3CCQO

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3ccqO00
1YIJL 1VQ9L 1VQ9O 1YHQL 1YHQO 3I56L 3CCLO 3CCJL 1Q82M 3I56O 1VQ4O 3CCEO 3CCJO 1VQKL 1VQ6L 1K8AM 1VQ6O 1Q86P 3CPWK 3I55O 1VQPL 1VQLL 1VQPO 3CC4O 1KQSK 3CCUL 3G4SL 3CCUO 3G4SO 1VQ7L 1N8RM 1VQ7O 1YJWO 1KD1M 1QVGN 1N8RP 1KC8P 1JJ2N 1VQML 1YIJO 1VQMO 1KD1P 3CCQL 1YI2L 1YI2O 1Q86M 1YJNL 1VQKO 3CCSL 3CXCK 3CCVL 1Q81M 3CCML 1VQNL 1K9MP 1VQNO 1M1KM 1Q81P 1VQ5L 1VQLO 1KC8M 1M1KP 3CC7L 1K73P 3CC7O 1QVFK 3CPWN 2QEXL 1W2BK 1YITL 3OW2K 2OTJL 1KQSN 2OTJO 3CCQO 3G6EL 1NJIP 1YJNO 1K9MM 3CMEL 3CD6L 3CCSO 3CD6O 3CCVO 1VQOL 3CCMO 2QA4L 1YJ9L 1K73M 1YJ9O 1VQ5O 3CMAL 3CMAO 3CXCN 3CCLL 1VQ4L 3CCEL 2QEXO 1NJIM 1YITO 1QVGK 1Q82P 1VQ8L 3I55L 1JJ2K 1VQ8O 3G6EO 1K8AP 3G71L 3CC2L 3CCRL 3CC4L 1QVFN 1M90M 3G71O 3CC2O 3CCRO 3CMEO 2OTLL 2OTLO 1Q7YM 1W2BN 3OW2N 1S72L 1VQOO 1S72O 1YJWL 1M90P 2QA4O 1Q7YP
chains in the Genus database with same CATH superfamily
1YIJL 1VQ9L 1VQ9O 1YHQL 1YHQO 5DLJA 3I56L 3CCLO 3CCJL 1Q82M 3I56O 1VQ4O 3CCEO 3CCJO 1VQKL 1VQ6L 1K8AM 1VQ6O 1Q86P 3CPWK 3I55O 1VQPL 1VQLL 1VQPO 3CC4O 1KQSK 3CCUL 3G4SL 5FCLA 3CCUO 3G4SO 1VQ7L 1N8RM 1VQ7O 1YJWO 1KD1M 4N06A 1QVGN 1N8RP 1KC8P 1JJ2N 1VQML 1YIJO 1VQMO 1KD1P 3CCQL 1YI2L 5DQTA 1YI2O 1Q86M 1YJNL 1VQKO 3CCSL 3CXCK 5DQZA 3CCVL 1Q81M 4WJ0A 3CCML 1VQNL 1K9MP 1VQNO 1M1KM 1Q81P 1VQ5L 1VQLO 4P6IC 1KC8M 1M1KP 3CC7L 1K73P 3CC7O 1QVFK 5DS4A 3CPWN 2QEXL 1W2BK 1YITL 3OW2K 5DS5A 2OTJL 1KQSN 2OTJO 3CCQO 3NKDA 3G6EL 1NJIP 1YJNO 1K9MM 3CMEL 3CD6L 3CCSO 3CD6O 3CCVO 1VQOL 3CCMO 2QA4L 1YJ9L 1K73M 1YJ9O 1VQ5O 3CMAL 3CMAO 3GODA 3CXCN 4QDLA 3CCLL 1VQ4L 3CCEL 2QEXO 4W8KA 1NJIM 1YITO 1QVGK 1Q82P 1VQ8L 3I55L 1JJ2K 1VQ8O 3G6EO 1K8AP 3G71L 5DS6A 3CCRL 3CC2L 3CC4L 1M90M 3G71O 3CC2O 3CCRO 3CMEO 2OTLL 1QVFN 4XTKA 2OTLO 1Q7YM 1W2BN 3OW2N 1S72L 1VQOO 1S72O 1YJWL 1M90P 2QA4O 2YZSA 1Q7YP
chains in the Genus database with same CATH topology
1YIJL 1VQ9L 1VQ9O 1YHQL 1YHQO 5DLJA 3I56L 3CCLO 3CCJL 1Q82M 3I56O 1VQ4O 3CCEO 3CCJO 1VQKL 1VQ6L 1K8AM 1VQ6O 1Q86P 3CPWK 3I55O 1VQPL 1VQLL 1VQPO 3CC4O 1KQSK 3CCUL 3G4SL 5FCLA 3CCUO 3G4SO 1VQ7L 1N8RM 1VQ7O 1YJWO 1KD1M 4N06A 1QVGN 1N8RP 1KC8P 1JJ2N 1VQML 1YIJO 1VQMO 1KD1P 3CCQL 1YI2L 5DQTA 1YI2O 1Q86M 1YJNL 1VQKO 3CCSL 3CXCK 5DQZA 3CCVL 1Q81M 4WJ0A 3CCML 1VQNL 1K9MP 1VQNO 1M1KM 1Q81P 1VQ5L 1VQLO 4P6IC 1KC8M 1M1KP 3CC7L 1K73P 3CC7O 1QVFK 5DS4A 3CPWN 2QEXL 1W2BK 1YITL 3OW2K 5DS5A 2OTJL 1KQSN 2OTJO 3CCQO 3NKDA 3G6EL 1NJIP 1YJNO 1K9MM 3CMEL 3CD6L 3CCSO 3CD6O 3CCVO 1VQOL 3CCMO 2QA4L 1YJ9L 1K73M 1YJ9O 1VQ5O 3CMAL 3CMAO 3GODA 3CXCN 4QDLA 3CCLL 1VQ4L 3CCEL 2QEXO 4W8KA 1NJIM 1YITO 1QVGK 1Q82P 1VQ8L 3I55L 1JJ2K 1VQ8O 3G6EO 1K8AP 3G71L 5DS6A 3CCRL 3CC2L 3CC4L 1M90M 3G71O 3CC2O 3CCRO 3CMEO 2OTLL 1QVFN 4XTKA 2OTLO 1Q7YM 1W2BN 3OW2N 1S72L 1VQOO 1S72O 1YJWL 1M90P 2QA4O 2YZSA 1Q7YP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ L;  1VQ9 L;  1VQ9 O;  1YHQ L;  1YHQ O;  3I56 L;  3CCL O;  3CCJ L;  1Q82 M;  3I56 O;  1VQ4 O;  3CCE O;  3CCJ O;  1VQK L;  1VQ6 L;  1K8A M;  1VQ6 O;  1Q86 P;  3CPW K;  3I55 O;  1VQP L;  1VQL L;  1VQP O;  3CC4 O;  1KQS K;  3CCU L;  3G4S L;  3CCU O;  3G4S O;  1VQ7 L;  1N8R M;  1VQ7 O;  1YJW O;  1KD1 M;  1QVG N;  1N8R P;  1KC8 P;  1JJ2 N;  1VQM L;  1YIJ O;  1VQM O;  1KD1 P;  3CCQ L;  1YI2 L;  1YI2 O;  1Q86 M;  1YJN L;  1VQK O;  3CCS L;  3CXC K;  3CCV L;  1Q81 M;  3CCM L;  1VQN L;  1K9M P;  1VQN O;  1M1K M;  1Q81 P;  1VQ5 L;  1VQL O;  1KC8 M;  1M1K P;  3CC7 L;  1K73 P;  3CC7 O;  1QVF K;  3CPW N;  2QEX L;  1W2B K;  1YIT L;  3OW2 K;  2OTJ L;  1KQS N;  2OTJ O;  3CCQ O;  3G6E L;  1NJI P;  1YJN O;  1K9M M;  3CME L;  3CD6 L;  3CCS O;  3CD6 O;  3CCV O;  1VQO L;  3CCM O;  2QA4 L;  1YJ9 L;  1K73 M;  1YJ9 O;  1VQ5 O;  3CMA L;  3CMA O;  3CXC N;  3CCL L;  1VQ4 L;  3CCE L;  2QEX O;  1NJI M;  1YIT O;  1QVG K;  1Q82 P;  1VQ8 L;  3I55 L;  1JJ2 K;  1VQ8 O;  3G6E O;  1K8A P;  3G71 L;  3CC2 L;  3CCR L;  3CC4 L;  1QVF N;  1M90 M;  3G71 O;  3CC2 O;  3CCR O;  3CME O;  2OTL L;  2OTL O;  1Q7Y M;  1W2B N;  3OW2 N;  1S72 L;  1VQO O;  1S72 O;  1YJW L;  1M90 P;  2QA4 O;  1Q7Y P; 
#chains in the Genus database with same CATH topology
 1YIJ L;  1VQ9 L;  1VQ9 O;  1YHQ L;  1YHQ O;  5DLJ A;  3I56 L;  3CCL O;  3CCJ L;  1Q82 M;  3I56 O;  1VQ4 O;  3CCE O;  3CCJ O;  1VQK L;  1VQ6 L;  1K8A M;  1VQ6 O;  1Q86 P;  3CPW K;  3I55 O;  1VQP L;  1VQL L;  1VQP O;  3CC4 O;  1KQS K;  3CCU L;  3G4S L;  5FCL A;  3CCU O;  3G4S O;  1VQ7 L;  1N8R M;  1VQ7 O;  1YJW O;  1KD1 M;  4N06 A;  1QVG N;  1N8R P;  1KC8 P;  1JJ2 N;  1VQM L;  1YIJ O;  1VQM O;  1KD1 P;  3CCQ L;  1YI2 L;  5DQT A;  1YI2 O;  1Q86 M;  1YJN L;  1VQK O;  3CCS L;  3CXC K;  5DQZ A;  3CCV L;  1Q81 M;  4WJ0 A;  3CCM L;  1VQN L;  1K9M P;  1VQN O;  1M1K M;  1Q81 P;  1VQ5 L;  1VQL O;  4P6I C;  1KC8 M;  1M1K P;  3CC7 L;  1K73 P;  3CC7 O;  1QVF K;  5DS4 A;  3CPW N;  2QEX L;  1W2B K;  1YIT L;  3OW2 K;  5DS5 A;  2OTJ L;  1KQS N;  2OTJ O;  3CCQ O;  3NKD A;  3G6E L;  1NJI P;  1YJN O;  1K9M M;  3CME L;  3CD6 L;  3CCS O;  3CD6 O;  3CCV O;  1VQO L;  3CCM O;  2QA4 L;  1YJ9 L;  1K73 M;  1YJ9 O;  1VQ5 O;  3CMA L;  3CMA O;  3GOD A;  3CXC N;  4QDL A;  3CCL L;  1VQ4 L;  3CCE L;  2QEX O;  4W8K A;  1NJI M;  1YIT O;  1QVG K;  1Q82 P;  1VQ8 L;  3I55 L;  1JJ2 K;  1VQ8 O;  3G6E O;  1K8A P;  3G71 L;  5DS6 A;  3CCR L;  3CC2 L;  3CC4 L;  1M90 M;  3G71 O;  3CC2 O;  3CCR O;  3CME O;  2OTL L;  1QVF N;  4XTK A;  2OTL O;  1Q7Y M;  1W2B N;  3OW2 N;  1S72 L;  1VQO O;  1S72 O;  1YJW L;  1M90 P;  2QA4 O;  2YZS A;  1Q7Y P; 
#chains in the Genus database with same CATH homology
 1YIJ L;  1VQ9 L;  1VQ9 O;  1YHQ L;  1YHQ O;  5DLJ A;  3I56 L;  3CCL O;  3CCJ L;  1Q82 M;  3I56 O;  1VQ4 O;  3CCE O;  3CCJ O;  1VQK L;  1VQ6 L;  1K8A M;  1VQ6 O;  1Q86 P;  3CPW K;  3I55 O;  1VQP L;  1VQL L;  1VQP O;  3CC4 O;  1KQS K;  3CCU L;  3G4S L;  5FCL A;  3CCU O;  3G4S O;  1VQ7 L;  1N8R M;  1VQ7 O;  1YJW O;  1KD1 M;  4N06 A;  1QVG N;  1N8R P;  1KC8 P;  1JJ2 N;  1VQM L;  1YIJ O;  1VQM O;  1KD1 P;  3CCQ L;  1YI2 L;  5DQT A;  1YI2 O;  1Q86 M;  1YJN L;  1VQK O;  3CCS L;  3CXC K;  5DQZ A;  3CCV L;  1Q81 M;  4WJ0 A;  3CCM L;  1VQN L;  1K9M P;  1VQN O;  1M1K M;  1Q81 P;  1VQ5 L;  1VQL O;  4P6I C;  1KC8 M;  1M1K P;  3CC7 L;  1K73 P;  3CC7 O;  1QVF K;  5DS4 A;  3CPW N;  2QEX L;  1W2B K;  1YIT L;  3OW2 K;  5DS5 A;  2OTJ L;  1KQS N;  2OTJ O;  3CCQ O;  3NKD A;  3G6E L;  1NJI P;  1YJN O;  1K9M M;  3CME L;  3CD6 L;  3CCS O;  3CD6 O;  3CCV O;  1VQO L;  3CCM O;  2QA4 L;  1YJ9 L;  1K73 M;  1YJ9 O;  1VQ5 O;  3CMA L;  3CMA O;  3GOD A;  3CXC N;  4QDL A;  3CCL L;  1VQ4 L;  3CCE L;  2QEX O;  4W8K A;  1NJI M;  1YIT O;  1QVG K;  1Q82 P;  1VQ8 L;  3I55 L;  1JJ2 K;  1VQ8 O;  3G6E O;  1K8A P;  3G71 L;  5DS6 A;  3CCR L;  3CC2 L;  3CC4 L;  1M90 M;  3G71 O;  3CC2 O;  3CCR O;  3CME O;  2OTL L;  1QVF N;  4XTK A;  2OTL O;  1Q7Y M;  1W2B N;  3OW2 N;  1S72 L;  1VQO O;  1S72 O;  1YJW L;  1M90 P;  2QA4 O;  2YZS A;  1Q7Y P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...