3CCJO

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3ccjO00
3CPWN 1KQSK 3CC4O 3CCMO 1VQML 1VQ7O 1VQ4O 1YHQL 1VQNO 1YI2O 1Q82P 1KQSN 1YJNO 3CCEO 2QA4L 1K9MP 1JJ2N 2OTJO 1QVGN 1S72O 3CMEO 3G71L 3I55O 1W2BK 1Q7YM 2QA4O 1K73M 1VQ5O 1W2BN 1VQPO 1QVFK 1KD1P 1VQOL 1N8RM 2QEXL 1YIJL 3CMAL 1QVFN 1Q86P 3CCSL 1VQ9O 1K8AM 3CCLL 1VQ6O 1YJWL 3G4SL 1VQKL 1NJIM 1YJ9L 3CCQL 1VQMO 3CCJL 1M90M 1YHQO 1Q82M 1M1KM 1Q81P 3CCLO 3G4SO 3CCVL 1YITL 1K9MM 1YJ9O 3CD6L 3CC7L 3I56L 1VQLL 3G6EL 3G71O 1KC8P 3CXCK 2OTLL 3CCUL 3I56O 1Q7YP 1KD1M 1K73P 3G6EO 3CC2L 3CXCN 1VQOO 2QEXO 1Q86M 1YIJO 3CMAO 1VQ8L 3CC4L 3CCSO 2OTLO 3CCUO 1VQ7L 1VQ4L 1VQNL 3OW2K 1YI2L 1YJWO 1VQKO 1YJNL 3CCQO 3OW2N 3CCJO 1K8AP 1Q81M 3CCEL 1VQ8O 1NJIP 3CCVO 1M90P 1YITO 1M1KP 2OTJL 1S72L 3CMEL 3I55L 1JJ2K 3CD6O 3CC7O 1QVGK 1VQ5L 1KC8M 1VQLO 3CCRL 1VQPL 3CCML 1N8RP 3CPWK 1VQ9L 3CC2O 3CCRO 1VQ6L
chains in the Genus database with same CATH superfamily
3CPWN 1KQSK 3CC4O 3CCMO 1VQML 1VQ7O 1VQ4O 1YHQL 1VQNO 1YI2O 1Q82P 1KQSN 1YJNO 4N06A 3CCEO 2QA4L 1K9MP 1JJ2N 5DS6A 2OTJO 1QVGN 1S72O 3CMEO 3I55O 3G71L 2YZSA 1W2BK 1Q7YM 3NKDA 2QA4O 4QDLA 1K73M 1VQ5O 1W2BN 1VQPO 1QVFK 1KD1P 1VQOL 1N8RM 2QEXL 1YIJL 3CMAL 1QVFN 5DS4A 5DS5A 1Q86P 3CCSL 1VQ9O 1K8AM 3CCLL 1VQ6O 1YJWL 3G4SL 1VQKL 1NJIM 1YJ9L 3CCQL 1VQMO 3CCJL 1M90M 1YHQO 5DQZA 1Q82M 1M1KM 1Q81P 5FCLA 3CCLO 3G4SO 3CCVL 1YITL 1K9MM 1YJ9O 3CD6L 3CC7L 3I56L 5DQTA 1VQLL 3G6EL 3G71O 1KC8P 3CXCK 2OTLL 3CCUL 3I56O 1Q7YP 1KD1M 5DLJA 1K73P 3G6EO 3CC2L 3CXCN 1VQOO 2QEXO 1Q86M 1YIJO 3CMAO 1VQ8L 3CC4L 3CCSO 2OTLO 3CCUO 1VQ7L 1VQ4L 1VQNL 3OW2K 1YI2L 1YJWO 1VQKO 1YJNL 3CCQO 3OW2N 3CCJO 1K8AP 1Q81M 4WJ0A 3CCEL 1VQ8O 1NJIP 3CCVO 1M90P 3GODA 1YITO 1M1KP 2OTJL 1S72L 3CMEL 3I55L 1JJ2K 3CD6O 3CC7O 1QVGK 1VQ5L 1KC8M 1VQLO 3CCRL 1VQPL 4P6IC 4W8KA 3CCML 1N8RP 3CPWK 1VQ9L 3CC2O 4XTKA 3CCRO 1VQ6L
chains in the Genus database with same CATH topology
3CPWN 1KQSK 3CC4O 3CCMO 1VQML 1VQ7O 1VQ4O 1YHQL 1VQNO 1YI2O 1Q82P 1KQSN 1YJNO 4N06A 3CCEO 2QA4L 1K9MP 1JJ2N 5DS6A 2OTJO 1QVGN 1S72O 3CMEO 3I55O 3G71L 2YZSA 1W2BK 1Q7YM 3NKDA 2QA4O 4QDLA 1K73M 1VQ5O 1W2BN 1VQPO 1QVFK 1KD1P 1VQOL 1N8RM 2QEXL 1YIJL 3CMAL 1QVFN 5DS4A 5DS5A 1Q86P 3CCSL 1VQ9O 1K8AM 3CCLL 1VQ6O 1YJWL 3G4SL 1VQKL 1NJIM 1YJ9L 3CCQL 1VQMO 3CCJL 1M90M 1YHQO 5DQZA 1Q82M 1M1KM 1Q81P 5FCLA 3CCLO 3G4SO 3CCVL 1YITL 1K9MM 1YJ9O 3CD6L 3CC7L 3I56L 5DQTA 1VQLL 3G6EL 3G71O 1KC8P 3CXCK 2OTLL 3CCUL 3I56O 1Q7YP 1KD1M 5DLJA 1K73P 3G6EO 3CC2L 3CXCN 1VQOO 2QEXO 1Q86M 1YIJO 3CMAO 1VQ8L 3CC4L 3CCSO 2OTLO 3CCUO 1VQ7L 1VQ4L 1VQNL 3OW2K 1YI2L 1YJWO 1VQKO 1YJNL 3CCQO 3OW2N 3CCJO 1K8AP 1Q81M 4WJ0A 3CCEL 1VQ8O 1NJIP 3CCVO 1M90P 3GODA 1YITO 1M1KP 2OTJL 1S72L 3CMEL 3I55L 1JJ2K 3CD6O 3CC7O 1QVGK 1VQ5L 1KC8M 1VQLO 3CCRL 1VQPL 4P6IC 4W8KA 3CCML 1N8RP 3CPWK 1VQ9L 3CC2O 4XTKA 3CCRO 1VQ6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW N;  1KQS K;  3CC4 O;  3CCM O;  1VQM L;  1VQ7 O;  1VQ4 O;  1YHQ L;  1VQN O;  1YI2 O;  1Q82 P;  1KQS N;  1YJN O;  3CCE O;  2QA4 L;  1K9M P;  1JJ2 N;  2OTJ O;  1QVG N;  1S72 O;  3CME O;  3G71 L;  3I55 O;  1W2B K;  1Q7Y M;  2QA4 O;  1K73 M;  1VQ5 O;  1W2B N;  1VQP O;  1QVF K;  1KD1 P;  1VQO L;  1N8R M;  2QEX L;  1YIJ L;  3CMA L;  1QVF N;  1Q86 P;  3CCS L;  1VQ9 O;  1K8A M;  3CCL L;  1VQ6 O;  1YJW L;  3G4S L;  1VQK L;  1NJI M;  1YJ9 L;  3CCQ L;  1VQM O;  3CCJ L;  1M90 M;  1YHQ O;  1Q82 M;  1M1K M;  1Q81 P;  3CCL O;  3G4S O;  3CCV L;  1YIT L;  1K9M M;  1YJ9 O;  3CD6 L;  3CC7 L;  3I56 L;  1VQL L;  3G6E L;  3G71 O;  1KC8 P;  3CXC K;  2OTL L;  3CCU L;  3I56 O;  1Q7Y P;  1KD1 M;  1K73 P;  3G6E O;  3CC2 L;  3CXC N;  1VQO O;  2QEX O;  1Q86 M;  1YIJ O;  3CMA O;  1VQ8 L;  3CC4 L;  3CCS O;  2OTL O;  3CCU O;  1VQ7 L;  1VQ4 L;  1VQN L;  3OW2 K;  1YI2 L;  1YJW O;  1VQK O;  1YJN L;  3CCQ O;  3OW2 N;  3CCJ O;  1K8A P;  1Q81 M;  3CCE L;  1VQ8 O;  1NJI P;  3CCV O;  1M90 P;  1YIT O;  1M1K P;  2OTJ L;  1S72 L;  3CME L;  3I55 L;  1JJ2 K;  3CD6 O;  3CC7 O;  1QVG K;  1VQ5 L;  1KC8 M;  1VQL O;  3CCR L;  1VQP L;  3CCM L;  1N8R P;  3CPW K;  1VQ9 L;  3CC2 O;  3CCR O;  1VQ6 L; 
#chains in the Genus database with same CATH topology
 3CPW N;  1KQS K;  3CC4 O;  3CCM O;  1VQM L;  1VQ7 O;  1VQ4 O;  1YHQ L;  1VQN O;  1YI2 O;  1Q82 P;  1KQS N;  1YJN O;  4N06 A;  3CCE O;  2QA4 L;  1K9M P;  1JJ2 N;  5DS6 A;  2OTJ O;  1QVG N;  1S72 O;  3CME O;  3I55 O;  3G71 L;  2YZS A;  1W2B K;  1Q7Y M;  3NKD A;  2QA4 O;  4QDL A;  1K73 M;  1VQ5 O;  1W2B N;  1VQP O;  1QVF K;  1KD1 P;  1VQO L;  1N8R M;  2QEX L;  1YIJ L;  3CMA L;  1QVF N;  5DS4 A;  5DS5 A;  1Q86 P;  3CCS L;  1VQ9 O;  1K8A M;  3CCL L;  1VQ6 O;  1YJW L;  3G4S L;  1VQK L;  1NJI M;  1YJ9 L;  3CCQ L;  1VQM O;  3CCJ L;  1M90 M;  1YHQ O;  5DQZ A;  1Q82 M;  1M1K M;  1Q81 P;  5FCL A;  3CCL O;  3G4S O;  3CCV L;  1YIT L;  1K9M M;  1YJ9 O;  3CD6 L;  3CC7 L;  3I56 L;  5DQT A;  1VQL L;  3G6E L;  3G71 O;  1KC8 P;  3CXC K;  2OTL L;  3CCU L;  3I56 O;  1Q7Y P;  1KD1 M;  5DLJ A;  1K73 P;  3G6E O;  3CC2 L;  3CXC N;  1VQO O;  2QEX O;  1Q86 M;  1YIJ O;  3CMA O;  1VQ8 L;  3CC4 L;  3CCS O;  2OTL O;  3CCU O;  1VQ7 L;  1VQ4 L;  1VQN L;  3OW2 K;  1YI2 L;  1YJW O;  1VQK O;  1YJN L;  3CCQ O;  3OW2 N;  3CCJ O;  1K8A P;  1Q81 M;  4WJ0 A;  3CCE L;  1VQ8 O;  1NJI P;  3CCV O;  1M90 P;  3GOD A;  1YIT O;  1M1K P;  2OTJ L;  1S72 L;  3CME L;  3I55 L;  1JJ2 K;  3CD6 O;  3CC7 O;  1QVG K;  1VQ5 L;  1KC8 M;  1VQL O;  3CCR L;  1VQP L;  4P6I C;  4W8K A;  3CCM L;  1N8R P;  3CPW K;  1VQ9 L;  3CC2 O;  4XTK A;  3CCR O;  1VQ6 L; 
#chains in the Genus database with same CATH homology
 3CPW N;  1KQS K;  3CC4 O;  3CCM O;  1VQM L;  1VQ7 O;  1VQ4 O;  1YHQ L;  1VQN O;  1YI2 O;  1Q82 P;  1KQS N;  1YJN O;  4N06 A;  3CCE O;  2QA4 L;  1K9M P;  1JJ2 N;  5DS6 A;  2OTJ O;  1QVG N;  1S72 O;  3CME O;  3I55 O;  3G71 L;  2YZS A;  1W2B K;  1Q7Y M;  3NKD A;  2QA4 O;  4QDL A;  1K73 M;  1VQ5 O;  1W2B N;  1VQP O;  1QVF K;  1KD1 P;  1VQO L;  1N8R M;  2QEX L;  1YIJ L;  3CMA L;  1QVF N;  5DS4 A;  5DS5 A;  1Q86 P;  3CCS L;  1VQ9 O;  1K8A M;  3CCL L;  1VQ6 O;  1YJW L;  3G4S L;  1VQK L;  1NJI M;  1YJ9 L;  3CCQ L;  1VQM O;  3CCJ L;  1M90 M;  1YHQ O;  5DQZ A;  1Q82 M;  1M1K M;  1Q81 P;  5FCL A;  3CCL O;  3G4S O;  3CCV L;  1YIT L;  1K9M M;  1YJ9 O;  3CD6 L;  3CC7 L;  3I56 L;  5DQT A;  1VQL L;  3G6E L;  3G71 O;  1KC8 P;  3CXC K;  2OTL L;  3CCU L;  3I56 O;  1Q7Y P;  1KD1 M;  5DLJ A;  1K73 P;  3G6E O;  3CC2 L;  3CXC N;  1VQO O;  2QEX O;  1Q86 M;  1YIJ O;  3CMA O;  1VQ8 L;  3CC4 L;  3CCS O;  2OTL O;  3CCU O;  1VQ7 L;  1VQ4 L;  1VQN L;  3OW2 K;  1YI2 L;  1YJW O;  1VQK O;  1YJN L;  3CCQ O;  3OW2 N;  3CCJ O;  1K8A P;  1Q81 M;  4WJ0 A;  3CCE L;  1VQ8 O;  1NJI P;  3CCV O;  1M90 P;  3GOD A;  1YIT O;  1M1K P;  2OTJ L;  1S72 L;  3CME L;  3I55 L;  1JJ2 K;  3CD6 O;  3CC7 O;  1QVG K;  1VQ5 L;  1KC8 M;  1VQL O;  3CCR L;  1VQP L;  4P6I C;  4W8K A;  3CCM L;  1N8R P;  3CPW K;  1VQ9 L;  3CC2 O;  4XTK A;  3CCR O;  1VQ6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...