1Q82M 1YI2O 1M1KP 1VQ8O 1YJ9O 3G4SO 3CCMO 1YJNO 1YJ9L 3CCJO 2QEXL 3CCVO 3CCML
chains in the Genus database with same CATH superfamily
1NJIM 1YJNL 3CCJL 2OTLO 3CMAO 1Q7YM 4P6IC 1VQ9O 5DS5A 3CPWN 1Q81P 3CC7O 2OTLL 3G71O 3CMAL 1M1KM 1VQ9L 1QVFN 1NJIP 3GODA 3OW2N 3CC7L 3G71L 3CCSO 1VQKO 1VQ7O 3CCSL 1VQKL 2QEXO 1VQ7L 3CCQO 1Q81M 1QVGK 3CCQL 4WJ0A 5DLJA 3CD6O 1JJ2N 1KQSK 3CC2O 4W8KA 5FCLA 3CD6L 1W2BK 1VQ6O 1VQPO 3CC2L 3I55O 1S72O 1K8AP 1VQ6L 1VQMO 1VQPL 1QVGN 1YIJO 3I55L 1S72L 3CXCK 1M90P 1VQ5O 1VQML 1YIJL 1KQSN 1K9MP 3CCUO 1KD1M 1VQOO 1VQ5L 5DQTA 1VQ4O 3CCEO 5DQZA 3CCUL 3NKDA 1VQOL 1VQ4L 1K8AM 3CCEL 1KD1P 1VQLO 4XTKA 3CMEO 3CC4L 1M90M 1YHQO 1VQLL 1VQNO 3CMEL 1YJWO 1K9MM 1KC8P 1YHQL 3CCLO 1VQNL 1N8RP 1YJWL 1QVFK 1YI2L 3CCLL 3OW2K 1VQ8L 3I56O 1Q86M 3G4SL 1Q82P 1W2BN 1YITO 3I56L 3CCVL 5DS6A 3CCRO 2YZSA 3CC4O 1K73M 2QA4O 5DS4A 1KC8M 1YITL 1N8RM 1Q86P 2OTJO 3CCRL 3CXCN 2QA4L 4N06A 3G6EO 1JJ2K 2OTJL 1Q7YP 4QDLA 1K73P 3G6EL 3CPWK 1Q82M 1YI2O 1M1KP 1VQ8O 1YJ9O 3G4SO 3CCMO 1YJNO 1YJ9L 3CCJO 2QEXL 3CCVO 3CCML
chains in the Genus database with same CATH topology
1NJIM 1YJNL 3CCJL 2OTLO 3CMAO 1Q7YM 4P6IC 1VQ9O 5DS5A 3CPWN 1Q81P 3CC7O 2OTLL 3G71O 3CMAL 1M1KM 1VQ9L 1QVFN 1NJIP 3GODA 3OW2N 3CC7L 3G71L 3CCSO 1VQKO 1VQ7O 3CCSL 1VQKL 2QEXO 1VQ7L 3CCQO 1Q81M 1QVGK 3CCQL 4WJ0A 5DLJA 3CD6O 1JJ2N 1KQSK 3CC2O 4W8KA 5FCLA 3CD6L 1W2BK 1VQ6O 1VQPO 3CC2L 3I55O 1S72O 1K8AP 1VQ6L 1VQMO 1VQPL 1QVGN 1YIJO 3I55L 1S72L 3CXCK 1M90P 1VQ5O 1VQML 1YIJL 1KQSN 1K9MP 3CCUO 1KD1M 1VQOO 1VQ5L 5DQTA 1VQ4O 3CCEO 5DQZA 3CCUL 3NKDA 1VQOL 1VQ4L 1K8AM 3CCEL 1KD1P 1VQLO 4XTKA 3CMEO 3CC4L 1M90M 1YHQO 1VQLL 1VQNO 3CMEL 1YJWO 1K9MM 1KC8P 1YHQL 3CCLO 1VQNL 1N8RP 1YJWL 1QVFK 1YI2L 3CCLL 3OW2K 1VQ8L 3I56O 1Q86M 3G4SL 1Q82P 1W2BN 1YITO 3I56L 3CCVL 5DS6A 3CCRO 2YZSA 3CC4O 1K73M 2QA4O 5DS4A 1KC8M 1YITL 1N8RM 1Q86P 2OTJO 3CCRL 3CXCN 2QA4L 4N06A 3G6EO 1JJ2K 2OTJL 1Q7YP 4QDLA 1K73P 3G6EL 3CPWK 1Q82M 1YI2O 1M1KP 1VQ8O 1YJ9O 3G4SO 3CCMO 1YJNO 1YJ9L 3CCJO 2QEXL 3CCVO 3CCML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI M;  1YJN L;  3CCJ L;  2OTL O;  3CMA O;  1Q7Y M;  1VQ9 O;  3CPW N;  1Q81 P;  3CC7 O;  2OTL L;  3G71 O;  3CMA L;  1M1K M;  1VQ9 L;  1QVF N;  1NJI P;  3OW2 N;  3CC7 L;  3G71 L;  3CCS O;  1VQK O;  1VQ7 O;  3CCS L;  1VQK L;  2QEX O;  1VQ7 L;  3CCQ O;  1Q81 M;  1QVG K;  3CCQ L;  3CD6 O;  1JJ2 N;  1KQS K;  3CC2 O;  3CD6 L;  1W2B K;  1VQ6 O;  1VQP O;  3CC2 L;  3I55 O;  1S72 O;  1K8A P;  1VQ6 L;  1VQM O;  1VQP L;  1QVG N;  1YIJ O;  3I55 L;  1S72 L;  3CXC K;  1M90 P;  1VQ5 O;  1VQM L;  1YIJ L;  1KQS N;  1K9M P;  3CCU O;  1KD1 M;  1VQO O;  1VQ5 L;  1VQ4 O;  3CCE O;  3CCU L;  1VQO L;  1VQ4 L;  1K8A M;  3CCE L;  1KD1 P;  1VQL O;  3CME O;  3CC4 L;  1M90 M;  1YHQ O;  1VQL L;  1VQN O;  3CME L;  1YJW O;  1K9M M;  1KC8 P;  1YHQ L;  3CCL O;  1VQN L;  1N8R P;  1YJW L;  1QVF K;  1YI2 L;  3CCL L;  3OW2 K;  1VQ8 L;  3I56 O;  1Q86 M;  3G4S L;  1Q82 P;  1W2B N;  1YIT O;  3I56 L;  3CCV L;  3CCR O;  1K73 M;  3CC4 O;  1KC8 M;  2QA4 O;  1YIT L;  1N8R M;  1Q86 P;  2OTJ O;  3CCR L;  3CXC N;  2QA4 L;  3G6E O;  1JJ2 K;  2OTJ L;  1Q7Y P;  1K73 P;  3G6E L;  3CPW K;  1Q82 M;  1YI2 O;  1M1K P;  1VQ8 O;  1YJ9 O;  3G4S O;  3CCM O;  1YJN O;  1YJ9 L;  3CCJ O;  2QEX L;  3CCV O;  3CCM L; 
#chains in the Genus database with same CATH topology
 1NJI M;  1YJN L;  3CCJ L;  2OTL O;  3CMA O;  1Q7Y M;  4P6I C;  1VQ9 O;  5DS5 A;  3CPW N;  1Q81 P;  3CC7 O;  2OTL L;  3G71 O;  3CMA L;  1M1K M;  1VQ9 L;  1QVF N;  1NJI P;  3GOD A;  3OW2 N;  3CC7 L;  3G71 L;  3CCS O;  1VQK O;  1VQ7 O;  3CCS L;  1VQK L;  2QEX O;  1VQ7 L;  3CCQ O;  1Q81 M;  1QVG K;  3CCQ L;  4WJ0 A;  5DLJ A;  3CD6 O;  1JJ2 N;  1KQS K;  3CC2 O;  4W8K A;  5FCL A;  3CD6 L;  1W2B K;  1VQ6 O;  1VQP O;  3CC2 L;  3I55 O;  1S72 O;  1K8A P;  1VQ6 L;  1VQM O;  1VQP L;  1QVG N;  1YIJ O;  3I55 L;  1S72 L;  3CXC K;  1M90 P;  1VQ5 O;  1VQM L;  1YIJ L;  1KQS N;  1K9M P;  3CCU O;  1KD1 M;  1VQO O;  1VQ5 L;  5DQT A;  1VQ4 O;  3CCE O;  5DQZ A;  3CCU L;  3NKD A;  1VQO L;  1VQ4 L;  1K8A M;  3CCE L;  1KD1 P;  1VQL O;  4XTK A;  3CME O;  3CC4 L;  1M90 M;  1YHQ O;  1VQL L;  1VQN O;  3CME L;  1YJW O;  1K9M M;  1KC8 P;  1YHQ L;  3CCL O;  1VQN L;  1N8R P;  1YJW L;  1QVF K;  1YI2 L;  3CCL L;  3OW2 K;  1VQ8 L;  3I56 O;  1Q86 M;  3G4S L;  1Q82 P;  1W2B N;  1YIT O;  3I56 L;  3CCV L;  5DS6 A;  3CCR O;  2YZS A;  3CC4 O;  1K73 M;  2QA4 O;  5DS4 A;  1KC8 M;  1YIT L;  1N8R M;  1Q86 P;  2OTJ O;  3CCR L;  3CXC N;  2QA4 L;  4N06 A;  3G6E O;  1JJ2 K;  2OTJ L;  1Q7Y P;  4QDL A;  1K73 P;  3G6E L;  3CPW K;  1Q82 M;  1YI2 O;  1M1K P;  1VQ8 O;  1YJ9 O;  3G4S O;  3CCM O;  1YJN O;  1YJ9 L;  3CCJ O;  2QEX L;  3CCV O;  3CCM L; 
#chains in the Genus database with same CATH homology
 1NJI M;  1YJN L;  3CCJ L;  2OTL O;  3CMA O;  1Q7Y M;  4P6I C;  1VQ9 O;  5DS5 A;  3CPW N;  1Q81 P;  3CC7 O;  2OTL L;  3G71 O;  3CMA L;  1M1K M;  1VQ9 L;  1QVF N;  1NJI P;  3GOD A;  3OW2 N;  3CC7 L;  3G71 L;  3CCS O;  1VQK O;  1VQ7 O;  3CCS L;  1VQK L;  2QEX O;  1VQ7 L;  3CCQ O;  1Q81 M;  1QVG K;  3CCQ L;  4WJ0 A;  5DLJ A;  3CD6 O;  1JJ2 N;  1KQS K;  3CC2 O;  4W8K A;  5FCL A;  3CD6 L;  1W2B K;  1VQ6 O;  1VQP O;  3CC2 L;  3I55 O;  1S72 O;  1K8A P;  1VQ6 L;  1VQM O;  1VQP L;  1QVG N;  1YIJ O;  3I55 L;  1S72 L;  3CXC K;  1M90 P;  1VQ5 O;  1VQM L;  1YIJ L;  1KQS N;  1K9M P;  3CCU O;  1KD1 M;  1VQO O;  1VQ5 L;  5DQT A;  1VQ4 O;  3CCE O;  5DQZ A;  3CCU L;  3NKD A;  1VQO L;  1VQ4 L;  1K8A M;  3CCE L;  1KD1 P;  1VQL O;  4XTK A;  3CME O;  3CC4 L;  1M90 M;  1YHQ O;  1VQL L;  1VQN O;  3CME L;  1YJW O;  1K9M M;  1KC8 P;  1YHQ L;  3CCL O;  1VQN L;  1N8R P;  1YJW L;  1QVF K;  1YI2 L;  3CCL L;  3OW2 K;  1VQ8 L;  3I56 O;  1Q86 M;  3G4S L;  1Q82 P;  1W2B N;  1YIT O;  3I56 L;  3CCV L;  5DS6 A;  3CCR O;  2YZS A;  3CC4 O;  1K73 M;  2QA4 O;  5DS4 A;  1KC8 M;  1YIT L;  1N8R M;  1Q86 P;  2OTJ O;  3CCR L;  3CXC N;  2QA4 L;  4N06 A;  3G6E O;  1JJ2 K;  2OTJ L;  1Q7Y P;  4QDL A;  1K73 P;  3G6E L;  3CPW K;  1Q82 M;  1YI2 O;  1M1K P;  1VQ8 O;  1YJ9 O;  3G4S O;  3CCM O;  1YJN O;  1YJ9 L;  3CCJ O;  2QEX L;  3CCV O;  3CCM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...