3GODA

Structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
b'DISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cas1
publication title Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Immune system
total genus 115
structure length 320
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01867 Cas_Cas1 CRISPR associated protein Cas1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3godA02
3.100.10.20 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3godA01
4P6IC 4XTKA 4W8KA 3NKEA 4N06A 4QDLA 3NKDA 4WJ0A 5DLJA 5FCLA 5DS5A 5DS6A 5DQTA 2YZSA 3GODA 5DS4A 5DQZA
chains in the Genus database with same CATH superfamily
4MS2A 1V74B 5COGA 3ABLC 2A6EF 1KD1M 1FMVA 4IWBA 2EPKX 3ZWIA 1TWCA 2J9UA 1ORSC 2QUPA 1WATA 1M90P 3CCMO 5JRAA 3M1CB 1ZHXA 2XLOA 1NSGB 256BA 3EGXB 1K9MM 3GWLA 1DOWA 4MVZA 3W4YA 2WZFA 1E83A 2M64A 4J7YA 3M4BA 1L7CA 5COFA 1ZHZA 1VQ6L 1APCA 4U5GA 2WZGA 2QA4L 1YJNO 2D5RB 4CJOA 2LFDA 4E7SA 2NUPB 1QSPA 4XEFA 2YZSA 4BJTA 4IAQA 2HMZA 3A11A 3W8HA 3FOOA 4Q7CA 3NYJA 3CXCK 2EPLX 5COMA 4OD4A 3TOMA 3FAJA 1E2XA 3ASOC 3QTHA 4G7ZF 2NPUA 1VQKO 1VTMP 1ZW2A 3QZCA 4YN0B 3DKAA 2GA0A 5EGYA 2PX3A 2HJMA 1Q7YM 1GQAA 3EQLF 5JP7A 3IHUA 1XZQA 4WJ0A 3WAQA 4NTBA 3UGOA 4J7TA 3W8IA 1KTMA 4JW1A 3AG3C 3DZAA 2ZXWC 4E0IA 3VAYA 3PMRA 1LKXA 3EGDB 5B3SC 3OA1A 2C03A 5KYXB 3K66A 3K7DA 4WABA 4PK4A 3JZ0A 3U9JA 3O55A 1LIHA 1FNTc 5L0HA 4GEHA 1JOGA 1MMDA 1O5HA 1D0YA 2M4EA 4XEVA 3RYLA 1Q82M 3CPWK 2CNWA 4FWVA 3U2MA 2YL7A 4JURI 2R7SA 2B0HA 3G4XA 1D1AA 2X0CA 3NMKA 1U6HA 3RQGA 2QEXO 1G8XA 2HSBA 1YZCA 5JS5A 1YVIA 4C3BA 1DOVA 3SNHA 2KC3A 4JZAA 4H4KC 5EK0A 1JR8A 3CMAL 3JCUQ 1KQSN 3J06A 1U89A 3TD7A 2JD3A 4C3EA 4A4AA 1H9GA 3G4SO 4AE4A 1PD1A 1T01A 3OW2N 1LI5A 2LFFA 4M63A 3S9OA 2ASRA 3CCEO 2YWAA 3Q6MA 3K1IA 1VQPL 4K1OA 4Z9HA 1W2BN 3MX3A 3TOLA 1HY5A 3U3FA 4XLNF 3CC4L 3I55O 3DMDA 3GM3A 4O79A 1YI2O 2XS8A 3CCML 4XPYA 1G4US 3DAFA 2Y3DA 1Y6DA 4D4XA 3JYHA 1NFOA 1E86A 3TK0A 2L9JA 3T6BA 1OKKA 5L0IA 1S72O 2YHSA 2XXAB 3JTLO 2W4BA 3K1HA 1QZXA 3GWNA 5A6KA 2V3CC 3ITFA 2PF4E 2VCCA 1VYIA 3L8IA 2FGYA 1D1BA 4CSAA 4IRUA 3EZIA 2XRHA 1I4YA 4CIPA 2W9YA 1VQNL 2KNHA 1T6IA 5KYWA 4JEAA 1O87A 4EWCA 4YT2A 2P0NA 4XEKA 2IXNA 2D4UA 3LNMB 4F4BA 2Z15A 4I3MA 3UGPA 5E3AA 4DVYP 4BJ6C 2J9BA 1T6QA 2A1DD 4JRZA 3B71A 1K9MP 1QVFK 4X0RA 4MW8A 2R7WA 1SZIA 3K1IC 3EG9A 1T9KA 3CCVO 4G78A 1BR2A 4KBLA 2IM8A 2LD6A 2YLIA 2BL2A 4CS8A 5HSWA 3CSKA 4N6CA 1VQ9O 1EKYA 4MVOA 4A2NB 3V5YA 4WGYA 3NMIA 4U9DA 4HE8D 3GEEA 3JRTA 2LQGA 4G7OF 2ZPAA 1AEPA 1YITL 4MNDA 3POVA 4LLEA 2AWCA 3CXCN 1VK5A 4NC3A 5JLIA 1Q81M 1M57C 3T4RA 2Q7RA 3LJBA 1JJ2N 4O7GA 4CSAC 2J7PD 1Q7YP 4XTKA 1VQLL 1WOLA 1OXKA 1VQOO 2WZLA 4Z9JA 3CCSL 2YRFA 1JPNA 2QTVA 2Q00A 2UUIA 3OWTA 3S90A 1OXBA 2NSGA 1YJGA 1HMOA 4JCHA 2KJGA 2NUTB 4PR9A 1TWAA 1M2VA 3AGUA 4YWQA 4K7BA 4LERA 1I4ZA 4I1OB 4I1MA 3JSZA 2EIKC 3RIPA 3C62A 2W4MA 4BPMA 4EBKA 2VB6A 2YEVA 3IQ6A 2O9XA 1C03A 1QQ3A 2IXPA 4NQFA 3CCEL 4CS8C 2XLVA 2Q3TA 4JTCB 1GGQA 3EGXA 5B3IA 2LSEA 4MVMA 4MQ9F 1Q82P 3H2UA 1JRAA 4IJJA 1Z7Qc 4JJGA 3B0UX 2DI3A 1QVGK 3CPWN 3CC2O 2OTJO 2A0BA 1VQ4L 3A9CA 3CCUL 1YI2L 3ASNC 2H7BA 3NYMA 2NUPA 2HS5A 1G5ZA 3DWWA 4CJGA 4JJFA 2WL8A 1J8YF 3HNJA 1TFKB 4DVZA 2WB7A 3C18A 4DRIB 5FZTA 2PBEA 3CD6O 1CGOA 4OINF 1XZPA 3Q7LA 4DRHB 1VB5A 3RQFA 1OCZC 4H54A 1H9TA 1OQCA 4CDVA 4JEBA 2LK4A 3C8GD 3JRMO 4JTDB 2R7VA 4BJ5C 5AC5A 2R7TA 1C17M 1ZHYA 3CCJL 2HMQA 3CC7O 3Q7GA 3HKKA 3C8GB 5F28E 1MNEA 2Q9CA 2TMVP 1A7EA 4CS7A 3L0IA 1ZU4A 2ZXPA 3RVYA 1NLXA 3NDBB 1U0BB 2EPNA 3AG2C 3UMIA 1QKRA 1TWGA 4YK5A 3X1OA 1VQ7L 4B6IA 1MMNA 3EGDA 5DVWA 4UDVA 4G7HF 3SXKA 5KYXA 4KNVA 2IXMA 1VQ5L 3EHMA 3LNRA 4W8KA 3EJNA 1VQ9L 3U9MA 4CBEA 2OEVA 3QMKA 3C7JA 3SP1A 1K8AP 4LDRA 1FAPB 2GDCA 3NYLA 1CGME 1OCCC 2WVOA 4K0DA 3CMEO 1S05A 2XL6A 2IXOA 3IQCA 1V54C 3RW0A 1F1MA 3B29A 1Z5ZA 3T6JA 1KNYA 2IYLD 4W8PA 2J46A 4GQHA 3MBGA 1TR2A 4JC7A 3N2ZB 2RSEB 2HJ3A 2YQYA 2YL0A 3TJ5A 5KYUB 3H65A 3V5XA 1QVFN 3CQZA 5E2QA 3AQBA 3LEOA 3CCQO 4JE9A 5GPGB 4IB4A 3CEXA 3HNLA 3X2QC 1VQMO 3IPMO 3QW0A 3B0PA 2IBFA 3CCLL 5K0IA 4DRJB 2Y69C 4I44A 2J0WA 5L3QA 2P61A 2LCHA 2XL8A 2YLGA 1FR0A 5DS4A 2Y3HA 2J0XA 4CS9A 4QDLA 1Q81P 3ZIBA 3KKBA 1ST6A 1YDIA 4KNWA 3WODF 3NKEA 4FX5A 4U5EE 3CC2L 2XXAA 3DJUB 1BZ4A 2FAPB 3ABMC 1OW6A 4E18A 2CYDA 2GFHA 1LE2A 3G6EO 2MHRA 3KYIA 5BQGA 1VLTA 2Q9BA 3HNIA 1YYXA 4E7ZA 1SMYF 5E3CA 3I56L 3G71O 3UR3C 3EZHA 2QLAA 1YA7O 3LESA 4BJ6A 1E85A 4O6NA 3V5ZA 5KYYB 4EBBA 4Q5SF 3ZVRA 1Q86P 2KGOA 4J32B 2OTLL 4EUKB 2P7VA 1R4TA 1TFOB 5A6AA 3AQCA 5L0JA 1IW7F 3CC7L 3O39A 3KMIA 1YARO 1QVGN 1A41A 2Y39A 5JVEA 4CS9C 4MTFA 4EHPA 3RH3A 1H6GA 5T3TA 2OU6A 4WGZA 1RKEB 1Z63A 1BDJB 5CI9A 3ZC4A 4XLPF 2J45A 1JMWA 1FFHA 1HE9A 4N6HA 1D1CA 4YT8A 5FCLA 1ORYA 2CNWD 1YJNL 1CPQA 4MVSA 3F47A 3LUTB 2HV7A 1OCRC 2VH3A 4HFFB 1K8AM 1B68A 3AG4C 2EPMX 1ORJA 4KI2A 4RDAA 3JSEO 3T9OA 4J30B 2AWYA 3TQOA 3QVYA 4JCZA 3EPVA 2J7PA 3B9QA 3DE8A 4C7OB 3NMJA 3NRHA 4U5DE 2NUTA 5AC4A 1V4AA 4YL0A 1EQ1A 3U0CA 3DM5A 2EINC 1VQKL 1RXQA 3QW1A 1XWJA 3MYFA 3Q6NA 4MTGA 1W2WA 1ZYRF 1SR2A 2XM4A 2MYSA 2YVKA 3C8ZA 1BR4A 1H7IA 3LLIA 3M4CA 5A69A 2NSFA 1RJ9B 5D92A 3S27A 4IARA 2HV6A 2OKUA 3I5PA 1JAFA 1NU9C 1RMVA 1SF8A 4BEMJ 3G50A 3RVZA 3TJ6A 5DQZA 2KQ9A 2KSFA 4YL1A 1OR3A 3EFOA 2A6HF 2UUHA 2L6FA 3FHDA 1GS9A 3IQ5A 3WG7C 2XLMA 1PD0A 2G3VA 1Q0MA 1OCOC 3N0TA 2H7VC 2EIMC 2DB4A 3ZDLA 2QEXL 3E70C 1OW8A 4OIQF 2A69F 1K73P 3GANA 4PJNA 4LDKA 2HSQA 4U9EA 3VYWA 2IOQA 4DBQA 2CCYA 4PJMA 4BJ5A 1MMAA 2R9RB 3M79A 3C8GA 2LP4A 1D0XA 3FMSA 3G4SL 1PCXA 1EI7A 1FTSA 3UMHA 2A68F 1Q86M 3TULA 3KPHA 5L0FA 3ECSA 3OW2K 1HE1A 1BR1A 4MVQA 2PP4A 4G0HA 4BG0A 2HFIA 3I55L 3DE9A 1WN0A 3VRCA 5L3VA 3EFOB 1W2BK 1Q0FA 2A0UA 2AVKA 3SXMA 3I5QA 5JT4A 1M56C 4LLCA 5A6BD 4YT5A 1S72L 2YL1A 2RD9A 4RBNA 1WWPA 3O10A 5B1BC 1AUEA 2OOCA 4GYTA 3GEIA 5KYUA 3HTKC 1VQ8O 3CMAO 1M2OA 1YIJO 3AG1C 3LS0A 3PHF2 1LE4A 2WVNA 4PJJA 2J9VA 1J8MF 1Q0GA 1R5ID 3CCRO 1A7DA 3WHNA 1YJWO 2V26A 2L81A 3UMKA 3GODA 3DM9B 1VQPO 4JKVA 4U5FE 5AGFA 4P6IC 3L1MA 3CZ6A 2R25A 1ZHTA 2DYRC 4MW3A 2HKVA 3CCVL 3CC4O 3EH2A 1LM3B 2Y3BA 3ZSUA 5D91A 2EILC 4FAPB 4DOZA 3U3BA 1S7ZA 3MFNA 4U5BE 3NG1A 1C02A 2L6HA 1ZVZA 5JUAA 2P1AA 1OR2A 2DGJA 1Z6AA 3SXYA 3PDMP 4L6RA 4DXWA 2QE9A 1NFNA 1V55C 3CAXA 5B1AC 4NCQA 3EHNA 2ICWG 3L8JA 2PX0A 4IAOA 2J9WA 4ER9A 1Z3IX 1VQNO 1TQGA 1LI7A 3VF0A 3AOUA 4XQ1A 1HW2A 4Q4ZF 1BBHA 2R7OA 2E87A 2PFDA 2F22A 4XPXA 2HZ8A 4U5HA 2I8BA 1VQOL 1JJ2K 2GWWA 5KYYA 3RQEA 2R05A 1UG7A 3IQTA 5CIVA 4ZLCA 1LPEA 1N1CA 4EBJA 1A0BA 1K73M 1IZMA 1ZW3A 5E33A 2H8AA 3W2WA 3S0XA 1KC8M 1LS4A 4N06A 2CW0F 5DLJA 3ATPA 4D4NA 1Q0DA 1G4WR 3ZTZA 2JPUA 5BQHA 3SYNA 2C04A 2FFHA 4E0HA 2VASA 4ULVA 5DS6A 1YAUO 1I5NA 2XLDA 1LVKA 1RKEA 4DBRA 1NJIM 1VMAA 3H2VA 5TJ5E 3L34A 3AGTA 1WGWA 2PNOA 3S84A 2ZXOA 1K05A 2XLEA 2VCAA 1YITO 2OTJL 2CGEA 2XM0A 1VLSA 3S29A 2BC5A 2OEXA 4NTFA 2EPOA 3M15A 1RCPA 2LIGA 1N8RP 2DYSC 5L0DA 1YJ9O 2XS1A 1EA8A 3GM1A 1VQLO 4PACA 3V7OA 3U5SA 3JYYA 4AL1A 4ZLDA 3CCSO 1D0ZA 4E17A 3CD6L 4MVUA 3GM2A 4RD9A 2VCBA 4C7OA 3US6A 1Q0KA 5DQTA 2YLDA 3W2VA 1VQ8L 5HV9A 2OJQA 3SXZA 3U8PA 1YIJL 2HUJA 4C3DA 5F5FA 3LEVA 1L3PA 1JPJA 2ZD9A 3F46A 3DXJF 3DAGA 1FFTC 1YYJA 5IY5C 3CCRL 3R2PA 3NKDA 4CDAA 1YJWL 5L0GA 1K40A 3ABKC 3JT1A 1YZAA 3LLKA 3MLGA 5BUOA 3SZRA 1RJ9A 2Q9AA 1CPRA 4JTAB 4JVSA 4YT4A 4IGGA 3PCVA 1VYKA 3HJCA 1VQ4O 3CCUO 2KW3C 1Z23A 5CI8A 1MQVA 3B0VC 3HLZA 3LS1A 4LACB 3RFYA 4CDYA 1M90M 1NG1A 2J8WA 1M1KP 4CX9A 3DJNB 2ETSA 3U2LA 1QLEC 1CGNA 4BEJA 1YLMA 3CMEL 4XPWA 1YHQO 2L7AA 2R7XA 1HW1A 1KU2A 3KYJA 3U8VA 5JSLA 4AL0A 4P9TA 4N4WA 3LAYA 1KD1P 2R03A 3DD7A 1WASA 3CCJO 2BE5F 4HFKB 3CCQL 5DS5A 3I4UA 4O6MA 2OCCC 2Q4FA 2XSEA 4AE4B 1O3UA 2R7UA 2MWQA 1YA9A 3N24A 1VQML 4ONSA 1SYQA 1AVOB 4CIHA 1NZEA 1MMGA 2G3KA 2XLWA 4ULWA 3FDQA 1K04A 4U5CE 4PJLA 1VQ7O 4EKWA 2OJED 3GORA 1WTYA 4ANJA 3C63A 2EIJC 3DI5A 3O6XA 1ZHWA 1OW7A 1VQ5O 4P9FA 2X51A 1VQ6O 3K33A 2JX0A 4MVRA 2QA4O 4NTAA 2B0JA 1OKKD 4QI2A 4OD5A 4O6YA 2R7QA 2YL3A 3KL4A 1T6UA 2R7RA 4HEAJ 4YL3A 4MTOA 3HNKA 4OIOF 4YJWA 2H7OA 3KH2A 2KYHA 3QVZA 2KK1A 2AU5A 5A6BA 4OIRF 4PFOA 3G6EL 1ZZPA 4R32A 3T6GB 1KC8P 3EH1A 2P6VA 1YJ9L 1N8RM 1PV3A 5KYWB 3G71L 3S28A 2QNLA 3CCLO 1E84A 1GM5A 2NG1A 2G62A 5KYNA 5F5HA 1NJIP 2L6GA 2XL4A 2Y3GA 2CDQA 3EG9B 1ZU5A 1KQSK 3ZTMA 5BQIA 3IEEA 1TWHA 2VC9A 4AK9A 4OIPF 2I15A 1TKNA 4QI0A 5A6JA 4PFPA 3K6BA 1NBBA 1NU7D 4JIOA 4EIYA 3R7CA 4XWJA 2WVQA 3ZQVA 4Z9IA 3VM6A 3GEHA 4LDQA 2ZXRA 2AP3A 5L0CA 2QY9A 4NY3A 2OG2A 3SEOA 2GAQA 2OQMA 2XLHA 5T3WA 3FXHA 4FESA 3UNGC 3AJMA 5T1DB 3MYIA 5EHHA 3OEOA 4AX2A 3BEHA 3FOPA 3BRJA 3FVYA 1VOMA 1HMDA 1M1KM 3G4ZA 3ZQYA 3ZG1A 3RF3A 1QPUA 1Y4CA 2YKZA 3FAPB 3E9VA 3I56O 1A7VA 1LS1A 1T5OA 1RKCA 4KC9A 1YHQL 2W45A 1UFBA 2OTLO 2R02A 1M6TA 1MNDA 1QVXA 1FMWA 1M2VB 3RKOF 4BJ1A 4DJ9A
chains in the Genus database with same CATH topology
4YT8A 4XTKA 2VASA 1VQLL 5FCLA 5DS6A 2CNWD 1YJNL 1LVKA 1VQOO 4DBRA 2WZLA 1NJIM 3F47A 1VMAA 3CCSL 3ABLC 1JPNA 2HV7A 2A6EF 1KD1M 2QTVA 1FMVA 3L34A 3OWTA 4IWBA 1OCRC 1WGWA 2VH3A 4HFFB 1TWCA 1K8AM 2J9UA 2ZXOA 3AG4C 4JCHA 1YITO 2OTJL 4KI2A 2KJGA 2CGEA 2NUTB 1M90P 1TWAA 1M2VA 4RDAA 4YWQA 4K7BA 3CCMO 3M1CB 4LERA 4I1OB 1ZHXA 4I1MA 3JSZA 3S29A 4J30B 2EIKC 3RIPA 3EGXB 1K9MM 2W4MA 3EPVA 2WZFA 2J7PA 3B9QA 2VB6A 1N8RP 2DYSC 2YEVA 4C7OB 3NRHA 2O9XA 4U5DE 2NUTA 2IXPA 1ZHZA 3CCEL 1YJ9O 1VQ6L 3DM5A 4U5GA 2WZGA 4CS8C 1VQLO 2EINC 3V7OA 1VQKL 2QA4L 1YJNO 2Q3TA 3EGXA 2D5RB 2LSEA 4E7SA 4MQ9F 4ZLDA 2NUPB 3CCSO 1D0ZA 1Q82P 3CD6L 3Q6NA 4IJJA 1W2WA 1ZYRF 2YZSA 4JJGA 4BJTA 4RD9A 3B0UX 2MYSA 4C7OA 1QVGK 3CPWN 3CC2O 2OTJO 3W8HA 5DQTA 1VQ4L 1BR4A 3W2VA 3CCUL 1VQ8L 4Q7CA 1YI2L 3ASNC 1YIJL 2H7BA 4C3DA 5F5FA 3LLIA 3LEVA 3NYMA 3NYJA 2NUPA 3CXCK 1RJ9B 5D92A 1JPJA 3S27A 3F46A 4OD4A 3DXJF 2HV6A 1FFTC 3DAGA 4JJFA 2WL8A 5IY5C 3CCRL 3FAJA 3I5PA 1J8YF 1NU9C 3NKDA 1SF8A 1YJWL 4DVZA 3ABKC 3JT1A 3ASOC 4G7ZF 2WB7A 1VQKO 3LLKA 3MLGA 5BUOA 5DQZA 3QZCA 2KQ9A 4YN0B 3SZRA 5EGYA 3CD6O 3EFOA 2PX3A 1RJ9A 2A6HF 4OINF 3FHDA 2Q9AA 1Q7YM 3Q7LA 3EQLF 1OCZC 4JVSA 4YT4A 1VYKA 3HJCA 1VQ4O 3WG7C 3CCUO 2KW3C 1Z23A 5CI8A 1PD0A 4WJ0A 3B0VC 2G3VA 3HLZA 3UGOA 1OCOC 3LS1A 4LACB 3RFYA 2R7VA 3N0TA 2H7VC 3W8IA 2EIMC 4BJ5C 4JW1A 2QEXL 2R7TA 1M90M 3AG3C 3E70C 3DZAA 1ZHYA 1NG1A 3CCJL 3CC7O 1M1KP 2ZXWC 3Q7GA 4OIQF 3VAYA 1MNEA 2Q9CA 3DJNB 3PMRA 2A69F 1LKXA 1QLEC 1K73P 4BEJA 3GANA 3EGDB 5B3SC 4PJNA 3OA1A 4CS7A 2C03A 3CMEL 5KYXB 3K66A 3L0IA 1ZU4A 3VYWA 2ZXPA 3K7DA 2IOQA 4DBQA 4PK4A 4PJMA 4BJ5A 1YHQO 3NDBB 1MMAA 2R7XA 1KU2A 3AG2C 4GEHA 3UMIA 1MMDA 1TWGA 1O5HA 3X1OA 1VQ7L 4B6IA 1D0YA 2M4EA 1D0XA 3G4SL 1MMNA 3EGDA 5DVWA 3RYLA 1PCXA 4G7HF 3CPWK 1Q82M 5KYXA 2CNWA 4KNVA 4FWVA 2IXMA 1FTSA 4JURI 1VQ5L 2R7SA 1D1AA 3EHMA 3LAYA 3LNRA 4W8KA 1KD1P 2QEXO 3EJNA 1VQ9L 1G8XA 3UMHA 3DD7A 4CBEA 3CCJO 3QMKA 2BE5F 4HFKB 2A68F 3SP1A 3CCQL 1Q86M 1K8AP 5DS5A 4C3BA 3I4UA 3NYLA 2OCCC 4O6MA 3ECSA 1OCCC 2XSEA 3SNHA 3OW2K 4AE4B 2WVOA 4K0DA 2R7UA 2MWQA 4JZAA 3CMEO 1BR1A 2IXOA 1V54C 3N24A 4H4KC 1VQML 2PP4A 4G0HA 4BG0A 1NZEA 1MMGA 1Z5ZA 4CIHA 3T6JA 3I55L 3CMAL 2IYLD 2J46A 3JCUQ 1KQSN 2G3KA 4ULWA 3FDQA 1TR2A 5L3VA 3TD7A 4U5CE 3EFOB 1W2BK 2JD3A 4PJLA 4C3EA 1VQ7O 3N2ZB 3G4SO 4AE4A 1PD1A 4ANJA 2EIJC 3OW2N 3O6XA 4M63A 1ZHWA 5KYUB 1VQ5O 2X51A 3CCEO 1VQ6O 3K33A 3I5QA 3H65A 1QVFN 1M56C 3CQZA 3Q6MA 3AQBA 4LLCA 5E2QA 4YT5A 1VQPL 2QA4O 3CCQO 1S72L 2B0JA 1OKKD 4QI2A 4OD5A 4O6YA 4RBNA 2R7QA 1W2BN 3MX3A 3KL4A 5B1BC 2R7RA 3X2QC 1VQMO 4GYTA 4XLNF 3CC4L 5KYUA 4HEAJ 3HTKC 3I55O 3DMDA 3B0PA 1VQ8O 3CCLL 3CMAO 4O79A 1YI2O 1M2OA 3CCML 4OIOF 1YIJO 2Y69C 3AG1C 3LS0A 4I44A 3PHF2 4YJWA 2H7OA 2J0WA 2WVNA 5L3QA 3DAFA 2Y3DA 4PJJA 3KH2A 2J9VA 3JYHA 1J8MF 3CCRO 5DS4A 4OIRF 4PFOA 2Y3HA 2L9JA 1YJWO 2V26A 3T6BA 2L81A 3UMKA 3G6EL 1OKKA 2J0XA 4CS9A 3GODA 3DM9B 4QDLA 1VQPO 1KC8P 3EH1A 2P6VA 4U5FE 1YJ9L 1S72O 2YHSA 1N8RM 1Q81P 2XXAB 3ZIBA 4P6IC 5KYWB 2W4BA 3K1HA 1QZXA 3CZ6A 1ZHTA 3G71L 3KKBA 1ST6A 2DYRC 3S28A 3CCVL 4KNWA 3CC4O 3WODF 2V3CC 3ITFA 2PF4E 3EH2A 1VYIA 3NKEA 2FGYA 4FX5A 4U5EE 2Y3BA 1D1BA 3ZSUA 5D91A 4CSAA 4IRUA 3CC2L 3CCLO 2NG1A 3EZIA 2EILC 2G62A 5KYNA 2XRHA 2W9YA 1VQNL 2KNHA 5F5HA 4DOZA 1NJIP 2XXAA 3DJUB 1S7ZA 2XL4A 5KYWA 2Y3GA 2CDQA 3EG9B 1ZU5A 3ABMC 1KQSK 1O87A 4EWCA 4YT2A 3IEEA 3NG1A 4U5BE 2IXNA 2GFHA 1TWHA 4AK9A 4F4BA 4OIPF 2Z15A 3G6EO 1TKNA 4I3MA 5E3AA 3UGPA 4QI0A 4DVYP 4PFPA 3K6BA 4BJ6C 2DGJA 1NU7D 2Q9BA 1Z6AA 2A1DD 1K9MP 1QVFK 4E7ZA 4X0RA 2R7WA 1SZIA 1SMYF 3K1IC 3EG9A 5E3CA 3I56L 3G71O 1V55C 4XWJA 2WVQA 3UR3C 5B1AC 3EZHA 3CCVO 3LESA 3EHNA 1BR2A 2ZXRA 2PX0A 4IAOA 2QY9A 4NY3A 2J9WA 4O6NA 4KBLA 4BJ6A 2OG2A 5KYYB 1Z3IX 4EBBA 4Q5SF 3ZVRA 1Q86P 2KGOA 4J32B 3SEOA 2OTLL 1VQNO 4CS8A 5HSWA 5T3WA 3CSKA 4Q4ZF 2P7VA 4FESA 3UNGC 1VQ9O 2R7OA 4A2NB 2E87A 2PFDA 5T1DB 4U5HA 3AQCA 2I8BA 1IW7F 5EHHA 3OEOA 4AX2A 3CC7L 3O39A 4HE8D 1VQOL 3KMIA 1JJ2K 3JRTA 4G7OF 5KYYA 3FVYA 1QVGN 1VOMA 2Y39A 1M1KM 2ZPAA 3ZG1A 4CS9C 4ZLCA 1YITL 1N1CA 3E9VA 3I56O 4MNDA 1K73M 1IZMA 1LS1A 3RH3A 5E33A 3POVA 4LLEA 5T3TA 4KC9A 3CXCN 1YHQL 3W2WA 3S0XA 1KC8M 1VK5A 4N06A 2CW0F 5DLJA 1Q81M 1Z63A 1M57C 3T4RA 2W45A 3LJBA 5CI9A 3ZC4A 1JJ2N 4O7GA 4XLPF 2OTLO 2J45A 1MNDA 4CSAC 1FMWA 1FFHA 2J7PD 3SYNA 1M2VB 2C04A 3RKOF 1Q7YP 4BJ1A 1D1CA 2FFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6I C;  4XTK A;  4W8K A;  3NKE A;  4N06 A;  4QDL A;  3NKD A;  4WJ0 A;  5DLJ A;  5FCL A;  5DS5 A;  5DS6 A;  5DQT A;  2YZS A;  3GOD A;  5DS4 A;  5DQZ A; 
#chains in the Genus database with same CATH topology
 4MS2 A;  1V74 B;  5COG A;  3ABL C;  2A6E F;  1KD1 M;  1FMV A;  4IWB A;  2EPK X;  3ZWI A;  1TWC A;  2J9U A;  1ORS C;  2QUP A;  1WAT A;  1M90 P;  3CCM O;  5JRA A;  3M1C B;  1ZHX A;  2XLO A;  1NSG B;  256B A;  3EGX B;  1K9M M;  3GWL A;  1DOW A;  4MVZ A;  3W4Y A;  2WZF A;  1E83 A;  2M64 A;  4J7Y A;  3M4B A;  1L7C A;  5COF A;  1ZHZ A;  1VQ6 L;  1APC A;  4U5G A;  2WZG A;  2QA4 L;  1YJN O;  2D5R B;  4CJO A;  2LFD A;  4E7S A;  2NUP B;  1QSP A;  4XEF A;  2YZS A;  4BJT A;  4IAQ A;  2HMZ A;  3A11 A;  3W8H A;  3FOO A;  4Q7C A;  3NYJ A;  3CXC K;  2EPL X;  5COM A;  4OD4 A;  3TOM A;  3FAJ A;  1E2X A;  3ASO C;  3QTH A;  4G7Z F;  2NPU A;  1VQK O;  1VTM P;  1ZW2 A;  3QZC A;  4YN0 B;  3DKA A;  2GA0 A;  5EGY A;  2PX3 A;  2HJM A;  1Q7Y M;  1GQA A;  3EQL F;  5JP7 A;  3IHU A;  1XZQ A;  4WJ0 A;  3WAQ A;  4NTB A;  3UGO A;  4J7T A;  3W8I A;  1KTM A;  4JW1 A;  3AG3 C;  3DZA A;  2ZXW C;  4E0I A;  3VAY A;  3PMR A;  1LKX A;  3EGD B;  5B3S C;  3OA1 A;  2C03 A;  5KYX B;  3K66 A;  3K7D A;  4WAB A;  4PK4 A;  3JZ0 A;  3U9J A;  3O55 A;  1LIH A;  1FNT c;  5L0H A;  4GEH A;  1JOG A;  1MMD A;  1O5H A;  1D0Y A;  2M4E A;  4XEV A;  3RYL A;  1Q82 M;  3CPW K;  2CNW A;  4FWV A;  3U2M A;  2YL7 A;  4JUR I;  2R7S A;  2B0H A;  3G4X A;  1D1A A;  2X0C A;  3NMK A;  1U6H A;  3RQG A;  2QEX O;  1G8X A;  2HSB A;  1YZC A;  5JS5 A;  1YVI A;  4C3B A;  1DOV A;  3SNH A;  2KC3 A;  4JZA A;  4H4K C;  5EK0 A;  1JR8 A;  3CMA L;  3JCU Q;  1KQS N;  3J06 A;  1U89 A;  3TD7 A;  2JD3 A;  4C3E A;  4A4A A;  1H9G A;  3G4S O;  4AE4 A;  1PD1 A;  1T01 A;  3OW2 N;  1LI5 A;  2LFF A;  4M63 A;  3S9O A;  2ASR A;  3CCE O;  2YWA A;  3Q6M A;  3K1I A;  1VQP L;  4K1O A;  4Z9H A;  1W2B N;  3MX3 A;  3TOL A;  1HY5 A;  3U3F A;  4XLN F;  3CC4 L;  3I55 O;  3DMD A;  3GM3 A;  4O79 A;  1YI2 O;  2XS8 A;  3CCM L;  4XPY A;  1G4U S;  3DAF A;  2Y3D A;  1Y6D A;  4D4X A;  3JYH A;  1NFO A;  1E86 A;  3TK0 A;  2L9J A;  3T6B A;  1OKK A;  5L0I A;  1S72 O;  2YHS A;  2XXA B;  3JTL O;  2W4B A;  3K1H A;  1QZX A;  3GWN A;  5A6K A;  2V3C C;  3ITF A;  2PF4 E;  2VCC A;  1VYI A;  3L8I A;  2FGY A;  1D1B A;  4CSA A;  4IRU A;  3EZI A;  2XRH A;  1I4Y A;  4CIP A;  2W9Y A;  1VQN L;  2KNH A;  1T6I A;  5KYW A;  4JEA A;  1O87 A;  4EWC A;  4YT2 A;  2P0N A;  4XEK A;  2IXN A;  2D4U A;  3LNM B;  4F4B A;  2Z15 A;  4I3M A;  3UGP A;  5E3A A;  4DVY P;  4BJ6 C;  2J9B A;  1T6Q A;  2A1D D;  4JRZ A;  3B71 A;  1K9M P;  1QVF K;  4X0R A;  4MW8 A;  2R7W A;  1SZI A;  3K1I C;  3EG9 A;  1T9K A;  3CCV O;  4G78 A;  1BR2 A;  4KBL A;  2IM8 A;  2LD6 A;  2YLI A;  2BL2 A;  4CS8 A;  5HSW A;  3CSK A;  4N6C A;  1VQ9 O;  1EKY A;  4MVO A;  4A2N B;  3V5Y A;  4WGY A;  3NMI A;  4U9D A;  4HE8 D;  3GEE A;  3JRT A;  2LQG A;  4G7O F;  2ZPA A;  1AEP A;  1YIT L;  4MND A;  3POV A;  4LLE A;  2AWC A;  3CXC N;  1VK5 A;  4NC3 A;  5JLI A;  1Q81 M;  1M57 C;  3T4R A;  2Q7R A;  3LJB A;  1JJ2 N;  4O7G A;  4CSA C;  2J7P D;  1Q7Y P;  4XTK A;  1VQL L;  1WOL A;  1OXK A;  1VQO O;  2WZL A;  4Z9J A;  3CCS L;  2YRF A;  1JPN A;  2QTV A;  2Q00 A;  2UUI A;  3OWT A;  3S90 A;  1OXB A;  2NSG A;  1YJG A;  1HMO A;  4JCH A;  2KJG A;  2NUT B;  4PR9 A;  1TWA A;  1M2V A;  3AGU A;  4YWQ A;  4K7B A;  4LER A;  1I4Z A;  4I1O B;  4I1M A;  3JSZ A;  2EIK C;  3RIP A;  3C62 A;  2W4M A;  4BPM A;  4EBK A;  2VB6 A;  2YEV A;  3IQ6 A;  2O9X A;  1C03 A;  1QQ3 A;  2IXP A;  4NQF A;  3CCE L;  4CS8 C;  2XLV A;  2Q3T A;  4JTC B;  1GGQ A;  3EGX A;  5B3I A;  2LSE A;  4MVM A;  4MQ9 F;  1Q82 P;  3H2U A;  1JRA A;  4IJJ A;  1Z7Q c;  4JJG A;  3B0U X;  2DI3 A;  1QVG K;  3CPW N;  3CC2 O;  2OTJ O;  2A0B A;  1VQ4 L;  3A9C A;  3CCU L;  1YI2 L;  3ASN C;  2H7B A;  3NYM A;  2NUP A;  2HS5 A;  1G5Z A;  3DWW A;  4CJG A;  4JJF A;  2WL8 A;  1J8Y F;  3HNJ A;  1TFK B;  4DVZ A;  2WB7 A;  3C18 A;  4DRI B;  5FZT A;  2PBE A;  3CD6 O;  1CGO A;  4OIN F;  1XZP A;  3Q7L A;  4DRH B;  1VB5 A;  3RQF A;  1OCZ C;  4H54 A;  1H9T A;  1OQC A;  4CDV A;  4JEB A;  2LK4 A;  3C8G D;  3JRM O;  4JTD B;  2R7V A;  4BJ5 C;  5AC5 A;  2R7T A;  1C17 M;  1ZHY A;  3CCJ L;  2HMQ A;  3CC7 O;  3Q7G A;  3HKK A;  3C8G B;  5F28 E;  1MNE A;  2Q9C A;  2TMV P;  1A7E A;  4CS7 A;  3L0I A;  1ZU4 A;  2ZXP A;  3RVY A;  1NLX A;  3NDB B;  1U0B B;  2EPN A;  3AG2 C;  3UMI A;  1QKR A;  1TWG A;  4YK5 A;  3X1O A;  1VQ7 L;  4B6I A;  1MMN A;  3EGD A;  5DVW A;  4UDV A;  4G7H F;  3SXK A;  5KYX A;  4KNV A;  2IXM A;  1VQ5 L;  3EHM A;  3LNR A;  4W8K A;  3EJN A;  1VQ9 L;  3U9M A;  4CBE A;  2OEV A;  3QMK A;  3C7J A;  3SP1 A;  1K8A P;  4LDR A;  1FAP B;  2GDC A;  3NYL A;  1CGM E;  1OCC C;  2WVO A;  4K0D A;  3CME O;  1S05 A;  2XL6 A;  2IXO A;  3IQC A;  1V54 C;  3RW0 A;  1F1M A;  3B29 A;  1Z5Z A;  3T6J A;  1KNY A;  2IYL D;  4W8P A;  2J46 A;  4GQH A;  3MBG A;  1TR2 A;  4JC7 A;  3N2Z B;  2RSE B;  2HJ3 A;  2YQY A;  2YL0 A;  3TJ5 A;  5KYU B;  3H65 A;  3V5X A;  1QVF N;  3CQZ A;  5E2Q A;  3AQB A;  3LEO A;  3CCQ O;  4JE9 A;  5GPG B;  4IB4 A;  3CEX A;  3HNL A;  3X2Q C;  1VQM O;  3IPM O;  3QW0 A;  3B0P A;  2IBF A;  3CCL L;  5K0I A;  4DRJ B;  2Y69 C;  4I44 A;  2J0W A;  5L3Q A;  2P61 A;  2LCH A;  2XL8 A;  2YLG A;  1FR0 A;  5DS4 A;  2Y3H A;  2J0X A;  4CS9 A;  4QDL A;  1Q81 P;  3ZIB A;  3KKB A;  1ST6 A;  1YDI A;  4KNW A;  3WOD F;  3NKE A;  4FX5 A;  4U5E E;  3CC2 L;  2XXA A;  3DJU B;  1BZ4 A;  2FAP B;  3ABM C;  1OW6 A;  4E18 A;  2CYD A;  2GFH A;  1LE2 A;  3G6E O;  2MHR A;  3KYI A;  5BQG A;  1VLT A;  2Q9B A;  3HNI A;  1YYX A;  4E7Z A;  1SMY F;  5E3C A;  3I56 L;  3G71 O;  3UR3 C;  3EZH A;  2QLA A;  1YA7 O;  3LES A;  4BJ6 A;  1E85 A;  4O6N A;  3V5Z A;  5KYY B;  4EBB A;  4Q5S F;  3ZVR A;  1Q86 P;  2KGO A;  4J32 B;  2OTL L;  4EUK B;  2P7V A;  1R4T A;  1TFO B;  5A6A A;  3AQC A;  5L0J A;  1IW7 F;  3CC7 L;  3O39 A;  3KMI A;  1YAR O;  1QVG N;  1A41 A;  2Y39 A;  5JVE A;  4CS9 C;  4MTF A;  4EHP A;  3RH3 A;  1H6G A;  5T3T A;  2OU6 A;  4WGZ A;  1RKE B;  1Z63 A;  1BDJ B;  5CI9 A;  3ZC4 A;  4XLP F;  2J45 A;  1JMW A;  1FFH A;  1HE9 A;  4N6H A;  1D1C A;  4YT8 A;  5FCL A;  1ORY A;  2CNW D;  1YJN L;  1CPQ A;  4MVS A;  3F47 A;  3LUT B;  2HV7 A;  1OCR C;  2VH3 A;  4HFF B;  1K8A M;  1B68 A;  3AG4 C;  2EPM X;  1ORJ A;  4KI2 A;  4RDA A;  3JSE O;  3T9O A;  4J30 B;  2AWY A;  3TQO A;  3QVY A;  4JCZ A;  3EPV A;  2J7P A;  3B9Q A;  3DE8 A;  4C7O B;  3NMJ A;  3NRH A;  4U5D E;  2NUT A;  5AC4 A;  1V4A A;  4YL0 A;  1EQ1 A;  3U0C A;  3DM5 A;  2EIN C;  1VQK L;  1RXQ A;  3QW1 A;  1XWJ A;  3MYF A;  3Q6N A;  4MTG A;  1W2W A;  1ZYR F;  1SR2 A;  2XM4 A;  2MYS A;  2YVK A;  3C8Z A;  1BR4 A;  1H7I A;  3LLI A;  3M4C A;  5A69 A;  2NSF A;  1RJ9 B;  5D92 A;  3S27 A;  4IAR A;  2HV6 A;  2OKU A;  3I5P A;  1JAF A;  1NU9 C;  1RMV A;  1SF8 A;  4BEM J;  3G50 A;  3RVZ A;  3TJ6 A;  5DQZ A;  2KQ9 A;  2KSF A;  4YL1 A;  1OR3 A;  3EFO A;  2A6H F;  2UUH A;  2L6F A;  3FHD A;  1GS9 A;  3IQ5 A;  3WG7 C;  2XLM A;  1PD0 A;  2G3V A;  1Q0M A;  1OCO C;  3N0T A;  2H7V C;  2EIM C;  2DB4 A;  3ZDL A;  2QEX L;  3E70 C;  1OW8 A;  4OIQ F;  2A69 F;  1K73 P;  3GAN A;  4PJN A;  4LDK A;  2HSQ A;  4U9E A;  3VYW A;  2IOQ A;  4DBQ A;  2CCY A;  4PJM A;  4BJ5 A;  1MMA A;  2R9R B;  3M79 A;  3C8G A;  2LP4 A;  1D0X A;  3FMS A;  3G4S L;  1PCX A;  1EI7 A;  1FTS A;  3UMH A;  2A68 F;  1Q86 M;  3TUL A;  3KPH A;  5L0F A;  3ECS A;  3OW2 K;  1HE1 A;  1BR1 A;  4MVQ A;  2PP4 A;  4G0H A;  4BG0 A;  2HFI A;  3I55 L;  3DE9 A;  1WN0 A;  3VRC A;  5L3V A;  3EFO B;  1W2B K;  1Q0F A;  2A0U A;  2AVK A;  3SXM A;  3I5Q A;  5JT4 A;  1M56 C;  4LLC A;  5A6B D;  4YT5 A;  1S72 L;  2YL1 A;  2RD9 A;  4RBN A;  1WWP A;  3O10 A;  5B1B C;  1AUE A;  2OOC A;  4GYT A;  3GEI A;  5KYU A;  3HTK C;  1VQ8 O;  3CMA O;  1M2O A;  1YIJ O;  3AG1 C;  3LS0 A;  3PHF 2;  1LE4 A;  2WVN A;  4PJJ A;  2J9V A;  1J8M F;  1Q0G A;  1R5I D;  3CCR O;  1A7D A;  3WHN A;  1YJW O;  2V26 A;  2L81 A;  3UMK A;  3GOD A;  3DM9 B;  1VQP O;  4JKV A;  4U5F E;  5AGF A;  4P6I C;  3L1M A;  3CZ6 A;  2R25 A;  1ZHT A;  2DYR C;  4MW3 A;  2HKV A;  3CCV L;  3CC4 O;  3EH2 A;  1LM3 B;  2Y3B A;  3ZSU A;  5D91 A;  2EIL C;  4FAP B;  4DOZ A;  3U3B A;  1S7Z A;  3MFN A;  4U5B E;  3NG1 A;  1C02 A;  2L6H A;  1ZVZ A;  5JUA A;  2P1A A;  1OR2 A;  2DGJ A;  1Z6A A;  3SXY A;  3PDM P;  4L6R A;  4DXW A;  2QE9 A;  1NFN A;  1V55 C;  3CAX A;  5B1A C;  4NCQ A;  3EHN A;  2ICW G;  3L8J A;  2PX0 A;  4IAO A;  2J9W A;  4ER9 A;  1Z3I X;  1VQN O;  1TQG A;  1LI7 A;  3VF0 A;  3AOU A;  4XQ1 A;  1HW2 A;  4Q4Z F;  1BBH A;  2R7O A;  2E87 A;  2PFD A;  2F22 A;  4XPX A;  2HZ8 A;  4U5H A;  2I8B A;  1VQO L;  1JJ2 K;  2GWW A;  5KYY A;  3RQE A;  2R05 A;  1UG7 A;  3IQT A;  5CIV A;  4ZLC A;  1LPE A;  1N1C A;  4EBJ A;  1A0B A;  1K73 M;  1IZM A;  1ZW3 A;  5E33 A;  2H8A A;  3W2W A;  3S0X A;  1KC8 M;  1LS4 A;  4N06 A;  2CW0 F;  5DLJ A;  3ATP A;  4D4N A;  1Q0D A;  1G4W R;  3ZTZ A;  2JPU A;  5BQH A;  3SYN A;  2C04 A;  2FFH A;  4E0H A;  2VAS A;  4ULV A;  5DS6 A;  1YAU O;  1I5N A;  2XLD A;  1LVK A;  1RKE A;  4DBR A;  1NJI M;  1VMA A;  3H2V A;  5TJ5 E;  3L34 A;  3AGT A;  1WGW A;  2PNO A;  3S84 A;  2ZXO A;  1K05 A;  2XLE A;  2VCA A;  1YIT O;  2OTJ L;  2CGE A;  2XM0 A;  1VLS A;  3S29 A;  2BC5 A;  2OEX A;  4NTF A;  2EPO A;  3M15 A;  1RCP A;  2LIG A;  1N8R P;  2DYS C;  5L0D A;  1YJ9 O;  2XS1 A;  1EA8 A;  3GM1 A;  1VQL O;  4PAC A;  3V7O A;  3U5S A;  3JYY A;  4AL1 A;  4ZLD A;  3CCS O;  1D0Z A;  4E17 A;  3CD6 L;  4MVU A;  3GM2 A;  4RD9 A;  2VCB A;  4C7O A;  3US6 A;  1Q0K A;  5DQT A;  2YLD A;  3W2V A;  1VQ8 L;  5HV9 A;  2OJQ A;  3SXZ A;  3U8P A;  1YIJ L;  2HUJ A;  4C3D A;  5F5F A;  3LEV A;  1L3P A;  1JPJ A;  2ZD9 A;  3F46 A;  3DXJ F;  3DAG A;  1FFT C;  1YYJ A;  5IY5 C;  3CCR L;  3R2P A;  3NKD A;  4CDA A;  1YJW L;  5L0G A;  1K40 A;  3ABK C;  3JT1 A;  1YZA A;  3LLK A;  3MLG A;  5BUO A;  3SZR A;  1RJ9 A;  2Q9A A;  1CPR A;  4JTA B;  4JVS A;  4YT4 A;  4IGG A;  3PCV A;  1VYK A;  3HJC A;  1VQ4 O;  3CCU O;  2KW3 C;  1Z23 A;  5CI8 A;  1MQV A;  3B0V C;  3HLZ A;  3LS1 A;  4LAC B;  3RFY A;  4CDY A;  1M90 M;  1NG1 A;  2J8W A;  1M1K P;  4CX9 A;  3DJN B;  2ETS A;  3U2L A;  1QLE C;  1CGN A;  4BEJ A;  1YLM A;  3CME L;  4XPW A;  1YHQ O;  2L7A A;  2R7X A;  1HW1 A;  1KU2 A;  3KYJ A;  3U8V A;  5JSL A;  4AL0 A;  4P9T A;  4N4W A;  3LAY A;  1KD1 P;  2R03 A;  3DD7 A;  1WAS A;  3CCJ O;  2BE5 F;  4HFK B;  3CCQ L;  5DS5 A;  3I4U A;  4O6M A;  2OCC C;  2Q4F A;  2XSE A;  4AE4 B;  1O3U A;  2R7U A;  2MWQ A;  1YA9 A;  3N24 A;  1VQM L;  4ONS A;  1SYQ A;  1AVO B;  4CIH A;  1NZE A;  1MMG A;  2G3K A;  2XLW A;  4ULW A;  3FDQ A;  1K04 A;  4U5C E;  4PJL A;  1VQ7 O;  4EKW A;  2OJE D;  3GOR A;  1WTY A;  4ANJ A;  3C63 A;  2EIJ C;  3DI5 A;  3O6X A;  1ZHW A;  1OW7 A;  1VQ5 O;  4P9F A;  2X51 A;  1VQ6 O;  3K33 A;  2JX0 A;  4MVR A;  2QA4 O;  4NTA A;  2B0J A;  1OKK D;  4QI2 A;  4OD5 A;  4O6Y A;  2R7Q A;  2YL3 A;  3KL4 A;  1T6U A;  2R7R A;  4HEA J;  4YL3 A;  4MTO A;  3HNK A;  4OIO F;  4YJW A;  2H7O A;  3KH2 A;  2KYH A;  3QVZ A;  2KK1 A;  2AU5 A;  5A6B A;  4OIR F;  4PFO A;  3G6E L;  1ZZP A;  4R32 A;  3T6G B;  1KC8 P;  3EH1 A;  2P6V A;  1YJ9 L;  1N8R M;  1PV3 A;  5KYW B;  3G71 L;  3S28 A;  2QNL A;  3CCL O;  1E84 A;  1GM5 A;  2NG1 A;  2G62 A;  5KYN A;  5F5H A;  1NJI P;  2L6G A;  2XL4 A;  2Y3G A;  2CDQ A;  3EG9 B;  1ZU5 A;  1KQS K;  3ZTM A;  5BQI A;  3IEE A;  1TWH A;  2VC9 A;  4AK9 A;  4OIP F;  2I15 A;  1TKN A;  4QI0 A;  5A6J A;  4PFP A;  3K6B A;  1NBB A;  1NU7 D;  4JIO A;  4EIY A;  3R7C A;  4XWJ A;  2WVQ A;  3ZQV A;  4Z9I A;  3VM6 A;  3GEH A;  4LDQ A;  2ZXR A;  2AP3 A;  5L0C A;  2QY9 A;  4NY3 A;  2OG2 A;  3SEO A;  2GAQ A;  2OQM A;  2XLH A;  5T3W A;  3FXH A;  4FES A;  3UNG C;  3AJM A;  5T1D B;  3MYI A;  5EHH A;  3OEO A;  4AX2 A;  3BEH A;  3FOP A;  3BRJ A;  3FVY A;  1VOM A;  1HMD A;  1M1K M;  3G4Z A;  3ZQY A;  3ZG1 A;  3RF3 A;  1QPU A;  1Y4C A;  2YKZ A;  3FAP B;  3E9V A;  3I56 O;  1A7V A;  1LS1 A;  1T5O A;  1RKC A;  4KC9 A;  1YHQ L;  2W45 A;  1UFB A;  2OTL O;  2R02 A;  1M6T A;  1MND A;  1QVX A;  1FMW A;  1M2V B;  3RKO F;  4BJ1 A;  4DJ9 A; 
#chains in the Genus database with same CATH homology
 4YT8 A;  4XTK A;  2VAS A;  1VQL L;  5FCL A;  5DS6 A;  2CNW D;  1YJN L;  1LVK A;  1VQO O;  4DBR A;  2WZL A;  1NJI M;  3F47 A;  1VMA A;  3CCS L;  3ABL C;  1JPN A;  2HV7 A;  2A6E F;  1KD1 M;  2QTV A;  1FMV A;  3L34 A;  3OWT A;  4IWB A;  1OCR C;  1WGW A;  2VH3 A;  4HFF B;  1TWC A;  1K8A M;  2J9U A;  2ZXO A;  3AG4 C;  4JCH A;  1YIT O;  2OTJ L;  4KI2 A;  2KJG A;  2CGE A;  2NUT B;  1M90 P;  1TWA A;  1M2V A;  4RDA A;  4YWQ A;  4K7B A;  3CCM O;  3M1C B;  4LER A;  4I1O B;  1ZHX A;  4I1M A;  3JSZ A;  3S29 A;  4J30 B;  2EIK C;  3RIP A;  3EGX B;  1K9M M;  2W4M A;  3EPV A;  2WZF A;  2J7P A;  3B9Q A;  2VB6 A;  1N8R P;  2DYS C;  2YEV A;  4C7O B;  3NRH A;  2O9X A;  4U5D E;  2NUT A;  2IXP A;  1ZHZ A;  3CCE L;  1YJ9 O;  1VQ6 L;  3DM5 A;  4U5G A;  2WZG A;  4CS8 C;  1VQL O;  2EIN C;  3V7O A;  1VQK L;  2QA4 L;  1YJN O;  2Q3T A;  3EGX A;  2D5R B;  2LSE A;  4E7S A;  4MQ9 F;  4ZLD A;  2NUP B;  3CCS O;  1D0Z A;  1Q82 P;  3CD6 L;  3Q6N A;  4IJJ A;  1W2W A;  1ZYR F;  2YZS A;  4JJG A;  4BJT A;  4RD9 A;  3B0U X;  2MYS A;  4C7O A;  1QVG K;  3CPW N;  3CC2 O;  2OTJ O;  3W8H A;  5DQT A;  1VQ4 L;  1BR4 A;  3W2V A;  3CCU L;  1VQ8 L;  4Q7C A;  1YI2 L;  3ASN C;  1YIJ L;  2H7B A;  4C3D A;  5F5F A;  3LLI A;  3LEV A;  3NYM A;  3NYJ A;  2NUP A;  3CXC K;  1RJ9 B;  5D92 A;  1JPJ A;  3S27 A;  3F46 A;  4OD4 A;  3DXJ F;  2HV6 A;  1FFT C;  3DAG A;  4JJF A;  2WL8 A;  5IY5 C;  3CCR L;  3FAJ A;  3I5P A;  1J8Y F;  1NU9 C;  3NKD A;  1SF8 A;  1YJW L;  4DVZ A;  3ABK C;  3JT1 A;  3ASO C;  4G7Z F;  2WB7 A;  1VQK O;  3LLK A;  3MLG A;  5BUO A;  5DQZ A;  3QZC A;  2KQ9 A;  4YN0 B;  3SZR A;  5EGY A;  3CD6 O;  3EFO A;  2PX3 A;  1RJ9 A;  2A6H F;  4OIN F;  3FHD A;  2Q9A A;  1Q7Y M;  3Q7L A;  3EQL F;  1OCZ C;  4JVS A;  4YT4 A;  1VYK A;  3HJC A;  1VQ4 O;  3WG7 C;  3CCU O;  2KW3 C;  1Z23 A;  5CI8 A;  1PD0 A;  4WJ0 A;  3B0V C;  2G3V A;  3HLZ A;  3UGO A;  1OCO C;  3LS1 A;  4LAC B;  3RFY A;  2R7V A;  3N0T A;  2H7V C;  3W8I A;  2EIM C;  4BJ5 C;  4JW1 A;  2QEX L;  2R7T A;  1M90 M;  3AG3 C;  3E70 C;  3DZA A;  1ZHY A;  1NG1 A;  3CCJ L;  3CC7 O;  1M1K P;  2ZXW C;  3Q7G A;  4OIQ F;  3VAY A;  1MNE A;  2Q9C A;  3DJN B;  3PMR A;  2A69 F;  1LKX A;  1QLE C;  1K73 P;  4BEJ A;  3GAN A;  3EGD B;  5B3S C;  4PJN A;  3OA1 A;  4CS7 A;  2C03 A;  3CME L;  5KYX B;  3K66 A;  3L0I A;  1ZU4 A;  3VYW A;  2ZXP A;  3K7D A;  2IOQ A;  4DBQ A;  4PK4 A;  4PJM A;  4BJ5 A;  1YHQ O;  3NDB B;  1MMA A;  2R7X A;  1KU2 A;  3AG2 C;  4GEH A;  3UMI A;  1MMD A;  1TWG A;  1O5H A;  3X1O A;  1VQ7 L;  4B6I A;  1D0Y A;  2M4E A;  1D0X A;  3G4S L;  1MMN A;  3EGD A;  5DVW A;  3RYL A;  1PCX A;  4G7H F;  3CPW K;  1Q82 M;  5KYX A;  2CNW A;  4KNV A;  4FWV A;  2IXM A;  1FTS A;  4JUR I;  1VQ5 L;  2R7S A;  1D1A A;  3EHM A;  3LAY A;  3LNR A;  4W8K A;  1KD1 P;  2QEX O;  3EJN A;  1VQ9 L;  1G8X A;  3UMH A;  3DD7 A;  4CBE A;  3CCJ O;  3QMK A;  2BE5 F;  4HFK B;  2A68 F;  3SP1 A;  3CCQ L;  1Q86 M;  1K8A P;  5DS5 A;  4C3B A;  3I4U A;  3NYL A;  2OCC C;  4O6M A;  3ECS A;  1OCC C;  2XSE A;  3SNH A;  3OW2 K;  4AE4 B;  2WVO A;  4K0D A;  2R7U A;  2MWQ A;  4JZA A;  3CME O;  1BR1 A;  2IXO A;  1V54 C;  3N24 A;  4H4K C;  1VQM L;  2PP4 A;  4G0H A;  4BG0 A;  1NZE A;  1MMG A;  1Z5Z A;  4CIH A;  3T6J A;  3I55 L;  3CMA L;  2IYL D;  2J46 A;  3JCU Q;  1KQS N;  2G3K A;  4ULW A;  3FDQ A;  1TR2 A;  5L3V A;  3TD7 A;  4U5C E;  3EFO B;  1W2B K;  2JD3 A;  4PJL A;  4C3E A;  1VQ7 O;  3N2Z B;  3G4S O;  4AE4 A;  1PD1 A;  4ANJ A;  2EIJ C;  3OW2 N;  3O6X A;  4M63 A;  1ZHW A;  5KYU B;  1VQ5 O;  2X51 A;  3CCE O;  1VQ6 O;  3K33 A;  3I5Q A;  3H65 A;  1QVF N;  1M56 C;  3CQZ A;  3Q6M A;  3AQB A;  4LLC A;  5E2Q A;  4YT5 A;  1VQP L;  2QA4 O;  3CCQ O;  1S72 L;  2B0J A;  1OKK D;  4QI2 A;  4OD5 A;  4O6Y A;  4RBN A;  2R7Q A;  1W2B N;  3MX3 A;  3KL4 A;  5B1B C;  2R7R A;  3X2Q C;  1VQM O;  4GYT A;  4XLN F;  3CC4 L;  5KYU A;  4HEA J;  3HTK C;  3I55 O;  3DMD A;  3B0P A;  1VQ8 O;  3CCL L;  3CMA O;  4O79 A;  1YI2 O;  1M2O A;  3CCM L;  4OIO F;  1YIJ O;  2Y69 C;  3AG1 C;  3LS0 A;  4I44 A;  3PHF 2;  4YJW A;  2H7O A;  2J0W A;  2WVN A;  5L3Q A;  3DAF A;  2Y3D A;  4PJJ A;  3KH2 A;  2J9V A;  3JYH A;  1J8M F;  3CCR O;  5DS4 A;  4OIR F;  4PFO A;  2Y3H A;  2L9J A;  1YJW O;  2V26 A;  3T6B A;  2L81 A;  3UMK A;  3G6E L;  1OKK A;  2J0X A;  4CS9 A;  3GOD A;  3DM9 B;  4QDL A;  1VQP O;  1KC8 P;  3EH1 A;  2P6V A;  4U5F E;  1YJ9 L;  1S72 O;  2YHS A;  1N8R M;  1Q81 P;  2XXA B;  3ZIB A;  4P6I C;  5KYW B;  2W4B A;  3K1H A;  1QZX A;  3CZ6 A;  1ZHT A;  3G71 L;  3KKB A;  1ST6 A;  2DYR C;  3S28 A;  3CCV L;  4KNW A;  3CC4 O;  3WOD F;  2V3C C;  3ITF A;  2PF4 E;  3EH2 A;  1VYI A;  3NKE A;  2FGY A;  4FX5 A;  4U5E E;  2Y3B A;  1D1B A;  3ZSU A;  5D91 A;  4CSA A;  4IRU A;  3CC2 L;  3CCL O;  2NG1 A;  3EZI A;  2EIL C;  2G62 A;  5KYN A;  2XRH A;  2W9Y A;  1VQN L;  2KNH A;  5F5H A;  4DOZ A;  1NJI P;  2XXA A;  3DJU B;  1S7Z A;  2XL4 A;  5KYW A;  2Y3G A;  2CDQ A;  3EG9 B;  1ZU5 A;  3ABM C;  1KQS K;  1O87 A;  4EWC A;  4YT2 A;  3IEE A;  3NG1 A;  4U5B E;  2IXN A;  2GFH A;  1TWH A;  4AK9 A;  4F4B A;  4OIP F;  2Z15 A;  3G6E O;  1TKN A;  4I3M A;  5E3A A;  3UGP A;  4QI0 A;  4DVY P;  4PFP A;  3K6B A;  4BJ6 C;  2DGJ A;  1NU7 D;  2Q9B A;  1Z6A A;  2A1D D;  1K9M P;  1QVF K;  4E7Z A;  4X0R A;  2R7W A;  1SZI A;  1SMY F;  3K1I C;  3EG9 A;  5E3C A;  3I56 L;  3G71 O;  1V55 C;  4XWJ A;  2WVQ A;  3UR3 C;  5B1A C;  3EZH A;  3CCV O;  3LES A;  3EHN A;  1BR2 A;  2ZXR A;  2PX0 A;  4IAO A;  2QY9 A;  4NY3 A;  2J9W A;  4O6N A;  4KBL A;  4BJ6 A;  2OG2 A;  5KYY B;  1Z3I X;  4EBB A;  4Q5S F;  3ZVR A;  1Q86 P;  2KGO A;  4J32 B;  3SEO A;  2OTL L;  1VQN O;  4CS8 A;  5HSW A;  5T3W A;  3CSK A;  4Q4Z F;  2P7V A;  4FES A;  3UNG C;  1VQ9 O;  2R7O A;  4A2N B;  2E87 A;  2PFD A;  5T1D B;  4U5H A;  3AQC A;  2I8B A;  1IW7 F;  5EHH A;  3OEO A;  4AX2 A;  3CC7 L;  3O39 A;  4HE8 D;  1VQO L;  3KMI A;  1JJ2 K;  3JRT A;  4G7O F;  5KYY A;  3FVY A;  1QVG N;  1VOM A;  2Y39 A;  1M1K M;  2ZPA A;  3ZG1 A;  4CS9 C;  4ZLC A;  1YIT L;  1N1C A;  3E9V A;  3I56 O;  4MND A;  1K73 M;  1IZM A;  1LS1 A;  3RH3 A;  5E33 A;  3POV A;  4LLE A;  5T3T A;  4KC9 A;  3CXC N;  1YHQ L;  3W2W A;  3S0X A;  1KC8 M;  1VK5 A;  4N06 A;  2CW0 F;  5DLJ A;  1Q81 M;  1Z63 A;  1M57 C;  3T4R A;  2W45 A;  3LJB A;  5CI9 A;  3ZC4 A;  1JJ2 N;  4O7G A;  4XLP F;  2OTL O;  2J45 A;  1MND A;  4CSA C;  1FMW A;  1FFH A;  2J7P D;  3SYN A;  1M2V B;  2C04 A;  3RKO F;  1Q7Y P;  4BJ1 A;  1D1C A;  2FFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...