3GODA

Structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
DISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cas1
publication title Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Immune system
total genus 115
structure length 320
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01867 Cas_Cas1 CRISPR associated protein Cas1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3godA02
3.100.10.20 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3godA01
4P6IC 5DLJA 2YZSA 3GODA 4WJ0A 5DQTA 5DS4A 3NKDA 5FCLA 4W8KA 5DS6A 4XTKA 4N06A 3NKEA 5DS5A 5DQZA 4QDLA
chains in the Genus database with same CATH superfamily
3N2ZB 4JEBA 2EILC 1TR2A 1VQ6L 1R5ID 5E3CA 3EH1A 2GDCA 4LLEA 4HFKB 3RVYA 3U3FA 1Q7YP 4AX2A 5DQZA 3DKAA 4Z9HA 4NTFA 3KYIA 3CSKA 3IEEA 2A68F 3ZIBA 2HS5A 1C17M 3DM5A 2WVNA 1WTYA 3JSEO 1H6GA 1D0YA 3L8IA 3POVA 1VQ7L 1LPEA 3OWTA 1EI7A 2QTVA 4J7TA 2AWYA 3G4SL 3CCEO 3QVYA 1ZZPA 3E70C 2QY9A 4PR9A 4C7OB 1NU9C 1VQOL 4Q4ZF 4NY3A 2ASRA 3ITFA 2AP3A 3EG9B 1OQCA 1VLSA 3M79A 3CCVL 2HSBA 2R7UA 3KYJA 3FDQA 1M6TA 3JRMO 1ZHXA 2MWQA 1NSGB 3HNJA 1YYJA 2W9YA 3ZTMA 2V26A 1GM5A 3WHNA 1FR0A 4CDYA 1TWAA 2NSFA 4YWQA 2UUHA 3UR3C 2W4MA 5GPGB 1AEPA 3SXMA 4MTFA 1VQNO 3HKKA 1VLTA 4EWCA 4G7HF 1KU2A 1RJ9A 2XS8A 1Z23A 2CNWD 3QW1A 2IOQA 2XLEA 3JCUQ 5KYWA 3MX3A 3R7CA 2IXPA 1PD0A 3DE8A 5JVEA 1APCA 2L81A 2KGOA 1VYKA 2KSFA 4JTCB 2A0UA 5L0GA 5CI8A 1EKYA 1YAUO 5E3AA 2G3KA 3RW0A 3V5XA 2R25A 4CBEA 1D1AA 2OTLO 2D5RB 2H7VC 5TJ5E 3EPVA 1Q0MA 1K40A 1VQLO 1S72L 1VQ5O 4YJWA 1NFOA 3C7JA 1VQ4L 3SZRA 4H4KC 3N0TA 5B3SC 4JEAA 2QNLA 4KNWA 1M90P 4OINF 3S90A 2LP4A 2KJGA 3FHDA 3GWLA 2GA0A 1ZW2A 3MBGA 4YT5A 3I4UA 1HE1A 3CC7O 4DBRA 3V5YA 3LS1A 2Q3TA 3CEXA 4OIRF 1Z6AA 4PJMA 4NCQA 3K33A 3M4BA 3A9CA 3ABLC 3T6JA 1HMOA 2PFDA 2EIMC 1LKXA 5JT4A 2J46A 4BG0A 1WN0A 4CDVA 4WGYA 1EA8A 2BL2A 5JUAA 3EGDA 1YZAA 1ORSC 4P9FA 1W2BK 1A41A 4O6YA 3B0PA 2L6FA 4DOZA 1K73M 2KC3A 1M57C 3X1OA 1D0XA 3DJNB 1T6UA 3JZ0A 2PNOA 2Z15A 2J9WA 4U5FE 3GORA 2YEVA 4NQFA 5COMA 3CMEO 1L7CA 1G5ZA 4DRJB 2XSEA 4CJGA 2OKUA 1M1KP 2XLDA 4N6CA 1VQ6O 1LIHA 1C02A 5L3QA 4AE4A 5T3WA 3M4CA 3FAPB 1KTMA 1DOWA 2HUJA 1KD1M 4WGZA 1SR2A 4LACB 4PFOA 3AJMA 5B1BC 2J9BA 4IAOA 1HMDA 5F5FA 2P1AA 3V7OA 5A6BA 5JLIA 3RIPA 1DOVA 1ZU4A 5L0HA 3U9MA 3LNRA 1OKKD 2IXOA 3RVZA 3BRJA 1VQ7O 2C03A 2FAPB 1K9MM 3AGUA 2CW0F 5FCLA 3PCVA 3AG3C 1VQOO 4IJJA 2KNHA 4JIOA 3CCLL 4CSAC 3DWWA 4GEHA 2PF4E 2XM0A 3FOPA 3CCVO 1SZIA 1YA7O 2XLHA 1ST6A 3EGXB 1XWJA 2YL0A 2KK1A 5L0FA 1K8AP 1YJ9L 4P9TA 2Y69C 3JYHA 2XXAB 3VYWA 2L7AA 4C7OA 2HMZA 1QQ3A 4W8KA 2YQYA 5B1AC 1LI5A 4CJOA 1YLMA 4YN0B 4YL0A 3EG9A 2VASA 1VB5A 2M4EA 1UFBA 4H54A 3CXCK 3ZDLA 4MVUA 2P0NA 2QLAA 4EBBA 2P61A 1CGNA 1VYIA 2ZXPA 5BUOA 1VQKL 4G7OF 3UNGC 4MW3A 4JTDB 2OU6A 3NKDA 5KYYB 3QMKA 1HY5A 4U9DA 1JPJA 5L0IA 2OQMA 4LLCA 2IBFA 1G8XA 1OCCC 1A7EA 1M2VB 4YK5A 3DZAA 3VM6A 2L9JA 4MTOA 2KYHA 4U5GA 3AG4C 3NYLA 5COFA 1ZHWA 3EHNA 4PACA 3EZIA 3FMSA 1QVFN 2JPUA 1W2WA 1S72O 3IPMO 3TK0A 1Z7Qc 4FAPB 3I55L 3SYNA 2Q00A 1U89A 3IQCA 1VQ4O 4Z9IA 2XLOA 3CCRL 3HNLA 3ZSUA 1Q0KA 5EK0A 4CIPA 2OJQA 2NUTB 1YIJL 1VQ9L 3E9VA 4MS2A 3O6XA 1SYQA 1BBHA 3LLKA 2GAQA 2EPMX 5DQTA 2EPLX 1ZVZA 4XEKA 1BDJB 4AL0A 4QDLA 3W2WA 4BPMA 2I15A 3SXZA 4LERA 5JRAA 4E18A 4DRHB 1VQML 3EQLF 3SXKA 2YKZA 1SF8A 1NJIM 1Q82M 1MMNA 1T01A 3GEIA 4JVSA 5DLJA 4R32A 3CCQL 4GYTA 2DYRC 1RKEA 2RSEB 1QPUA 2A69F 1V54C 2GWWA 3DAGA 4JTAB 2WZGA 2XLWA 4ANJA 3ZC4A 1U6HA 2XL8A 3CQZA 3FVYA 1M56C 1BZ4A 4P6IC 3CC2L 5KYXB 2J0WA 4D4NA 1RCPA 1Q7YM 3T6BA 4JURI 1FFTC 3VRCA 2GFHA 2HV7A 2DYSC 1LS4A 3NMJA 2EINC 2JX0A 3T9OA 3U8PA 4XLPF 1VQ8L 4XTKA 3OW2K 4N6HA 1MMGA 3IQTA 4K7BA 3QTHA 1BR2A 3ECSA 3RKOF 4ZLCA 2HJMA 2YL3A 1Q86P 5EHHA 1FMVA 2ICWG 3EFOA 3OEOA 5L0DA 3ZQVA 4B6IA 1YI2L 4YL3A 3SNHA 5F28E 1E2XA 2R9RB 3F46A 3CD6L 2IXMA 2D4UA 3C8GA 4FWVA 3CMAL 1Q0GA 2O9XA 3AG1C 4MQ9F 3CCLO 1R4TA 2R05A 1YITL 5D92A 2QA4L 2A0BA 1OR2A 3W8IA 4XPYA 1MMDA 2H8AA 2J7PD 1S7ZA 1FFHA 1YJ9O 4BJTA 2AWCA 3SEOA 4L6RA 5A6JA 3B0VC 5JP7A 4Q5SF 1U0BB 1GGQA 2Y3DA 1O3UA 1OR3A 4JC7A 4IB4A 4NC3A 1S05A 1HW1A 1VOMA 5A6AA 2J9VA 3UMIA 1YARO 4EUKB 3RQGA 5L0JA 3EGXA 3B0UX 2L6HA 1K05A 3LESA 4IARA 1VQKO 4JRZA 3UMKA 3GANA 3FAJA 2XXAA 1OW8A 3Q7LA 3X2QC 3LEOA 3RQEA 3JT1A 2F22A 2L6GA 4UDVA 2CGEA 3HLZA 4DVYP 2XL4A 1OXBA 4LDQA 3T4RA 4EKWA 4E7SA 4EIYA 1K04A 5AC5A 4BJ6C 3HNIA 4C3DA 1T9KA 1MNDA 5KYYA 3W2VA 2YZSA 2BC5A 3AG2C 4G78A 3I55O 3US6A 4M63A 1KC8M 3JSZA 3CCRO 3DMDA 1M2VA 1G4US 2H7OA 2P7VA 3CCSL 3TOMA 1FAPB 3AGTA 1YIJO 1VQ9O 2UUIA 2PX3A 2I8BA 3CCUO 3L34A 4YT4A 2R7QA 2EPKX 4CX9A 3AOUA 3C18A 4BJ6A 3SXYA 2XRHA 2QE9A 2YHSA 4O79A 1JJ2K 3DXJF 1IZMA 1VQMO 2NUTA 5B3IA 2FGYA 1RKCA 2CNWA 1I4ZA 3BEHA 2EPNA 1GS9A 3CCQO 1KD1P 2P6VA 3G71L 1ZHZA 3S9OA 1TWCA 3Q7GA 5KYNA 1JMWA 1L3PA 1D0ZA 2E87A 2LCHA 2XLMA 2Y3BA 2NPUA 1HW2A 1OW7A 4LDKA 3HTKC 3ABKC 3C63A 5A69A 3CC2O 1PV3A 1KNYA 2ETSA 4NTAA 5IY5C 2RD9A 3O55A 3M15A 4YL1A 1LS1A 1RXQA 1K9MP 4A4AA 1AUEA 1A7DA 1W2BN 1H7IA 3J06A 3G4SO 2VCAA 3IQ5A 5L3VA 2YLDA 4ONSA 3TD7A 1VQ8O 1G4WR 2Y3GA 4JCZA 3G50A 3LS0A 3V5ZA 2KQ9A 5HSWA 5FZTA 3RQFA 3CC4L 2OG2A 5KYXA 2J45A 5BQHA 3LLIA 3GEHA 1D1CA 3CPWK 1T5OA 5F5HA 4XWJA 3ZG1A 1D1BA 3S29A 2R7RA 3IHUA 5BQIA 2YWAA 3Q6NA 1I4YA 1YI2O 2WL8A 1YA9A 2MHRA 1N8RM 3CD6O 2ZXOA 1TWGA 3CMAO 3K1IC 2VC9A 2WVQA 3MYFA 4CSAA 1LE2A 2IXNA 1ZHTA 1YITO 3C62A 1WATA 2QA4O 1KQSK 2IM8A 2OOCA 2Q9CA 3M1CB 3W8HA 1QVGK 2PX0A 4JKVA 1BR1A 2ZXWC 1Q81M 3DJUB 2R7SA 1VMAA 2HMQA 3K1IA 1LE4A 2V3CC 3HJCA 4E17A 4JJGA 3CC7L 3RH3A 3B29A 3Q6MA 3CCML 1XZPA 4ULWA 1OCZC 3U8VA 1VTMP 3GM2A 4ULVA 4MTGA 1V74B 3U3BA 2J9UA 2W4BA 4HEAJ 1MMAA 1O87A 3NKEA 4XQ1A 3NMKA 4O7GA 4HE8D 3CXCN 3VAYA 2TMVP 1OKKA 3TJ6A 2NUPB 3WAQA 1A0BA 4CIHA 3UMHA 4YT8A 1JOGA 1WOLA 1FTSA 3RF3A 3L1MA 1NJIP 2LSEA 1Q82P 3O39A 1WASA 4DBQA 1YJNL 4PJNA 4RBNA 3ATPA 1FMWA 4W8PA 3DD7A 3PHF2 2Q4FA 4Z9JA 4ER9A 3CCSO 4I1MA 3U9JA 4E0HA 3L8JA 3B71A 5AGFA 2W45A 3G4ZA 4IWBA 1EQ1A 4CDAA 4CS7A 4GQHA 2LD6A 3S28A 4E7ZA 3QVZA 3CCJL 1LM3B 3TOLA 1E84A 4J32B 3KPHA 1AVOB 1Y4CA 1OCRC 2VB6A 3TJ5A 2MYSA 2XLVA 1LVKA 4E0IA 3CZ6A 2VH3A 2A1DD 3DAFA 3G4XA 4QI0A 2QEXL 1C03A 1NBBA 2A6EF 3N24A 3G71O 1YHQL 1QSPA 2R02A 4RD9A 5KYUB 2Q9BA 4N4WA 2HSQA 5JSLA 5T3TA 1H9GA 4D4XA 2AU5A 4X0RA 3ZVRA 2EPOA 3KL4A 2YLIA 1GQAA 1VK5A 1VQPL 2R7TA 1Z3IX 3T6GB 2ZD9A 3PMRA 1UG7A 1JAFA 3I56L 4I1OB 4BJ1A 1A7VA 3QW0A 3VF0A 1TWHA 4KI2A 3H2UA 4JJFA 4RDAA 4QI2A 3UGOA 2Q9AA 1Q86M 2Y39A 2G3VA 2A6HF 3GM1A 3GEEA 4KBLA 4U5EE 3MYIA 3IQ6A 1NLXA 5D91A 3CC4O 1WWPA 1E86A 2EIJC 3EH2A 2XM4A 3U2LA 2ZXRA 4JW1A 2LK4A 3JTLO 1F1MA 3S27A 4J30B 3I5PA 4K0DA 3NYJA 3OW2N 3MLGA 1NFNA 1ORYA 5A6BD 1SMYF 3GODA 1NG1A 2YRFA 4EHPA 1JR8A 3NG1A 4DRIB 2XS1A 2J8WA 3PDMP 3ZTZA 3F47A 1RMVA 4C3BA 3R2PA 3WG7C 3LNMB 2NG1A 1YJWL 5T1DB 3G6EL 1NZEA 3KMIA 3LAYA 3ZWIA 4WABA 1OW6A 2DGJA 1N1CA 4XPXA 4MNDA 2OTJL 1YJGA 4BJ5C 2WZFA 3NMIA 4PJLA 2PBEA 5EGYA 2HZ8A 1PCXA 3U2MA 1M90M 1J8MF 4MW8A 4EBKA 1LI7A 3U0CA 1OCOC 3B9QA 2X0CA 1RKEB 2H7BA 3SP1A 1TFKB 1KC8P 4EBJA 3RFYA 1CPQA 5E2QA 3CCMO 1T6IA 2VCCA 2Q7RA 1V4AA 2R03A 2HJ3A 3LUTB 1QZXA 1K73P 5BQGA 1TFOB 1Z63A 1ORJA 2YL7A 4MVMA 4BJ5A 4C3EA 4IAQA 3LEVA 4OD5A 5COGA 2NSGA 1ZU5A 4MVZA 4XEVA 1M2OA 4DVZA 4K1OA 1IW7F 4G7ZF 2QUPA 3JYYA 2Y3HA 4J7YA 1MNEA 256BA 4A2NB 2OJED 2JD3A 2EIKC 1YJNO 1H9TA 1YZCA 4LDRA 2OEXA 1MQVA 4FX5A 4IRUA 4WJ0A 3KKBA 1B68A 1TQGA 2HFIA 3EHMA 4XPWA 5HV9A 3C8ZA 1Z5ZA 2WVOA 2NUPA 4HFFB 3CCEL 2B0JA 4Q7CA 1M1KM 2J7PA 3EFOB 4G0HA 4JZAA 4JCHA 1I5NA 1QVXA 4U5BE 4XLNF 1OXKA 3FXHA 4O6MA 1FNTc 1BR4A 3H2VA 3TULA 3CCJO 3K6BA 3C8GB 2AVKA 1JRAA 1YDIA 1TKNA 1RJ9B 1XZQA 4O6NA 5JS5A 3HNKA 2R7XA 5KYWB 4IGGA 2WZLA 2QEXO 3OA1A 3JRTA 4DJ9A 3K1HA 3ASNC 3CAXA 1YHQO 3DE9A 1E83A 3K66A 4N06A 1VQNL 3KH2A 1QLEC 2KW3C 5K0IA 4NTBA 4FESA 3QZCA 4CS8C 4F4BA 5A6KA 3RYLA 1JJ2N 1VQPO 2LFDA 3DI5A 3S0XA 3UGPA 1WGWA 2ZPAA 4U5HA 3AQBA 2R7VA 4JE9A 3I56O 1N8RP 1QVFK 4DXWA 2R7WA 1ZYRF 1Y6DA 4U5CE 4ZLDA 3GM3A 5KYUA 1V55C 4I3MA 4OIPF 5CIVA 2DB4A 5DVWA 1JPNA 1K8AM 3ZQYA 2PP4A 5DS5A 2CYDA 2CCYA 1ZW3A 4MVRA 4OIOF 1YYXA 3I5QA 5L0CA 4CS9C 1O5HA 2OEVA 3L0IA 4AK9A 3EJNA 1HE9A 4CS8A 2OTLL 4AL1A 2YL1A 4U9EA 1VQLL 1VQ5L 2WB7A 4I44A 1Q81P 5AC4A 5CI9A 4PK4A 4KC9A 4U5DE 4OIQF 4PFPA 3LJBA 4MVQA 1NU7D 4BEJA 1CPRA 2HKVA 3A11A 1J8YF 3GWNA 4CS9A 3S84A 3EGDB 3EZHA 2LFFA 2C04A 2YVKA 3DM9B 3NYMA 3CPWN 1E85A 4YT2A 3WODF 2R7OA 4KNVA 4MVOA 3AQCA 4PJJA 4XEFA 1YJWO 1YVIA 3G6EO 3C8GD 2FFHA 2HV6A 2XL6A 4OD4A 1ZHYA 2X51A 3K7DA 1QKRA 2OTJO 1T6QA 1CGME 2CDQA 3NDBB 3O10A 2J0XA 5DS4A 1Q0FA 3W4YA 2YLGA 2G62A 3ASOC 2OCCC 2BE5F 4MVSA 2M64A 5E33A 3TQOA 3CCUL 2IYLD 1Q0DA 3ABMC 4AE4B 5DS6A 2LIGA 4BEMJ 1KQSN 1PD1A 2LQGA 3NRHA 3U5SA 2DI3A 3H65A 1QVGN 2B0HA 1CGOA 3MFNA 2VCBA 3CMEL 3FOOA
chains in the Genus database with same CATH topology
3N2ZB 5B1AC 2R7QA 4BJ6A 2EILC 1TR2A 4YN0B 3S27A 3EG9A 1VQ6L 2XRHA 4J30B 3I5PA 2VASA 2M4EA 3CXCK 5E3CA 4K0DA 3NYJA 3EH1A 2YHSA 4O79A 3OW2N 4LLEA 4HFKB 3MLGA 1JJ2K 3DXJF 4EBBA 1IZMA 1VYIA 2ZXPA 5BUOA 1VQMO 1SMYF 1Q7YP 1VQKL 3GODA 1NG1A 2NUTA 4AX2A 5DQZA 2FGYA 4G7OF 3UNGC 3CSKA 2CNWA 3IEEA 3CCQO 2A68F 1KD1P 3ZIBA 3NKDA 2P6VA 5KYYB 3G71L 3QMKA 3NG1A 1ZHZA 1JPJA 1TWCA 3DM5A 3Q7GA 3F47A 4LLCA 2WVNA 5KYNA 4C3BA 1D0ZA 3WG7C 2E87A 1G8XA 2Y3BA 1D0YA 1M2VB 2NG1A 5T1DB 1YJWL 3POVA 3G6EL 1VQ7L 1NZEA 3OWTA 3HTKC 3ABKC 3KMIA 3LAYA 3DZAA 2QTVA 3G4SL 2L9JA 3CCEO 3CC2O 2DGJA 4U5GA 1N1CA 3AG4C 3NYLA 3E70C 2QY9A 1ZHWA 5IY5C 1NU9C 3EHNA 4MNDA 4C7OB 1VQOL 2OTJL 1LS1A 4BJ5C 1K9MP 3EZIA 2WZFA 1QVFN 1W2WA 4PJLA 1S72O 5EGYA 4Q4ZF 1W2BN 3I55L 1PCXA 3SYNA 3G4SO 1VQ4O 4NY3A 1M90M 5L3VA 3ITFA 3EG9B 3CCVL 1J8MF 3TD7A 3CCRL 1VQ8O 3ZSUA 2Y3GA 2R7UA 3FDQA 1OCOC 3B9QA 2H7BA 3LS0A 3SP1A 1KC8P 2KQ9A 1ZHXA 2NUTB 5HSWA 2MWQA 1YIJL 3RFYA 3CC4L 1VQ9L 5E2QA 3E9VA 2OG2A 3CCMO 5KYXA 2J45A 3O6XA 2W9YA 2V26A 3LLKA 3LLIA 1D1CA 3CPWK 1TWAA 1QZXA 4YWQA 5F5HA 3UR3C 4XWJA 2W4MA 3ZG1A 1K73P 1D1BA 3S29A 1Z63A 5DQTA 1VQNO 4BJ5A 4C3EA 2R7RA 3LEVA 4EWCA 4OD5A 4G7HF 1KU2A 3Q6NA 1ZU5A 4QDLA 3W2WA 1YI2O 4LERA 1RJ9A 2WL8A 1Z23A 2CNWD 1M2OA 3EQLF 2IOQA 1VQML 1N8RM 1SF8A 1NJIM 1Q82M 1MMNA 3JCUQ 3CD6O 2ZXOA 1TWGA 4DVZA 4JVSA 1IW7F 3K1IC 5DLJA 5KYWA 4G7ZF 3CMAO 2WVQA 4CSAA 2Y3HA 3CCQL 1MNEA 4GYTA 3MX3A 2DYRC 2IXPA 4A2NB 1PD0A 2IXNA 2JD3A 2L81A 2KGOA 1VYKA 2A69F 1V54C 3DAGA 2EIKC 1YJNO 1ZHTA 1YITO 2WZGA 4ANJA 2QA4O 4FX5A 5CI8A 4IRUA 4WJ0A 3ZC4A 3KKBA 5E3AA 1KQSK 3EHMA 3CQZA 2G3KA 2Q9CA 1Z5ZA 3FVYA 2WVOA 2NUPA 4CBEA 3M1CB 3W8HA 1QVGK 1M56C 4HFFB 4P6IC 1D1AA 3CCEL 2B0JA 3CC2L 4Q7CA 2J0WA 5KYXB 2PX0A 2J7PA 3EFOB 1M1KM 1BR1A 2OTLO 2D5RB 2ZXWC 4G0HA 4JZAA 1Q7YM 2H7VC 1Q81M 3T6BA 3DJUB 4JCHA 4JURI 3EPVA 1FFTC 2R7SA 1VQLO 4U5BE 1VMAA 1S72L 2GFHA 4XLNF 2HV7A 1VQ5O 4O6MA 2DYSC 4YJWA 1VQ4L 1BR4A 2EINC 3SZRA 3CCJO 2V3CC 3HJCA 4H4KC 4XLPF 3K6BA 1VQ8L 3N0TA 4XTKA 3OW2K 1TKNA 5B3SC 4JJGA 3CC7L 1MMGA 1RJ9B 4KNWA 1M90P 4OINF 3RH3A 4K7BA 3Q6MA 4O6NA 2KJGA 3FHDA 3CCML 4ULWA 1OCZC 2R7XA 5KYWB 2QEXO 2WZLA 4YT5A 3I4UA 3OA1A 1BR2A 3JRTA 3CC7O 3K1HA 3ECSA 3RKOF 3ASNC 4DBRA 1YHQO 3LS1A 2Q3TA 2J9UA 3K66A 4ZLCA 2W4BA 4HEAJ 4N06A 4OIRF 1VQNL 1Q86P 1Z6AA 5EHHA 4PJMA 1FMVA 3EFOA 3OEOA 1MMAA 1QLEC 3KH2A 1O87A 3K33A 2KW3C 3NKEA 3ABLC 3T6JA 4O7GA 4HE8D 4B6IA 4FESA 3CXCN 3QZCA 2PFDA 3VAYA 4CS8C 1YI2L 2EIMC 4F4BA 3RYLA 1OKKA 1JJ2N 3SNHA 1LKXA 1VQPO 2NUPB 2J46A 3S0XA 4BG0A 3UGPA 3F46A 3CD6L 1WGWA 4CIHA 3UMHA 2IXMA 4YT8A 3CMAL 4FWVA 2ZPAA 1FTSA 4U5HA 3AQBA 2R7VA 3EGDA 2O9XA 3AG1C 3I56O 4MQ9F 1N8RP 1NJIP 1QVFK 2LSEA 1Q82P 3O39A 1W2BK 2R7WA 1ZYRF 4U5CE 3CCLO 4DBQA 4ZLDA 4O6YA 1YJNL 3B0PA 4PJNA 4RBNA 1V55C 5KYUA 4DOZA 1YITL 4I3MA 4OIPF 5D92A 2QA4L 5DVWA 1JPNA 1K8AM 1FMWA 1K73M 3W8IA 2PP4A 1M57C 3DD7A 1MMDA 3PHF2 5DS5A 3X1OA 1D0XA 3DJNB 2J7PD 1S7ZA 4OIOF 1FFHA 3I5QA 3CCSO 4CS9C 2Z15A 4I1MA 1O5HA 2J9WA 1YJ9O 4U5FE 4BJTA 3L0IA 2YEVA 3SEOA 4AK9A 3EJNA 2W45A 4CS8A 2OTLL 4IWBA 3B0VC 4Q5SF 3CMEO 4CS7A 2XSEA 2Y3DA 1VQLL 1VQ5L 1M1KP 2WB7A 4I44A 3S28A 4E7ZA 1Q81P 1VOMA 3CCJL 2J9VA 5CI9A 1VQ6O 3UMIA 4PK4A 4J32B 4KC9A 4U5DE 5L3QA 4OIQF 4AE4A 3EGXA 4PFPA 3B0UX 1OCRC 2VB6A 3LJBA 5T3WA 2MYSA 1LVKA 3CZ6A 3LESA 1NU7D 2VH3A 2A1DD 1KD1M 3DAFA 4BEJA 4LACB 1VQKO 4PFOA 4QI0A 3UMKA 3GANA 3FAJA 5B1BC 2XXAA 4IAOA 1J8YF 5F5FA 2QEXL 3V7OA 4CS9A 3EGDB 3EZHA 2C04A 3DM9B 3Q7LA 3X2QC 3NYMA 2A6EF 3N24A 3G71O 3JT1A 3RIPA 3CPWN 1YHQL 1ZU4A 4YT2A 4RD9A 2CGEA 2Q9BA 5KYUB 3HLZA 3LNRA 3WODF 2R7OA 1OKKD 4KNVA 2IXOA 5T3TA 4DVYP 3AQCA 2XL4A 4X0RA 3ZVRA 4PJJA 3KL4A 1YJWO 3G6EO 1VK5A 1VQ7O 2C03A 3T4RA 1VQPL 2R7TA 1Z3IX 1K9MM 4E7SA 2FFHA 2CW0F 2HV6A 4OD4A 5FCLA 1ZHYA 3PMRA 2X51A 3K7DA 4BJ6C 3AG3C 1VQOO 4C3DA 3I56L 2OTJO 1MNDA 4I1OB 2CDQA 5KYYA 3NDBB 3W2VA 4IJJA 2KNHA 2YZSA 2J0XA 4BJ1A 5DS4A 3CCLL 3AG2C 4CSAC 2G62A 3I55O 1TWHA 4GEHA 4KI2A 2PF4E 4M63A 3ASOC 2OCCC 2BE5F 1KC8M 3JSZA 5E33A 4JJFA 3CCVO 1SZIA 3CCUL 2IYLD 4RDAA 3CCRO 4QI2A 3DMDA 3UGOA 2Q9AA 2Y39A 2G3VA 3ABMC 1Q86M 4AE4B 1ST6A 3EGXB 2A6HF 5DS6A 1M2VA 1KQSN 1PD1A 3NRHA 4KBLA 4U5EE 2H7OA 2P7VA 3CCSL 1K8AP 5D91A 1YJ9L 3H65A 2Y69C 3CC4O 1YIJO 1VQ9O 3JYHA 1QVGN 2XXAB 2PX3A 2I8BA 3CCUO 2EIJC 3VYWA 3EH2A 4C7OA 3CMEL 3L34A 4W8KA 4YT4A 2ZXRA 4JW1A 1OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6I C;  5DLJ A;  2YZS A;  3GOD A;  4WJ0 A;  5DQT A;  5DS4 A;  3NKD A;  5FCL A;  4W8K A;  5DS6 A;  4XTK A;  4N06 A;  3NKE A;  5DS5 A;  5DQZ A;  4QDL A; 
#chains in the Genus database with same CATH topology
 3N2Z B;  4JEB A;  2EIL C;  1TR2 A;  1VQ6 L;  1R5I D;  5E3C A;  3EH1 A;  2GDC A;  4LLE A;  4HFK B;  3RVY A;  3U3F A;  1Q7Y P;  4AX2 A;  5DQZ A;  3DKA A;  4Z9H A;  4NTF A;  3KYI A;  3CSK A;  3IEE A;  2A68 F;  3ZIB A;  2HS5 A;  1C17 M;  3DM5 A;  2WVN A;  1WTY A;  3JSE O;  1H6G A;  1D0Y A;  3L8I A;  3POV A;  1VQ7 L;  1LPE A;  3OWT A;  1EI7 A;  2QTV A;  4J7T A;  2AWY A;  3G4S L;  3CCE O;  3QVY A;  1ZZP A;  3E70 C;  2QY9 A;  4PR9 A;  4C7O B;  1NU9 C;  1VQO L;  4Q4Z F;  4NY3 A;  2ASR A;  3ITF A;  2AP3 A;  3EG9 B;  1OQC A;  1VLS A;  3M79 A;  3CCV L;  2HSB A;  2R7U A;  3KYJ A;  3FDQ A;  1M6T A;  3JRM O;  1ZHX A;  2MWQ A;  1NSG B;  3HNJ A;  1YYJ A;  2W9Y A;  3ZTM A;  2V26 A;  1GM5 A;  3WHN A;  1FR0 A;  4CDY A;  1TWA A;  2NSF A;  4YWQ A;  2UUH A;  3UR3 C;  2W4M A;  5GPG B;  1AEP A;  3SXM A;  4MTF A;  1VQN O;  3HKK A;  1VLT A;  4EWC A;  4G7H F;  1KU2 A;  1RJ9 A;  2XS8 A;  1Z23 A;  2CNW D;  3QW1 A;  2IOQ A;  2XLE A;  3JCU Q;  5KYW A;  3MX3 A;  3R7C A;  2IXP A;  1PD0 A;  3DE8 A;  5JVE A;  1APC A;  2L81 A;  2KGO A;  1VYK A;  2KSF A;  4JTC B;  2A0U A;  5L0G A;  5CI8 A;  1EKY A;  1YAU O;  5E3A A;  2G3K A;  3RW0 A;  3V5X A;  2R25 A;  4CBE A;  1D1A A;  2OTL O;  2D5R B;  2H7V C;  5TJ5 E;  3EPV A;  1Q0M A;  1K40 A;  1VQL O;  1S72 L;  1VQ5 O;  4YJW A;  1NFO A;  3C7J A;  1VQ4 L;  3SZR A;  4H4K C;  3N0T A;  5B3S C;  4JEA A;  2QNL A;  4KNW A;  1M90 P;  4OIN F;  3S90 A;  2LP4 A;  2KJG A;  3FHD A;  3GWL A;  2GA0 A;  1ZW2 A;  3MBG A;  4YT5 A;  3I4U A;  1HE1 A;  3CC7 O;  4DBR A;  3V5Y A;  3LS1 A;  2Q3T A;  3CEX A;  4OIR F;  1Z6A A;  4PJM A;  4NCQ A;  3K33 A;  3M4B A;  3A9C A;  3ABL C;  3T6J A;  1HMO A;  2PFD A;  2EIM C;  1LKX A;  5JT4 A;  2J46 A;  4BG0 A;  1WN0 A;  4CDV A;  4WGY A;  1EA8 A;  2BL2 A;  5JUA A;  3EGD A;  1YZA A;  1ORS C;  4P9F A;  1W2B K;  1A41 A;  4O6Y A;  3B0P A;  2L6F A;  4DOZ A;  1K73 M;  2KC3 A;  1M57 C;  3X1O A;  1D0X A;  3DJN B;  1T6U A;  3JZ0 A;  2PNO A;  2Z15 A;  2J9W A;  4U5F E;  3GOR A;  2YEV A;  4NQF A;  5COM A;  3CME O;  1L7C A;  1G5Z A;  4DRJ B;  2XSE A;  4CJG A;  2OKU A;  1M1K P;  2XLD A;  4N6C A;  1VQ6 O;  1LIH A;  1C02 A;  5L3Q A;  4AE4 A;  5T3W A;  3M4C A;  3FAP B;  1KTM A;  1DOW A;  2HUJ A;  1KD1 M;  4WGZ A;  1SR2 A;  4LAC B;  4PFO A;  3AJM A;  5B1B C;  2J9B A;  4IAO A;  1HMD A;  5F5F A;  2P1A A;  3V7O A;  5A6B A;  5JLI A;  3RIP A;  1DOV A;  1ZU4 A;  5L0H A;  3U9M A;  3LNR A;  1OKK D;  2IXO A;  3RVZ A;  3BRJ A;  1VQ7 O;  2C03 A;  2FAP B;  1K9M M;  3AGU A;  2CW0 F;  5FCL A;  3PCV A;  3AG3 C;  1VQO O;  4IJJ A;  2KNH A;  4JIO A;  3CCL L;  4CSA C;  3DWW A;  4GEH A;  2PF4 E;  2XM0 A;  3FOP A;  3CCV O;  1SZI A;  1YA7 O;  2XLH A;  1ST6 A;  3EGX B;  1XWJ A;  2YL0 A;  2KK1 A;  5L0F A;  1K8A P;  1YJ9 L;  4P9T A;  2Y69 C;  3JYH A;  2XXA B;  3VYW A;  2L7A A;  4C7O A;  2HMZ A;  1QQ3 A;  4W8K A;  2YQY A;  5B1A C;  1LI5 A;  4CJO A;  1YLM A;  4YN0 B;  4YL0 A;  3EG9 A;  2VAS A;  1VB5 A;  2M4E A;  1UFB A;  4H54 A;  3CXC K;  3ZDL A;  4MVU A;  2P0N A;  2QLA A;  4EBB A;  2P61 A;  1CGN A;  1VYI A;  2ZXP A;  5BUO A;  1VQK L;  4G7O F;  3UNG C;  4MW3 A;  4JTD B;  2OU6 A;  3NKD A;  5KYY B;  3QMK A;  1HY5 A;  4U9D A;  1JPJ A;  5L0I A;  2OQM A;  4LLC A;  2IBF A;  1G8X A;  1OCC C;  1A7E A;  1M2V B;  4YK5 A;  3DZA A;  3VM6 A;  2L9J A;  4MTO A;  2KYH A;  4U5G A;  3AG4 C;  3NYL A;  5COF A;  1ZHW A;  3EHN A;  4PAC A;  3EZI A;  3FMS A;  1QVF N;  2JPU A;  1W2W A;  1S72 O;  3IPM O;  3TK0 A;  1Z7Q c;  4FAP B;  3I55 L;  3SYN A;  2Q00 A;  1U89 A;  3IQC A;  1VQ4 O;  4Z9I A;  2XLO A;  3CCR L;  3HNL A;  3ZSU A;  1Q0K A;  5EK0 A;  4CIP A;  2OJQ A;  2NUT B;  1YIJ L;  1VQ9 L;  3E9V A;  4MS2 A;  3O6X A;  1SYQ A;  1BBH A;  3LLK A;  2GAQ A;  2EPM X;  5DQT A;  2EPL X;  1ZVZ A;  4XEK A;  1BDJ B;  4AL0 A;  4QDL A;  3W2W A;  4BPM A;  2I15 A;  3SXZ A;  4LER A;  5JRA A;  4E18 A;  4DRH B;  1VQM L;  3EQL F;  3SXK A;  2YKZ A;  1SF8 A;  1NJI M;  1Q82 M;  1MMN A;  1T01 A;  3GEI A;  4JVS A;  5DLJ A;  4R32 A;  3CCQ L;  4GYT A;  2DYR C;  1RKE A;  2RSE B;  1QPU A;  2A69 F;  1V54 C;  2GWW A;  3DAG A;  4JTA B;  2WZG A;  2XLW A;  4ANJ A;  3ZC4 A;  1U6H A;  2XL8 A;  3CQZ A;  3FVY A;  1M56 C;  1BZ4 A;  4P6I C;  3CC2 L;  5KYX B;  2J0W A;  4D4N A;  1RCP A;  1Q7Y M;  3T6B A;  4JUR I;  1FFT C;  3VRC A;  2GFH A;  2HV7 A;  2DYS C;  1LS4 A;  3NMJ A;  2EIN C;  2JX0 A;  3T9O A;  3U8P A;  4XLP F;  1VQ8 L;  4XTK A;  3OW2 K;  4N6H A;  1MMG A;  3IQT A;  4K7B A;  3QTH A;  1BR2 A;  3ECS A;  3RKO F;  4ZLC A;  2HJM A;  2YL3 A;  1Q86 P;  5EHH A;  1FMV A;  2ICW G;  3EFO A;  3OEO A;  5L0D A;  3ZQV A;  4B6I A;  1YI2 L;  4YL3 A;  3SNH A;  5F28 E;  1E2X A;  2R9R B;  3F46 A;  3CD6 L;  2IXM A;  2D4U A;  3C8G A;  4FWV A;  3CMA L;  1Q0G A;  2O9X A;  3AG1 C;  4MQ9 F;  3CCL O;  1R4T A;  2R05 A;  1YIT L;  5D92 A;  2QA4 L;  2A0B A;  1OR2 A;  3W8I A;  4XPY A;  1MMD A;  2H8A A;  2J7P D;  1S7Z A;  1FFH A;  1YJ9 O;  4BJT A;  2AWC A;  3SEO A;  4L6R A;  5A6J A;  3B0V C;  5JP7 A;  4Q5S F;  1U0B B;  1GGQ A;  2Y3D A;  1O3U A;  1OR3 A;  4JC7 A;  4IB4 A;  4NC3 A;  1S05 A;  1HW1 A;  1VOM A;  5A6A A;  2J9V A;  3UMI A;  1YAR O;  4EUK B;  3RQG A;  5L0J A;  3EGX A;  3B0U X;  2L6H A;  1K05 A;  3LES A;  4IAR A;  1VQK O;  4JRZ A;  3UMK A;  3GAN A;  3FAJ A;  2XXA A;  1OW8 A;  3Q7L A;  3X2Q C;  3LEO A;  3RQE A;  3JT1 A;  2F22 A;  2L6G A;  4UDV A;  2CGE A;  3HLZ A;  4DVY P;  2XL4 A;  1OXB A;  4LDQ A;  3T4R A;  4EKW A;  4E7S A;  4EIY A;  1K04 A;  5AC5 A;  4BJ6 C;  3HNI A;  4C3D A;  1T9K A;  1MND A;  5KYY A;  3W2V A;  2YZS A;  2BC5 A;  3AG2 C;  4G78 A;  3I55 O;  3US6 A;  4M63 A;  1KC8 M;  3JSZ A;  3CCR O;  3DMD A;  1M2V A;  1G4U S;  2H7O A;  2P7V A;  3CCS L;  3TOM A;  1FAP B;  3AGT A;  1YIJ O;  1VQ9 O;  2UUI A;  2PX3 A;  2I8B A;  3CCU O;  3L34 A;  4YT4 A;  2R7Q A;  2EPK X;  4CX9 A;  3AOU A;  3C18 A;  4BJ6 A;  3SXY A;  2XRH A;  2QE9 A;  2YHS A;  4O79 A;  1JJ2 K;  3DXJ F;  1IZM A;  1VQM O;  2NUT A;  5B3I A;  2FGY A;  1RKC A;  2CNW A;  1I4Z A;  3BEH A;  2EPN A;  1GS9 A;  3CCQ O;  1KD1 P;  2P6V A;  3G71 L;  1ZHZ A;  3S9O A;  1TWC A;  3Q7G A;  5KYN A;  1JMW A;  1L3P A;  1D0Z A;  2E87 A;  2LCH A;  2XLM A;  2Y3B A;  2NPU A;  1HW2 A;  1OW7 A;  4LDK A;  3HTK C;  3ABK C;  3C63 A;  5A69 A;  3CC2 O;  1PV3 A;  1KNY A;  2ETS A;  4NTA A;  5IY5 C;  2RD9 A;  3O55 A;  3M15 A;  4YL1 A;  1LS1 A;  1RXQ A;  1K9M P;  4A4A A;  1AUE A;  1A7D A;  1W2B N;  1H7I A;  3J06 A;  3G4S O;  2VCA A;  3IQ5 A;  5L3V A;  2YLD A;  4ONS A;  3TD7 A;  1VQ8 O;  1G4W R;  2Y3G A;  4JCZ A;  3G50 A;  3LS0 A;  3V5Z A;  2KQ9 A;  5HSW A;  5FZT A;  3RQF A;  3CC4 L;  2OG2 A;  5KYX A;  2J45 A;  5BQH A;  3LLI A;  3GEH A;  1D1C A;  3CPW K;  1T5O A;  5F5H A;  4XWJ A;  3ZG1 A;  1D1B A;  3S29 A;  2R7R A;  3IHU A;  5BQI A;  2YWA A;  3Q6N A;  1I4Y A;  1YI2 O;  2WL8 A;  1YA9 A;  2MHR A;  1N8R M;  3CD6 O;  2ZXO A;  1TWG A;  3CMA O;  3K1I C;  2VC9 A;  2WVQ A;  3MYF A;  4CSA A;  1LE2 A;  2IXN A;  1ZHT A;  1YIT O;  3C62 A;  1WAT A;  2QA4 O;  1KQS K;  2IM8 A;  2OOC A;  2Q9C A;  3M1C B;  3W8H A;  1QVG K;  2PX0 A;  4JKV A;  1BR1 A;  2ZXW C;  1Q81 M;  3DJU B;  2R7S A;  1VMA A;  2HMQ A;  3K1I A;  1LE4 A;  2V3C C;  3HJC A;  4E17 A;  4JJG A;  3CC7 L;  3RH3 A;  3B29 A;  3Q6M A;  3CCM L;  1XZP A;  4ULW A;  1OCZ C;  3U8V A;  1VTM P;  3GM2 A;  4ULV A;  4MTG A;  1V74 B;  3U3B A;  2J9U A;  2W4B A;  4HEA J;  1MMA A;  1O87 A;  3NKE A;  4XQ1 A;  3NMK A;  4O7G A;  4HE8 D;  3CXC N;  3VAY A;  2TMV P;  1OKK A;  3TJ6 A;  2NUP B;  3WAQ A;  1A0B A;  4CIH A;  3UMH A;  4YT8 A;  1JOG A;  1WOL A;  1FTS A;  3RF3 A;  3L1M A;  1NJI P;  2LSE A;  1Q82 P;  3O39 A;  1WAS A;  4DBQ A;  1YJN L;  4PJN A;  4RBN A;  3ATP A;  1FMW A;  4W8P A;  3DD7 A;  3PHF 2;  2Q4F A;  4Z9J A;  4ER9 A;  3CCS O;  4I1M A;  3U9J A;  4E0H A;  3L8J A;  3B71 A;  5AGF A;  2W45 A;  3G4Z A;  4IWB A;  1EQ1 A;  4CDA A;  4CS7 A;  4GQH A;  2LD6 A;  3S28 A;  4E7Z A;  3QVZ A;  3CCJ L;  1LM3 B;  3TOL A;  1E84 A;  4J32 B;  3KPH A;  1AVO B;  1Y4C A;  1OCR C;  2VB6 A;  3TJ5 A;  2MYS A;  2XLV A;  1LVK A;  4E0I A;  3CZ6 A;  2VH3 A;  2A1D D;  3DAF A;  3G4X A;  4QI0 A;  2QEX L;  1C03 A;  1NBB A;  2A6E F;  3N24 A;  3G71 O;  1YHQ L;  1QSP A;  2R02 A;  4RD9 A;  5KYU B;  2Q9B A;  4N4W A;  2HSQ A;  5JSL A;  5T3T A;  1H9G A;  4D4X A;  2AU5 A;  4X0R A;  3ZVR A;  2EPO A;  3KL4 A;  2YLI A;  1GQA A;  1VK5 A;  1VQP L;  2R7T A;  1Z3I X;  3T6G B;  2ZD9 A;  3PMR A;  1UG7 A;  1JAF A;  3I56 L;  4I1O B;  4BJ1 A;  1A7V A;  3QW0 A;  3VF0 A;  1TWH A;  4KI2 A;  3H2U A;  4JJF A;  4RDA A;  4QI2 A;  3UGO A;  2Q9A A;  1Q86 M;  2Y39 A;  2G3V A;  2A6H F;  3GM1 A;  3GEE A;  4KBL A;  4U5E E;  3MYI A;  3IQ6 A;  1NLX A;  5D91 A;  3CC4 O;  1WWP A;  1E86 A;  2EIJ C;  3EH2 A;  2XM4 A;  3U2L A;  2ZXR A;  4JW1 A;  2LK4 A;  3JTL O;  1F1M A;  3S27 A;  4J30 B;  3I5P A;  4K0D A;  3NYJ A;  3OW2 N;  3MLG A;  1NFN A;  1ORY A;  5A6B D;  1SMY F;  3GOD A;  1NG1 A;  2YRF A;  4EHP A;  1JR8 A;  3NG1 A;  4DRI B;  2XS1 A;  2J8W A;  3PDM P;  3ZTZ A;  3F47 A;  1RMV A;  4C3B A;  3R2P A;  3WG7 C;  3LNM B;  2NG1 A;  1YJW L;  5T1D B;  3G6E L;  1NZE A;  3KMI A;  3LAY A;  3ZWI A;  4WAB A;  1OW6 A;  2DGJ A;  1N1C A;  4XPX A;  4MND A;  2OTJ L;  1YJG A;  4BJ5 C;  2WZF A;  3NMI A;  4PJL A;  2PBE A;  5EGY A;  2HZ8 A;  1PCX A;  3U2M A;  1M90 M;  1J8M F;  4MW8 A;  4EBK A;  1LI7 A;  3U0C A;  1OCO C;  3B9Q A;  2X0C A;  1RKE B;  2H7B A;  3SP1 A;  1TFK B;  1KC8 P;  4EBJ A;  3RFY A;  1CPQ A;  5E2Q A;  3CCM O;  1T6I A;  2VCC A;  2Q7R A;  1V4A A;  2R03 A;  2HJ3 A;  3LUT B;  1QZX A;  1K73 P;  5BQG A;  1TFO B;  1Z63 A;  1ORJ A;  2YL7 A;  4MVM A;  4BJ5 A;  4C3E A;  4IAQ A;  3LEV A;  4OD5 A;  5COG A;  2NSG A;  1ZU5 A;  4MVZ A;  4XEV A;  1M2O A;  4DVZ A;  4K1O A;  1IW7 F;  4G7Z F;  2QUP A;  3JYY A;  2Y3H A;  4J7Y A;  1MNE A;  256B A;  4A2N B;  2OJE D;  2JD3 A;  2EIK C;  1YJN O;  1H9T A;  1YZC A;  4LDR A;  2OEX A;  1MQV A;  4FX5 A;  4IRU A;  4WJ0 A;  3KKB A;  1B68 A;  1TQG A;  2HFI A;  3EHM A;  4XPW A;  5HV9 A;  3C8Z A;  1Z5Z A;  2WVO A;  2NUP A;  4HFF B;  3CCE L;  2B0J A;  4Q7C A;  1M1K M;  2J7P A;  3EFO B;  4G0H A;  4JZA A;  4JCH A;  1I5N A;  1QVX A;  4U5B E;  4XLN F;  1OXK A;  3FXH A;  4O6M A;  1FNT c;  1BR4 A;  3H2V A;  3TUL A;  3CCJ O;  3K6B A;  3C8G B;  2AVK A;  1JRA A;  1YDI A;  1TKN A;  1RJ9 B;  1XZQ A;  4O6N A;  5JS5 A;  3HNK A;  2R7X A;  5KYW B;  4IGG A;  2WZL A;  2QEX O;  3OA1 A;  3JRT A;  4DJ9 A;  3K1H A;  3ASN C;  3CAX A;  1YHQ O;  3DE9 A;  1E83 A;  3K66 A;  4N06 A;  1VQN L;  3KH2 A;  1QLE C;  2KW3 C;  5K0I A;  4NTB A;  4FES A;  3QZC A;  4CS8 C;  4F4B A;  5A6K A;  3RYL A;  1JJ2 N;  1VQP O;  2LFD A;  3DI5 A;  3S0X A;  3UGP A;  1WGW A;  2ZPA A;  4U5H A;  3AQB A;  2R7V A;  4JE9 A;  3I56 O;  1N8R P;  1QVF K;  4DXW A;  2R7W A;  1ZYR F;  1Y6D A;  4U5C E;  4ZLD A;  3GM3 A;  5KYU A;  1V55 C;  4I3M A;  4OIP F;  5CIV A;  2DB4 A;  5DVW A;  1JPN A;  1K8A M;  3ZQY A;  2PP4 A;  5DS5 A;  2CYD A;  2CCY A;  1ZW3 A;  4MVR A;  4OIO F;  1YYX A;  3I5Q A;  5L0C A;  4CS9 C;  1O5H A;  2OEV A;  3L0I A;  4AK9 A;  3EJN A;  1HE9 A;  4CS8 A;  2OTL L;  4AL1 A;  2YL1 A;  4U9E A;  1VQL L;  1VQ5 L;  2WB7 A;  4I44 A;  1Q81 P;  5AC4 A;  5CI9 A;  4PK4 A;  4KC9 A;  4U5D E;  4OIQ F;  4PFP A;  3LJB A;  4MVQ A;  1NU7 D;  4BEJ A;  1CPR A;  2HKV A;  3A11 A;  1J8Y F;  3GWN A;  4CS9 A;  3S84 A;  3EGD B;  3EZH A;  2LFF A;  2C04 A;  2YVK A;  3DM9 B;  3NYM A;  3CPW N;  1E85 A;  4YT2 A;  3WOD F;  2R7O A;  4KNV A;  4MVO A;  3AQC A;  4PJJ A;  4XEF A;  1YJW O;  1YVI A;  3G6E O;  3C8G D;  2FFH A;  2HV6 A;  2XL6 A;  4OD4 A;  1ZHY A;  2X51 A;  3K7D A;  1QKR A;  2OTJ O;  1T6Q A;  1CGM E;  2CDQ A;  3NDB B;  3O10 A;  2J0X A;  5DS4 A;  1Q0F A;  3W4Y A;  2YLG A;  2G62 A;  3ASO C;  2OCC C;  2BE5 F;  4MVS A;  2M64 A;  5E33 A;  3TQO A;  3CCU L;  2IYL D;  1Q0D A;  3ABM C;  4AE4 B;  5DS6 A;  2LIG A;  4BEM J;  1KQS N;  1PD1 A;  2LQG A;  3NRH A;  3U5S A;  2DI3 A;  3H65 A;  1QVG N;  2B0H A;  1CGO A;  3MFN A;  2VCB A;  3CME L;  3FOO A; 
#chains in the Genus database with same CATH homology
 3N2Z B;  5B1A C;  2R7Q A;  4BJ6 A;  2EIL C;  1TR2 A;  4YN0 B;  3S27 A;  3EG9 A;  1VQ6 L;  2XRH A;  4J30 B;  3I5P A;  2VAS A;  2M4E A;  3CXC K;  5E3C A;  4K0D A;  3NYJ A;  3EH1 A;  2YHS A;  4O79 A;  3OW2 N;  4LLE A;  4HFK B;  3MLG A;  1JJ2 K;  3DXJ F;  4EBB A;  1IZM A;  1VYI A;  2ZXP A;  5BUO A;  1VQM O;  1SMY F;  1Q7Y P;  1VQK L;  3GOD A;  1NG1 A;  2NUT A;  4AX2 A;  5DQZ A;  2FGY A;  4G7O F;  3UNG C;  3CSK A;  2CNW A;  3IEE A;  3CCQ O;  2A68 F;  1KD1 P;  3ZIB A;  3NKD A;  2P6V A;  5KYY B;  3G71 L;  3QMK A;  3NG1 A;  1ZHZ A;  1JPJ A;  1TWC A;  3DM5 A;  3Q7G A;  3F47 A;  4LLC A;  2WVN A;  5KYN A;  4C3B A;  1D0Z A;  3WG7 C;  2E87 A;  1G8X A;  2Y3B A;  1D0Y A;  1M2V B;  2NG1 A;  5T1D B;  1YJW L;  3POV A;  3G6E L;  1VQ7 L;  1NZE A;  3OWT A;  3HTK C;  3ABK C;  3KMI A;  3LAY A;  3DZA A;  2QTV A;  3G4S L;  2L9J A;  3CCE O;  3CC2 O;  2DGJ A;  4U5G A;  1N1C A;  3AG4 C;  3NYL A;  3E70 C;  2QY9 A;  1ZHW A;  5IY5 C;  1NU9 C;  3EHN A;  4MND A;  4C7O B;  1VQO L;  2OTJ L;  1LS1 A;  4BJ5 C;  1K9M P;  3EZI A;  2WZF A;  1QVF N;  1W2W A;  4PJL A;  1S72 O;  5EGY A;  4Q4Z F;  1W2B N;  3I55 L;  1PCX A;  3SYN A;  3G4S O;  1VQ4 O;  4NY3 A;  1M90 M;  5L3V A;  3ITF A;  3EG9 B;  3CCV L;  1J8M F;  3TD7 A;  3CCR L;  1VQ8 O;  3ZSU A;  2Y3G A;  2R7U A;  3FDQ A;  1OCO C;  3B9Q A;  2H7B A;  3LS0 A;  3SP1 A;  1KC8 P;  2KQ9 A;  1ZHX A;  2NUT B;  5HSW A;  2MWQ A;  1YIJ L;  3RFY A;  3CC4 L;  1VQ9 L;  5E2Q A;  3E9V A;  2OG2 A;  3CCM O;  5KYX A;  2J45 A;  3O6X A;  2W9Y A;  2V26 A;  3LLK A;  3LLI A;  1D1C A;  3CPW K;  1TWA A;  1QZX A;  4YWQ A;  5F5H A;  3UR3 C;  4XWJ A;  2W4M A;  3ZG1 A;  1K73 P;  1D1B A;  3S29 A;  1Z63 A;  5DQT A;  1VQN O;  4BJ5 A;  4C3E A;  2R7R A;  3LEV A;  4EWC A;  4OD5 A;  4G7H F;  1KU2 A;  3Q6N A;  1ZU5 A;  4QDL A;  3W2W A;  1YI2 O;  4LER A;  1RJ9 A;  2WL8 A;  1Z23 A;  2CNW D;  1M2O A;  3EQL F;  2IOQ A;  1VQM L;  1N8R M;  1SF8 A;  1NJI M;  1Q82 M;  1MMN A;  3JCU Q;  3CD6 O;  2ZXO A;  1TWG A;  4DVZ A;  4JVS A;  1IW7 F;  3K1I C;  5DLJ A;  5KYW A;  4G7Z F;  3CMA O;  2WVQ A;  4CSA A;  2Y3H A;  3CCQ L;  1MNE A;  4GYT A;  3MX3 A;  2DYR C;  2IXP A;  4A2N B;  1PD0 A;  2IXN A;  2JD3 A;  2L81 A;  2KGO A;  1VYK A;  2A69 F;  1V54 C;  3DAG A;  2EIK C;  1YJN O;  1ZHT A;  1YIT O;  2WZG A;  4ANJ A;  2QA4 O;  4FX5 A;  5CI8 A;  4IRU A;  4WJ0 A;  3ZC4 A;  3KKB A;  5E3A A;  1KQS K;  3EHM A;  3CQZ A;  2G3K A;  2Q9C A;  1Z5Z A;  3FVY A;  2WVO A;  2NUP A;  4CBE A;  3M1C B;  3W8H A;  1QVG K;  1M56 C;  4HFF B;  4P6I C;  1D1A A;  3CCE L;  2B0J A;  3CC2 L;  4Q7C A;  2J0W A;  5KYX B;  2PX0 A;  2J7P A;  3EFO B;  1M1K M;  1BR1 A;  2OTL O;  2D5R B;  2ZXW C;  4G0H A;  4JZA A;  1Q7Y M;  2H7V C;  1Q81 M;  3T6B A;  3DJU B;  4JCH A;  4JUR I;  3EPV A;  1FFT C;  2R7S A;  1VQL O;  4U5B E;  1VMA A;  1S72 L;  2GFH A;  4XLN F;  2HV7 A;  1VQ5 O;  4O6M A;  2DYS C;  4YJW A;  1VQ4 L;  1BR4 A;  2EIN C;  3SZR A;  3CCJ O;  2V3C C;  3HJC A;  4H4K C;  4XLP F;  3K6B A;  1VQ8 L;  3N0T A;  4XTK A;  3OW2 K;  1TKN A;  5B3S C;  4JJG A;  3CC7 L;  1MMG A;  1RJ9 B;  4KNW A;  1M90 P;  4OIN F;  3RH3 A;  4K7B A;  3Q6M A;  4O6N A;  2KJG A;  3FHD A;  3CCM L;  4ULW A;  1OCZ C;  2R7X A;  5KYW B;  2QEX O;  2WZL A;  4YT5 A;  3I4U A;  3OA1 A;  1BR2 A;  3JRT A;  3CC7 O;  3K1H A;  3ECS A;  3RKO F;  3ASN C;  4DBR A;  1YHQ O;  3LS1 A;  2Q3T A;  2J9U A;  3K66 A;  4ZLC A;  2W4B A;  4HEA J;  4N06 A;  4OIR F;  1VQN L;  1Q86 P;  1Z6A A;  5EHH A;  4PJM A;  1FMV A;  3EFO A;  3OEO A;  1MMA A;  1QLE C;  3KH2 A;  1O87 A;  3K33 A;  2KW3 C;  3NKE A;  3ABL C;  3T6J A;  4O7G A;  4HE8 D;  4B6I A;  4FES A;  3CXC N;  3QZC A;  2PFD A;  3VAY A;  4CS8 C;  1YI2 L;  2EIM C;  4F4B A;  3RYL A;  1OKK A;  1JJ2 N;  3SNH A;  1LKX A;  1VQP O;  2NUP B;  2J46 A;  3S0X A;  4BG0 A;  3UGP A;  3F46 A;  3CD6 L;  1WGW A;  4CIH A;  3UMH A;  2IXM A;  4YT8 A;  3CMA L;  4FWV A;  2ZPA A;  1FTS A;  4U5H A;  3AQB A;  2R7V A;  3EGD A;  2O9X A;  3AG1 C;  3I56 O;  4MQ9 F;  1N8R P;  1NJI P;  1QVF K;  2LSE A;  1Q82 P;  3O39 A;  1W2B K;  2R7W A;  1ZYR F;  4U5C E;  3CCL O;  4DBQ A;  4ZLD A;  4O6Y A;  1YJN L;  3B0P A;  4PJN A;  4RBN A;  1V55 C;  5KYU A;  4DOZ A;  1YIT L;  4I3M A;  4OIP F;  5D92 A;  2QA4 L;  5DVW A;  1JPN A;  1K8A M;  1FMW A;  1K73 M;  3W8I A;  2PP4 A;  1M57 C;  3DD7 A;  1MMD A;  3PHF 2;  5DS5 A;  3X1O A;  1D0X A;  3DJN B;  2J7P D;  1S7Z A;  4OIO F;  1FFH A;  3I5Q A;  3CCS O;  4CS9 C;  2Z15 A;  4I1M A;  1O5H A;  2J9W A;  1YJ9 O;  4U5F E;  4BJT A;  3L0I A;  2YEV A;  3SEO A;  4AK9 A;  3EJN A;  2W45 A;  4CS8 A;  2OTL L;  4IWB A;  3B0V C;  4Q5S F;  3CME O;  4CS7 A;  2XSE A;  2Y3D A;  1VQL L;  1VQ5 L;  1M1K P;  2WB7 A;  4I44 A;  3S28 A;  4E7Z A;  1Q81 P;  1VOM A;  3CCJ L;  2J9V A;  5CI9 A;  1VQ6 O;  3UMI A;  4PK4 A;  4J32 B;  4KC9 A;  4U5D E;  5L3Q A;  4OIQ F;  4AE4 A;  3EGX A;  4PFP A;  3B0U X;  1OCR C;  2VB6 A;  3LJB A;  5T3W A;  2MYS A;  1LVK A;  3CZ6 A;  3LES A;  1NU7 D;  2VH3 A;  2A1D D;  1KD1 M;  3DAF A;  4BEJ A;  4LAC B;  1VQK O;  4PFO A;  4QI0 A;  3UMK A;  3GAN A;  3FAJ A;  5B1B C;  2XXA A;  4IAO A;  1J8Y F;  5F5F A;  2QEX L;  3V7O A;  4CS9 A;  3EGD B;  3EZH A;  2C04 A;  3DM9 B;  3Q7L A;  3X2Q C;  3NYM A;  2A6E F;  3N24 A;  3G71 O;  3JT1 A;  3RIP A;  3CPW N;  1YHQ L;  1ZU4 A;  4YT2 A;  4RD9 A;  2CGE A;  2Q9B A;  5KYU B;  3HLZ A;  3LNR A;  3WOD F;  2R7O A;  1OKK D;  4KNV A;  2IXO A;  5T3T A;  4DVY P;  3AQC A;  2XL4 A;  4X0R A;  3ZVR A;  4PJJ A;  3KL4 A;  1YJW O;  3G6E O;  1VK5 A;  1VQ7 O;  2C03 A;  3T4R A;  1VQP L;  2R7T A;  1Z3I X;  1K9M M;  4E7S A;  2FFH A;  2CW0 F;  2HV6 A;  4OD4 A;  5FCL A;  1ZHY A;  3PMR A;  2X51 A;  3K7D A;  4BJ6 C;  3AG3 C;  1VQO O;  4C3D A;  3I56 L;  2OTJ O;  1MND A;  4I1O B;  2CDQ A;  5KYY A;  3NDB B;  3W2V A;  4IJJ A;  2KNH A;  2YZS A;  2J0X A;  4BJ1 A;  5DS4 A;  3CCL L;  3AG2 C;  4CSA C;  2G62 A;  3I55 O;  1TWH A;  4GEH A;  4KI2 A;  2PF4 E;  4M63 A;  3ASO C;  2OCC C;  2BE5 F;  1KC8 M;  3JSZ A;  5E33 A;  4JJF A;  3CCV O;  1SZI A;  3CCU L;  2IYL D;  4RDA A;  3CCR O;  4QI2 A;  3DMD A;  3UGO A;  2Q9A A;  2Y39 A;  2G3V A;  3ABM C;  1Q86 M;  4AE4 B;  1ST6 A;  3EGX B;  2A6H F;  5DS6 A;  1M2V A;  1KQS N;  1PD1 A;  3NRH A;  4KBL A;  4U5E E;  2H7O A;  2P7V A;  3CCS L;  1K8A P;  5D91 A;  1YJ9 L;  3H65 A;  2Y69 C;  3CC4 O;  1YIJ O;  1VQ9 O;  3JYH A;  1QVG N;  2XXA B;  2PX3 A;  2I8B A;  3CCU O;  2EIJ C;  3VYW A;  3EH2 A;  4C7O A;  3CME L;  3L34 A;  4W8K A;  4YT4 A;  2ZXR A;  4JW1 A;  1OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...