3GODA

Structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
DISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Immune system
molecule keywords Cas1
total genus 115
structure length 320
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01867 Cas_Cas1 CRISPR associated protein Cas1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3godA02
3.100.10.20 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3godA01
4WJ0A 5FCLA 5DS4A 4N06A 2YZSA 4QDLA 4W8KA 4XTKA 3GODA 5DS5A 5DQZA 3NKDA 4P6IC 5DQTA 3NKEA 5DLJA 5DS6A
chains in the Genus database with same CATH superfamily
4JRZA 2KSFA 2Q7RA 1Z3IX 3ZIBA 2XSEA 4CS8A 1T6IA 1AEPA 5JP7A 3UGPA 3CCML 4KI2A 4CIPA 2IXNA 4OIPF 1N1CA 4AL0A 2Q00A 2PFDA 2OTJL 4EUKB 1YAUO 5DVWA 1VQLO 1VQ6L 3EFOA 1M57C 1YARO 1YZCA 4JURI 4JW1A 4PJMA 3S0XA 2YQYA 2YWAA 4K7BA 3S28A 1YITL 1A7EA 4U9EA 2WVQA 5A69A 3VAYA 2QLAA 2ZD9A 2XLOA 3CC2O 1ZVZA 5COGA 2C04A 4E17A 3MYFA 1Q0MA 3Q6NA 3H2UA 256BA 3EPVA 1K8AP 2L6FA 4JEAA 5JRAA 1I5NA 2J7PA 1OXBA 4J7TA 4U9DA 5BUOA 4J7YA 3KL4A 4JKVA 4N4WA 4P6IC 5KYYB 1QSPA 3EHNA 4XEVA 4EWCA 3CCEL 3SP1A 1BR2A 1G4WR 1NFNA 3GEEA 1LS1A 3RVZA 2PX3A 3GWNA 3PHF2 2BE5F 2CYDA 2QUPA 1GQAA 3IEEA 3M4CA 4MW3A 1YYJA 4XEKA 5F5HA 2V3CC 1TWGA 1K05A 2WL8A 3JRMO 3KKBA 1TR2A 4I1OB 2NUPB 1AVOB 1S72L 1KQSN 1VQNL 4BEJA 3N24A 4MTFA 3TQOA 1GGQA 3CMEL 1VQ4O 1Z23A 1QQ3A 2KQ9A 1TWAA 1LI7A 2R7SA 2D4UA 2W4MA 1MMAA 4H54A 5D92A 4DOZA 4P9FA 4MW8A 1SYQA 4Q7CA 3LS1A 3ZSUA 2YRFA 5KYWA 2A0BA 1YJNO 2R7TA 3CD6O 1VQOO 3U9JA 3UMKA 1TWHA 3L8IA 1J8YF 5JUAA 2X0CA 3U8PA 2L6HA 4AL1A 3CCLO 4LLCA 2J0XA 2VCCA 4CDYA 2J9BA 2H7OA 3W2WA 2HMZA 2OCCC 1S05A 4LLEA 3DZAA 4HFFB 3SXZA 3V5YA 3ZG1A 5JVEA 4NQFA 4BJ6A 1D0XA 4PACA 4P9TA 4CBEA 3G6EO 3G71O 1KNYA 3OA1A 4O79A 1FMWA 3U2LA 2WVNA 2OJED 2LK4A 4RBNA 2DB4A 4CS9A 3ZQYA 1FAPB 3ZTZA 4NTBA 4U5HA 5DQZA 4JZAA 1WASA 3UMIA 3NKEA 2IBFA 5L3QA 3EH2A 2YL0A 1JRAA 2LSEA 5DS5A 3B29A 5JT4A 2XLMA 3HNKA 4MNDA 3K1HA 4IJJA 2G3VA 1QVGN 1M6TA 4Z9HA 5FCLA 3S27A 5DS4A 2CDQA 1Q81M 2KJGA 1OW8A 1H6GA 1PD1A 4L6RA 1M90P 1WGWA 2EPLX 4G7HF 3NKDA 1NSGB 3K1IA 1QPUA 3C7JA 3L34A 1D1BA 2HMQA 3U8VA 5AGFA 2GFHA 2HJ3A 1XWJA 3DJUB 4HEAJ 4MS2A 4RD9A 1LKXA 4W8KA 1LE2A 4WGYA 1VQ4L 1I4ZA 3RYLA 3X1OA 1VLTA 2A0UA 4WGZA 1PV3A 2CNWD 1S72O 2L6GA 1J8MF 1LIHA 2C03A 3NMKA 2QEXO 1KD1M 4E7ZA 2Y3HA 1VOMA 2OOCA 2OU6A 5B1AC 3TD7A 3UMHA 2MHRA 2IXOA 3CC7L 1EA8A 1Q0KA 2HKVA 3EQLF 4H4KC 2G62A 2XM0A 4JCHA 3KYIA 3TJ5A 4XLPF 3EGXA 1A41A 2OTJO 3QW0A 2R7OA 3GWLA 5A6BD 1M1KP 3I5QA 5F5FA 4CS8C 5L0GA 3CXCN 3CQZA 3NYMA 3WHNA 4CSAC 4IGGA 3G50A 4IARA 3W8HA 4XQ1A 1K8AM 4CS7A 4WABA 2NUTA 2XLVA 4XLNF 1ZYRF 1E85A 1HW2A 5CIVA 1Z63A 5F28E 1BDJB 4G0HA 4OIRF 1K73M 4Q4ZF 1LS4A 2LIGA 4NC3A 3RH3A 5B3SC 3VF0A 3NDBB 4O6MA 3RVYA 3ASNC 1A0BA 1PCXA 2XM4A 2W45A 1XZPA 1FFTC 3O39A 2W4BA 3JT1A 4Z9IA 4HFKB 2PF4E 3SXKA 3VRCA 4F4BA 3TJ6A 2FGYA 2GWWA 3HNLA 4N6HA 4OIOF 1YJ9O 4OINF 3CEXA 3VM6A 5AC5A 3CCMO 1OQCA 1MNDA 1RKEB 1Y4CA 1NZEA 1YI2L 1VQ9O 4KBLA 1R4TA 3ABLC 1VQML 1V55C 3JRTA 3FMSA 1RMVA 1C02A 3M15A 1K9MM 3U9MA 2JPUA 1M56C 2EIMC 2WB7A 4BJTA 1GS9A 1HMDA 1Q0FA 2M4EA 3CCRL 2EIJC 1HE1A 2EINC 5TJ5E 3M79A 5E2QA 3AG2C 4JTCB 2XXAA 2B0HA 1RJ9A 4EKWA 3Q7LA 1YI2O 4U5EE 1ZHXA 1OCCC 1QVGK 1Z5ZA 4U5FE 4CSAA 3NMJA 5K0IA 3JSZA 4CJOA 2Q3TA 1JAFA 3CZ6A 5L0CA 1QZXA 5JLIA 1Q81P 1M90M 3IQTA 2P0NA 2Y69C 2HFIA 4A4AA 2NSFA 5CI8A 3G4SL 1GM5A 3O10A 1K04A 4K1OA 4X0RA 5DLJA 3CCVO 1RKEA 3NRHA 3CPWN 1OR2A 1U89A 2GAQA 3DKAA 1SZIA 5EHHA 1FFHA 2W9YA 3U2MA 2QEXL 4MTGA 2IXMA 1MMNA 4Q5SF 5KYNA 3H2VA 4YWQA 2L81A 2R7XA 4JEBA 4ZLDA 1VQ8O 2L7AA 3HTKC 4OD4A 4FESA 3GODA 3W2VA 1D0YA 1VQKL 3W8IA 3CMAO 3KH2A 2RD9A 2NPUA 1VQ5O 1RJ9B 3TOLA 1U6HA 1SMYF 1VQ8L 2NSGA 1FR0A 3OW2N 1WN0A 1R5ID 2YKZA 1A7DA 1HMOA 3AG1C 3JCUQ 3K6BA 3OEOA 3UNGC 3V5XA 4Z9JA 5KYUB 2GDCA 1YJWO 1QKRA 2CW0F 2XS8A 2YZSA 3G4ZA 2QA4O 2LP4A 2PNOA 1M2OA 2OKUA 3LAYA 2L9JA 4NTFA 3T6BA 1YJWL 4I3MA 3ABKC 1HW1A 3M4BA 1EI7A 3CCQO 3CCVL 1ZHWA 1KD1P 1RCPA 3ATPA 1VTMP 4LDKA 4J30B 1T6UA 2A6HF 3RF3A 1Z6AA 3CCJL 1NFOA 2ETSA 1NBBA 3EZHA 1F1MA 1V4AA 1H7IA 5L0IA 2PX0A 2OEVA 3CMAL 4RDAA 1Y6DA 3B0UX 4K0DA 3G6EL 3G71L 1LVKA 4YL3A 1T01A 3CC4L 2HZ8A 3EG9A 4MVRA 1VLSA 3LESA 4DRHB 3HNJA 2A1DD 4YK5A 5IY5C 1VK5A 2PP4A 4E0IA 3B9QA 2OEXA 3EGDA 3C18A 4WJ0A 4D4NA 1HY5A 4DBQA 2R7QA 3F46A 1APCA 3PMRA 4C3BA 5KYXA 3POVA 2DYSC 3NG1A 3RQGA 1HE9A 2OG2A 3AOUA 2B0JA 2GA0A 2LFDA 4IRUA 4JCZA 4MQ9F 4KC9A 4BJ5C 3G4SO 3FXHA 1FNTc 2UUHA 2H7BA 2QE9A 3EZIA 3DI5A 1K40A 1YA9A 4I44A 3I56O 4OD5A 1V74B 2WZGA 1VMAA 5E3CA 2AU5A 3FOPA 4CX9A 1YJ9L 5L0JA 5KYWB 1Q82P 1M2VB 1CGME 3JYHA 4C7OB 3N2ZB 4PJNA 3DE8A 3JZ0A 4FWVA 1MMGA 2AWCA 3ASOC 1RKCA 3K66A 4MVQA 2YLGA 3LJBA 5B1BC 3CAXA 3AQBA 3VYWA 2CGEA 2R9RB 3AJMA 1Q0DA 2YLIA 4LDQA 4N6CA 4EBKA 3BEHA 2BC5A 1H9GA 1BBHA 3SEOA 1VQMO 5T1DB 2IM8A 5BQIA 2YHSA 1K73P 2Y3GA 4J32B 1E2XA 3A11A 2LQGA 3EHMA 3SXYA 3FHDA 2VC9A 3EH1A 3DM9B 4EHPA 4KNWA 3IPMO 1AUEA 1YHQO 1YIJO 2J7PD 4GYTA 2HS5A 1K9MP 3ZQVA 2J9WA 3IQ6A 3LNRA 2A68F 2NUPA 3RQFA 1JR8A 1T5OA 3OWTA 4B6IA 3LS0A 4LERA 1VQLL 1YVIA 2XLWA 4DXWA 3S29A 1JJ2N 2XLEA 1OCOC 5COFA 2XL8A 3FOOA 1D1CA 3IQCA 1MQVA 4ONSA 2MWQA 2JX0A 2OQMA 5DQTA 2M64A 1TKNA 1Q86P 2NG1A 4CS9C 3E70C 5FZTA 5L0DA 1NJIP 3RFYA 1FTSA 1KQSK 1KU2A 3QVZA 3TK0A 2KC3A 4YT8A 3KPHA 4MVUA 3I4UA 3C8ZA 3QVYA 2I15A 3DAGA 1QVXA 2HSQA 3L8JA 1YYXA 1Z7Qc 3ZC4A 3HJCA 4CJGA 3IHUA 2ZXRA 3GORA 2EPOA 4PJJA 4ANJA 3CC7O 2EPNA 3DWWA 1N8RM 3NMIA 3WG7C 3GANA 3U5SA 2EPMX 3K1IC 1KC8P 1O87A 2FAPB 1T6QA 1SR2A 3B0PA 4AK9A 4E7SA 5A6JA 2DGJA 1T9KA 2IXPA 3AG4C 4M63A 1A7VA 2ASRA 2XL6A 1YLMA 1OXKA 3CSKA 3CXCK 1NU7D 1O3UA 2J8WA 3DM5A 1VQPO 2VCBA 1WTYA 3CMEO 2XLHA 1UG7A 3DMDA 1H9TA 3SYNA 4O6YA 3AG3C 3CCLL 3IQ5A 4JE9A 1VQPL 1G5ZA 2KYHA 3ZWIA 3CC4O 4BPMA 1Q7YP 1WATA 3EJNA 3DJNB 5AC4A 5EGYA 4IAOA 1C17M 4PR9A 3FDQA 2HJMA 4W8PA 1BZ4A 4JJFA 1EKYA 3JYYA 2OTLO 3H65A 4U5BE 4EBJA 3KMIA 4BEMJ 3KYJA 2KGOA 5L0HA 3J06A 1YDIA 2AVKA 4R32A 2I8BA 1QVFK 2J9VA 2R03A 3TOMA 2QA4L 3LNMB 1G8XA 3A9CA 1JMWA 2Q4FA 3CCUL 2H8AA 4EIYA 2QTVA 5KYXB 1VYKA 1ORSC 1EQ1A 3C63A 2YL7A 1Q7YM 4IWBA 1BR4A 4C7OA 1E83A 3EG9B 3U0CA 1ZHTA 4DBRA 1NLXA 3QZCA 4PK4A 3M1CB 2YL3A 2FFHA 4YL0A 3C62A 4CDAA 5COMA 4EBBA 1OKKD 2DYRC 3T4RA 2CCYA 3GEHA 4JTAB 4O6NA 2R7RA 3FVYA 1JJ2K 3S9OA 4XPWA 4AE4B 4NY3A 2ICWG 3HLZA 4LDRA 1QLEC 1TWCA 2X51A 3AQCA 3HKKA 3K7DA 4YJWA 1E86A 3GM1A 3O6XA 3CC2L 1L7CA 4ZLCA 2Q9AA 2KK1A 1MMDA 1TQGA 3ITFA 1ORJA 2R05A 3ZDLA 4O7GA 3ZVRA 4DVZA 3EFOB 3LEVA 5B3IA 2KW3C 3MX3A 1OCZC 3SNHA 3NYLA 4BJ6C 5DS6A 3CCSO 3JSEO 4MVZA 4IAQA 2Q9BA 3G4XA 2P7VA 3CCEO 1YIJL 2OJQA 1NG1A 1YHQL 1W2WA 5L0FA 1W2BN 3ABMC 2Z15A 1Q86M 1VQKO 5CI9A 1C03A 4XPYA 2R7WA 4G7ZF 3LLIA 3T9OA 5A6KA 4U5DE 1OCRC 3E9VA 1JPNA 2DI3A 2Q9CA 4CDVA 5A6AA 4JIOA 2R25A 2WZLA 4A2NB 2HV7A 3EGDB 5EK0A 4CIHA 3GEIA 5D91A 3HNIA 1M1KM 4AE4A 1YITO 4MVMA 4JTDB 5E33A 3UR3C 2VB6A 3MYIA 4ULWA 1ORYA 1XZQA 2CNWA 1VQ6O 3X2QC 1VQ7L 2EILC 2AWYA 2H7VC 2J9UA 3T6GB 4AX2A 2G3KA 4I1MA 2KNHA 1D0ZA 2UUIA 2LFFA 3US6A 3FAJA 1N8RP 1JOGA 1S7ZA 3DD7A 2MYSA 3V5ZA 1CPRA 3WODF 4UDVA 4MVOA 5KYYA 3SXMA 1VQ7O 3N0TA 5L3VA 1ST6A 4E0HA 3LEOA 4ER9A 2V26A 2E87A 2YL1A 1D1AA 1LE4A 1JPJA 2AP3A 1L3PA 4KNVA 4YT5A 3RKOF 3CCRO 3I55L 4PFPA 2HV6A 4JVSA 1QVFN 1DOWA 2YVKA 3JTLO 1OKKA 3U3BA 1Q82M 4U5CE 3CPWK 3QW1A 4FX5A 4XPXA 5T3WA 3S84A 2XS1A 2R7UA 4JC7A 3I56L 4QI0A 4YL1A 2BL2A 3B0VC 2LD6A 3CCJO 2VH3A 3R2PA 3LLKA 1ZW2A 3O55A 5KYUA 3TULA 2TMVP 1DOVA 2VASA 3DAFA 1KTMA 3FAPB 1YJGA 4DJ9A 3S90A 1LI5A 4E18A 2JD3A 3QMKA 5JS5A 3CCSL 3SZRA 4PFOA 4FAPB 1CPQA 2ZXOA 4QI2A 3GM3A 1FMVA 1I4YA 2WZFA 1NU9C 4HE8D 1OW6A 3K33A 3OW2K 2LCHA 3ZTMA 4PJLA 1MNEA 4G7OF 2IYLD 2EIKC 2NUTB 4DVYP 1VQ5L 3C8GA 1IZMA 1ZZPA 1ZU5A 3L1MA 1WOLA 4C3DA 2P1AA 1UFBA 1ZU4A 2PBEA 2J45A 1ZW3A 2XL4A 3L0IA 4MVSA 4XWJA 1W2BK 3BRJA 2YEVA 1SF8A 1TFOB 3AGTA 1E84A 3CCQL 5GPGB 2IOQA 3B71A 3WAQA 5HSWA 4OIQF 1VYIA 2F22A 2J46A 2Y3DA 3Q7GA 4DRIB 1YJNL 4GQHA 3C8GB 3F47A 3NYJA 3UGOA 1CGNA 1G4US 3RQEA 3DE9A 4YT4A 1TFKB 2HSBA 3PDMP 2XXAB 2OTLL 2VCAA 2EPKX 2ZPAA 2P61A 2QY9A 4U5GA 2ZXPA 4DRJB 2R7VA 1ZHZA 2XRHA 5BQGA 3PCVA 4ULVA 1WWPA 4N06A 3RIPA 3Q6MA 2A69F 4LACB 4C3EA 1LM3B 3LUTB 1B68A 4YN0B 5T3TA 2P6VA 3EGXB 1IW7F 4NCQA 2D5RB 3V7OA 3I55O 3CCUO 1YZAA 3QTHA 2HUJA 4XTKA 3W4YA 1VB5A 2A6EF 1O5HA 3MFNA 3RW0A 2WVOA 2XLDA 4MTOA 5E3AA 4BJ5A 4YT2A 1NJIM 2Y3BA 3MBGA 1CGOA 2Y39A 4NTAA 3AGUA 4BJ1A 1VQ9L 1BR1A 3ECSA 1U0BB 5BQHA 4G78A 4XEFA 5A6BA 3U3FA 1VQNO 3GM2A 1Q0GA 4GEHA 4QDLA 2ZXWC 2J0WA 3C8GD 1M2VA 3I5PA 4JJGA 1PD0A 5JSLA 1YA7O 1V54C 1ZHYA 3R7CA 1RXQA 4D4XA 4BG0A 3DXJF 5HV9A 1OW7A 1LPEA 2O9XA 2RSEB 1VQOL 2YLDA 3T6JA 3MLGA 1KC8M 3CD6L 2R02A 4IB4A 1OR3A 2QNLA
chains in the Genus database with same CATH topology
1Z3IX 2XSEA 4CS8A 3UGPA 3CCML 4KI2A 2IXNA 4OIPF 1N1CA 2PFDA 2OTJL 1VQLO 5DVWA 1VQ6L 3EFOA 1M57C 4JURI 4JW1A 4PJMA 3S0XA 4K7BA 3S28A 1YITL 2WVQA 3VAYA 3CC2O 2C04A 3Q6NA 3EPVA 1K8AP 2J7PA 5BUOA 3KL4A 4P6IC 5KYYB 3EHNA 4EWCA 3CCEL 3SP1A 1BR2A 1LS1A 2PX3A 3PHF2 2BE5F 3IEEA 5F5HA 2V3CC 1TWGA 2WL8A 3KKBA 1TR2A 4I1OB 2NUPB 1S72L 1KQSN 1VQNL 4BEJA 3N24A 1VQ4O 1Z23A 2KQ9A 1TWAA 2R7SA 2W4MA 1MMAA 5D92A 4DOZA 4Q7CA 3LS1A 3ZSUA 5KYWA 3CD6O 1YJNO 2R7TA 1VQOO 3UMKA 1TWHA 1J8YF 3CCLO 4LLCA 2J0XA 2H7OA 3W2WA 2OCCC 4LLEA 3DZAA 4HFFB 3CMEL 3ZG1A 4BJ6A 1D0XA 4CBEA 3G6EO 3G71O 3OA1A 4O79A 1FMWA 2WVNA 4RBNA 4CS9A 4U5HA 5DQZA 4JZAA 3UMIA 3NKEA 5L3QA 3EH2A 2LSEA 5DS5A 1QVGN 4MNDA 3K1HA 4IJJA 2G3VA 5FCLA 3S27A 5DS4A 2CDQA 1Q81M 1PD1A 2KJGA 1M90P 1WGWA 4G7HF 3NKDA 3L34A 1D1BA 2GFHA 4HEAJ 3DJUB 4RD9A 4W8KA 1LKXA 1VQ4L 3RYLA 3X1OA 2CNWD 1S72O 1J8MF 2C03A 2QEXO 1KD1M 4E7ZA 2Y3HA 1VOMA 5B1AC 3TD7A 3UMHA 2IXOA 3CC7L 3EQLF 4H4KC 4JCHA 2G62A 4XLPF 3EGXA 2OTJO 2R7OA 1M1KP 3I5QA 5F5FA 4CS8C 3CXCN 3CQZA 3NYMA 4CSAC 3W8HA 1K8AM 4CS7A 2NUTA 4XLNF 1ZYRF 1Z63A 4G0HA 4OIRF 1K73M 4Q4ZF 3RH3A 5B3SC 3NDBB 4O6MA 3ASNC 1PCXA 2W45A 1FFTC 3O39A 2W4BA 3JT1A 4HFKB 2PF4E 4F4BA 2FGYA 4OIOF 1YJ9O 4OINF 3CCMO 1MNDA 1NZEA 1YI2L 1VQ9O 4KBLA 3ABLC 1VQML 1V55C 3JRTA 1K9MM 2WB7A 1M56C 2EIMC 4BJTA 2M4EA 3CCRL 2EIJC 2EINC 5E2QA 3AG2C 2XXAA 1RJ9A 3Q7LA 1YI2O 4U5EE 1ZHXA 1OCCC 1QVGK 1Z5ZA 4U5FE 4CSAA 3JSZA 2Q3TA 3CZ6A 1QZXA 1Q81P 1M90M 2Y69C 3G4SL 5CI8A 3CCVO 4X0RA 5DLJA 3NRHA 3CPWN 2QEXL 1SZIA 5EHHA 1FFHA 2W9YA 2IXMA 1MMNA 4Q5SF 5KYNA 4YWQA 2L81A 2R7XA 4ZLDA 1VQ8O 3HTKC 4OD4A 4FESA 3GODA 3W2VA 1D0YA 1VQKL 3W8IA 3CMAO 3KH2A 1VQ5O 1RJ9B 1VQ8L 1SMYF 3OW2N 3AG1C 3JCUQ 3K6BA 3OEOA 3UNGC 5KYUB 1YJWO 2CW0F 2YZSA 2QA4O 3T6BA 1M2OA 3LAYA 2L9JA 1YJWL 4I3MA 3ABKC 3CCQO 3CCVL 1KD1P 1ZHWA 4J30B 2A6HF 1Z6AA 3CCJL 3EZHA 3CMAL 2PX0A 4RDAA 3B0UX 4K0DA 3G6EL 3G71L 1LVKA 3CC4L 3EG9A 3LESA 5IY5C 2A1DD 1VK5A 2PP4A 3B9QA 4WJ0A 3EGDA 4DBQA 2R7QA 3F46A 3PMRA 4C3BA 3POVA 5KYXA 2DYSC 3NG1A 2OG2A 2B0JA 4IRUA 4MQ9F 4BJ5C 4KC9A 3G4SO 2H7BA 3EZIA 4I44A 3I56O 4OD5A 2WZGA 1VMAA 5E3CA 1YJ9L 5KYWB 1Q82P 1M2VB 3JYHA 4C7OB 3N2ZB 4PJNA 4FWVA 1MMGA 3ASOC 3K66A 3LJBA 5B1BC 3AQBA 3VYWA 2CGEA 1VQMO 3SEOA 5T1DB 2YHSA 1K73P 2Y3GA 4J32B 3EHMA 3FHDA 3EH1A 3DM9B 1YHQO 4KNWA 1YIJO 2J7PD 4GYTA 1K9MP 2J9WA 3LNRA 2A68F 2NUPA 4B6IA 3OWTA 3LS0A 4LERA 1VQLL 3S29A 1JJ2N 1OCOC 5DQTA 1D1CA 2MWQA 1TKNA 1Q86P 2NG1A 4CS9C 3E70C 1NJIP 3RFYA 1FTSA 1KQSK 1KU2A 4YT8A 3I4UA 3ZIBA 3DAGA 3ZC4A 3HJCA 2ZXRA 4ANJA 4PJJA 3CC7O 1N8RM 3WG7C 3GANA 3K1IC 1KC8P 1O87A 3B0PA 4AK9A 4E7SA 2DGJA 2IXPA 3AG4C 4M63A 3CSKA 3CXCK 1NU7D 3DM5A 1VQPO 3CMEO 3DMDA 3SYNA 4O6YA 3AG3C 3CCLL 1VQPL 3CC4O 1Q7YP 3EJNA 3DJNB 5EGYA 4IAOA 3FDQA 4JJFA 2OTLO 3H65A 4U5BE 3KMIA 2KGOA 2I8BA 1QVFK 2J9VA 2QA4L 3CCUL 1G8XA 2QTVA 5KYXB 1VYKA 1Q7YM 4IWBA 1BR4A 4C7OA 3EG9B 1ZHTA 4DBRA 4PK4A 3QZCA 4EBBA 3M1CB 1YJNL 2FFHA 1OKKD 2DYRC 3T4RA 2R7RA 4O6NA 3FVYA 1JJ2K 4AE4B 4NY3A 3HLZA 1QLEC 1TWCA 2X51A 3AQCA 3K7DA 4YJWA 3O6XA 3CC2L 4ZLCA 2Q9AA 1MMDA 3ITFA 3ZVRA 4DVZA 4O7GA 3EFOB 3LEVA 2KW3C 3MX3A 1OCZC 3SNHA 3NYLA 4BJ6C 5DS6A 3CCSO 3CCEO 2Q9BA 1YIJL 2P7VA 1NG1A 1YHQL 1W2WA 1W2BN 1Q86M 3ABMC 2Z15A 1VQKO 5CI9A 2R7WA 4G7ZF 3LLIA 4U5DE 1OCRC 3E9VA 1JPNA 2Q9CA 2WZLA 4A2NB 2HV7A 3EGDB 4CIHA 5D91A 1M1KM 4AE4A 1YITO 5E33A 3UR3C 2VB6A 4ULWA 2CNWA 1VQ6O 3X2QC 1VQ7L 2EILC 2J9UA 2H7VC 4AX2A 2G3KA 4I1MA 2KNHA 1D0ZA 1N8RP 3FAJA 3WODF 1S7ZA 3DD7A 2MYSA 5KYYA 1VQ7O 3N0TA 5L3VA 1ST6A 2V26A 2E87A 1D1AA 1JPJA 4KNVA 4YT5A 3RKOF 3CCRO 3I55L 4PFPA 2HV6A 4JVSA 1QVFN 1OKKA 1Q82M 4U5CE 3CPWK 5T3WA 4FX5A 2R7UA 3I56L 4QI0A 3B0VC 3CCJO 2VH3A 3LLKA 5KYUA 2VASA 3DAFA 3CCSL 2JD3A 3QMKA 3SZRA 4PFOA 4QI2A 2ZXOA 1FMVA 2WZFA 1NU9C 4HE8D 3K33A 3OW2K 4PJLA 1MNEA 4G7OF 2IYLD 2EIKC 2NUTB 4DVYP 1VQ5L 1IZMA 1ZU5A 4C3DA 1ZU4A 3L0IA 2J45A 2XL4A 4XWJA 1W2BK 2YEVA 1SF8A 3CCQL 2IOQA 5HSWA 4OIQF 1VYIA 2J46A 2Y3DA 3Q7GA 3F47A 3NYJA 3UGOA 4YT4A 2XXAB 2OTLL 2ZPAA 2QY9A 4U5GA 2ZXPA 2R7VA 1ZHZA 2XRHA 3RIPA 4N06A 3Q6MA 2A69F 4LACB 4C3EA 4YN0B 5T3TA 2P6VA 3EGXB 1IW7F 2D5RB 3V7OA 3I55O 3CCUO 4XTKA 2A6EF 1O5HA 4BJ5A 2WVOA 4YT2A 5E3AA 1NJIM 2Y3BA 4BJ1A 2Y39A 1VQ9L 1BR1A 3ECSA 1VQNO 4GEHA 4QDLA 2ZXWC 2J0WA 3I5PA 1M2VA 4JJGA 1PD0A 1V54C 1ZHYA 4BG0A 3DXJF 2O9XA 1VQOL 1KC8M 3T6JA 3MLGA 3CD6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ0 A;  5FCL A;  5DS4 A;  4N06 A;  2YZS A;  4QDL A;  4W8K A;  4XTK A;  3GOD A;  5DS5 A;  5DQZ A;  3NKD A;  4P6I C;  5DQT A;  3NKE A;  5DLJ A;  5DS6 A; 
#chains in the Genus database with same CATH topology
 4JRZ A;  2KSF A;  2Q7R A;  1Z3I X;  3ZIB A;  2XSE A;  4CS8 A;  1T6I A;  1AEP A;  5JP7 A;  3UGP A;  3CCM L;  4KI2 A;  4CIP A;  2IXN A;  4OIP F;  1N1C A;  4AL0 A;  2Q00 A;  2PFD A;  2OTJ L;  4EUK B;  1YAU O;  5DVW A;  1VQL O;  1VQ6 L;  3EFO A;  1M57 C;  1YAR O;  1YZC A;  4JUR I;  4JW1 A;  4PJM A;  3S0X A;  2YQY A;  2YWA A;  4K7B A;  3S28 A;  1YIT L;  1A7E A;  4U9E A;  2WVQ A;  5A69 A;  3VAY A;  2QLA A;  2ZD9 A;  2XLO A;  3CC2 O;  1ZVZ A;  5COG A;  2C04 A;  4E17 A;  3MYF A;  1Q0M A;  3Q6N A;  3H2U A;  256B A;  3EPV A;  1K8A P;  2L6F A;  4JEA A;  5JRA A;  1I5N A;  2J7P A;  1OXB A;  4J7T A;  4U9D A;  5BUO A;  4J7Y A;  3KL4 A;  4JKV A;  4N4W A;  4P6I C;  5KYY B;  1QSP A;  3EHN A;  4XEV A;  4EWC A;  3CCE L;  3SP1 A;  1BR2 A;  1G4W R;  1NFN A;  3GEE A;  1LS1 A;  3RVZ A;  2PX3 A;  3GWN A;  3PHF 2;  2BE5 F;  2CYD A;  2QUP A;  1GQA A;  3IEE A;  3M4C A;  4MW3 A;  1YYJ A;  4XEK A;  5F5H A;  2V3C C;  1TWG A;  1K05 A;  2WL8 A;  3JRM O;  3KKB A;  1TR2 A;  4I1O B;  2NUP B;  1AVO B;  1S72 L;  1KQS N;  1VQN L;  4BEJ A;  3N24 A;  4MTF A;  3TQO A;  1GGQ A;  3CME L;  1VQ4 O;  1Z23 A;  1QQ3 A;  2KQ9 A;  1TWA A;  1LI7 A;  2R7S A;  2D4U A;  2W4M A;  1MMA A;  4H54 A;  5D92 A;  4DOZ A;  4P9F A;  4MW8 A;  1SYQ A;  4Q7C A;  3LS1 A;  3ZSU A;  2YRF A;  5KYW A;  2A0B A;  1YJN O;  2R7T A;  3CD6 O;  1VQO O;  3U9J A;  3UMK A;  1TWH A;  3L8I A;  1J8Y F;  5JUA A;  2X0C A;  3U8P A;  2L6H A;  4AL1 A;  3CCL O;  4LLC A;  2J0X A;  2VCC A;  4CDY A;  2J9B A;  2H7O A;  3W2W A;  2HMZ A;  2OCC C;  1S05 A;  4LLE A;  3DZA A;  4HFF B;  3SXZ A;  3V5Y A;  3ZG1 A;  5JVE A;  4NQF A;  4BJ6 A;  1D0X A;  4PAC A;  4P9T A;  4CBE A;  3G6E O;  3G71 O;  1KNY A;  3OA1 A;  4O79 A;  1FMW A;  3U2L A;  2WVN A;  2OJE D;  2LK4 A;  4RBN A;  2DB4 A;  4CS9 A;  3ZQY A;  1FAP B;  3ZTZ A;  4NTB A;  4U5H A;  5DQZ A;  4JZA A;  1WAS A;  3UMI A;  3NKE A;  2IBF A;  5L3Q A;  3EH2 A;  2YL0 A;  1JRA A;  2LSE A;  5DS5 A;  3B29 A;  5JT4 A;  2XLM A;  3HNK A;  4MND A;  3K1H A;  4IJJ A;  2G3V A;  1QVG N;  1M6T A;  4Z9H A;  5FCL A;  3S27 A;  5DS4 A;  2CDQ A;  1Q81 M;  2KJG A;  1OW8 A;  1H6G A;  1PD1 A;  4L6R A;  1M90 P;  1WGW A;  2EPL X;  4G7H F;  3NKD A;  1NSG B;  3K1I A;  1QPU A;  3C7J A;  3L34 A;  1D1B A;  2HMQ A;  3U8V A;  5AGF A;  2GFH A;  2HJ3 A;  1XWJ A;  3DJU B;  4HEA J;  4MS2 A;  4RD9 A;  1LKX A;  4W8K A;  1LE2 A;  4WGY A;  1VQ4 L;  1I4Z A;  3RYL A;  3X1O A;  1VLT A;  2A0U A;  4WGZ A;  1PV3 A;  2CNW D;  1S72 O;  2L6G A;  1J8M F;  1LIH A;  2C03 A;  3NMK A;  2QEX O;  1KD1 M;  4E7Z A;  2Y3H A;  1VOM A;  2OOC A;  2OU6 A;  5B1A C;  3TD7 A;  3UMH A;  2MHR A;  2IXO A;  3CC7 L;  1EA8 A;  1Q0K A;  2HKV A;  3EQL F;  4H4K C;  2G62 A;  2XM0 A;  4JCH A;  3KYI A;  3TJ5 A;  4XLP F;  3EGX A;  1A41 A;  2OTJ O;  3QW0 A;  2R7O A;  3GWL A;  5A6B D;  1M1K P;  3I5Q A;  5F5F A;  4CS8 C;  5L0G A;  3CXC N;  3CQZ A;  3NYM A;  3WHN A;  4CSA C;  4IGG A;  3G50 A;  4IAR A;  3W8H A;  4XQ1 A;  1K8A M;  4CS7 A;  4WAB A;  2NUT A;  2XLV A;  4XLN F;  1ZYR F;  1E85 A;  1HW2 A;  5CIV A;  1Z63 A;  5F28 E;  1BDJ B;  4G0H A;  4OIR F;  1K73 M;  4Q4Z F;  1LS4 A;  2LIG A;  4NC3 A;  3RH3 A;  5B3S C;  3VF0 A;  3NDB B;  4O6M A;  3RVY A;  3ASN C;  1A0B A;  1PCX A;  2XM4 A;  2W45 A;  1XZP A;  1FFT C;  3O39 A;  2W4B A;  3JT1 A;  4Z9I A;  4HFK B;  2PF4 E;  3SXK A;  3VRC A;  4F4B A;  3TJ6 A;  2FGY A;  2GWW A;  3HNL A;  4N6H A;  4OIO F;  1YJ9 O;  4OIN F;  3CEX A;  3VM6 A;  5AC5 A;  3CCM O;  1OQC A;  1MND A;  1RKE B;  1Y4C A;  1NZE A;  1YI2 L;  1VQ9 O;  4KBL A;  1R4T A;  3ABL C;  1VQM L;  1V55 C;  3JRT A;  3FMS A;  1RMV A;  1C02 A;  3M15 A;  1K9M M;  3U9M A;  2JPU A;  1M56 C;  2EIM C;  2WB7 A;  4BJT A;  1GS9 A;  1HMD A;  1Q0F A;  2M4E A;  3CCR L;  2EIJ C;  1HE1 A;  2EIN C;  5TJ5 E;  3M79 A;  5E2Q A;  3AG2 C;  4JTC B;  2XXA A;  2B0H A;  1RJ9 A;  4EKW A;  3Q7L A;  1YI2 O;  4U5E E;  1ZHX A;  1OCC C;  1QVG K;  1Z5Z A;  4U5F E;  4CSA A;  3NMJ A;  5K0I A;  3JSZ A;  4CJO A;  2Q3T A;  1JAF A;  3CZ6 A;  5L0C A;  1QZX A;  5JLI A;  1Q81 P;  1M90 M;  3IQT A;  2P0N A;  2Y69 C;  2HFI A;  4A4A A;  2NSF A;  5CI8 A;  3G4S L;  1GM5 A;  3O10 A;  1K04 A;  4K1O A;  4X0R A;  5DLJ A;  3CCV O;  1RKE A;  3NRH A;  3CPW N;  1OR2 A;  1U89 A;  2GAQ A;  3DKA A;  1SZI A;  5EHH A;  1FFH A;  2W9Y A;  3U2M A;  2QEX L;  4MTG A;  2IXM A;  1MMN A;  4Q5S F;  5KYN A;  3H2V A;  4YWQ A;  2L81 A;  2R7X A;  4JEB A;  4ZLD A;  1VQ8 O;  2L7A A;  3HTK C;  4OD4 A;  4FES A;  3GOD A;  3W2V A;  1D0Y A;  1VQK L;  3W8I A;  3CMA O;  3KH2 A;  2RD9 A;  2NPU A;  1VQ5 O;  1RJ9 B;  3TOL A;  1U6H A;  1SMY F;  1VQ8 L;  2NSG A;  1FR0 A;  3OW2 N;  1WN0 A;  1R5I D;  2YKZ A;  1A7D A;  1HMO A;  3AG1 C;  3JCU Q;  3K6B A;  3OEO A;  3UNG C;  3V5X A;  4Z9J A;  5KYU B;  2GDC A;  1YJW O;  1QKR A;  2CW0 F;  2XS8 A;  2YZS A;  3G4Z A;  2QA4 O;  2LP4 A;  2PNO A;  1M2O A;  2OKU A;  3LAY A;  2L9J A;  4NTF A;  3T6B A;  1YJW L;  4I3M A;  3ABK C;  1HW1 A;  3M4B A;  1EI7 A;  3CCQ O;  3CCV L;  1ZHW A;  1KD1 P;  1RCP A;  3ATP A;  1VTM P;  4LDK A;  4J30 B;  1T6U A;  2A6H F;  3RF3 A;  1Z6A A;  3CCJ L;  1NFO A;  2ETS A;  1NBB A;  3EZH A;  1F1M A;  1V4A A;  1H7I A;  5L0I A;  2PX0 A;  2OEV A;  3CMA L;  4RDA A;  1Y6D A;  3B0U X;  4K0D A;  3G6E L;  3G71 L;  1LVK A;  4YL3 A;  1T01 A;  3CC4 L;  2HZ8 A;  3EG9 A;  4MVR A;  1VLS A;  3LES A;  4DRH B;  3HNJ A;  2A1D D;  4YK5 A;  5IY5 C;  1VK5 A;  2PP4 A;  4E0I A;  3B9Q A;  2OEX A;  3EGD A;  3C18 A;  4WJ0 A;  4D4N A;  1HY5 A;  4DBQ A;  2R7Q A;  3F46 A;  1APC A;  3PMR A;  4C3B A;  5KYX A;  3POV A;  2DYS C;  3NG1 A;  3RQG A;  1HE9 A;  2OG2 A;  3AOU A;  2B0J A;  2GA0 A;  2LFD A;  4IRU A;  4JCZ A;  4MQ9 F;  4KC9 A;  4BJ5 C;  3G4S O;  3FXH A;  1FNT c;  2UUH A;  2H7B A;  2QE9 A;  3EZI A;  3DI5 A;  1K40 A;  1YA9 A;  4I44 A;  3I56 O;  4OD5 A;  1V74 B;  2WZG A;  1VMA A;  5E3C A;  2AU5 A;  3FOP A;  4CX9 A;  1YJ9 L;  5L0J A;  5KYW B;  1Q82 P;  1M2V B;  1CGM E;  3JYH A;  4C7O B;  3N2Z B;  4PJN A;  3DE8 A;  3JZ0 A;  4FWV A;  1MMG A;  2AWC A;  3ASO C;  1RKC A;  3K66 A;  4MVQ A;  2YLG A;  3LJB A;  5B1B C;  3CAX A;  3AQB A;  3VYW A;  2CGE A;  2R9R B;  3AJM A;  1Q0D A;  2YLI A;  4LDQ A;  4N6C A;  4EBK A;  3BEH A;  2BC5 A;  1H9G A;  1BBH A;  3SEO A;  1VQM O;  5T1D B;  2IM8 A;  5BQI A;  2YHS A;  1K73 P;  2Y3G A;  4J32 B;  1E2X A;  3A11 A;  2LQG A;  3EHM A;  3SXY A;  3FHD A;  2VC9 A;  3EH1 A;  3DM9 B;  4EHP A;  4KNW A;  3IPM O;  1AUE A;  1YHQ O;  1YIJ O;  2J7P D;  4GYT A;  2HS5 A;  1K9M P;  3ZQV A;  2J9W A;  3IQ6 A;  3LNR A;  2A68 F;  2NUP A;  3RQF A;  1JR8 A;  1T5O A;  3OWT A;  4B6I A;  3LS0 A;  4LER A;  1VQL L;  1YVI A;  2XLW A;  4DXW A;  3S29 A;  1JJ2 N;  2XLE A;  1OCO C;  5COF A;  2XL8 A;  3FOO A;  1D1C A;  3IQC A;  1MQV A;  4ONS A;  2MWQ A;  2JX0 A;  2OQM A;  5DQT A;  2M64 A;  1TKN A;  1Q86 P;  2NG1 A;  4CS9 C;  3E70 C;  5FZT A;  5L0D A;  1NJI P;  3RFY A;  1FTS A;  1KQS K;  1KU2 A;  3QVZ A;  3TK0 A;  2KC3 A;  4YT8 A;  3KPH A;  4MVU A;  3I4U A;  3C8Z A;  3QVY A;  2I15 A;  3DAG A;  1QVX A;  2HSQ A;  3L8J A;  1YYX A;  1Z7Q c;  3ZC4 A;  3HJC A;  4CJG A;  3IHU A;  2ZXR A;  3GOR A;  2EPO A;  4PJJ A;  4ANJ A;  3CC7 O;  2EPN A;  3DWW A;  1N8R M;  3NMI A;  3WG7 C;  3GAN A;  3U5S A;  2EPM X;  3K1I C;  1KC8 P;  1O87 A;  2FAP B;  1T6Q A;  1SR2 A;  3B0P A;  4AK9 A;  4E7S A;  5A6J A;  2DGJ A;  1T9K A;  2IXP A;  3AG4 C;  4M63 A;  1A7V A;  2ASR A;  2XL6 A;  1YLM A;  1OXK A;  3CSK A;  3CXC K;  1NU7 D;  1O3U A;  2J8W A;  3DM5 A;  1VQP O;  2VCB A;  1WTY A;  3CME O;  2XLH A;  1UG7 A;  3DMD A;  1H9T A;  3SYN A;  4O6Y A;  3AG3 C;  3CCL L;  3IQ5 A;  4JE9 A;  1VQP L;  1G5Z A;  2KYH A;  3ZWI A;  3CC4 O;  4BPM A;  1Q7Y P;  1WAT A;  3EJN A;  3DJN B;  5AC4 A;  5EGY A;  4IAO A;  1C17 M;  4PR9 A;  3FDQ A;  2HJM A;  4W8P A;  1BZ4 A;  4JJF A;  1EKY A;  3JYY A;  2OTL O;  3H65 A;  4U5B E;  4EBJ A;  3KMI A;  4BEM J;  3KYJ A;  2KGO A;  5L0H A;  3J06 A;  1YDI A;  2AVK A;  4R32 A;  2I8B A;  1QVF K;  2J9V A;  2R03 A;  3TOM A;  2QA4 L;  3LNM B;  1G8X A;  3A9C A;  1JMW A;  2Q4F A;  3CCU L;  2H8A A;  4EIY A;  2QTV A;  5KYX B;  1VYK A;  1ORS C;  1EQ1 A;  3C63 A;  2YL7 A;  1Q7Y M;  4IWB A;  1BR4 A;  4C7O A;  1E83 A;  3EG9 B;  3U0C A;  1ZHT A;  4DBR A;  1NLX A;  3QZC A;  4PK4 A;  3M1C B;  2YL3 A;  2FFH A;  4YL0 A;  3C62 A;  4CDA A;  5COM A;  4EBB A;  1OKK D;  2DYR C;  3T4R A;  2CCY A;  3GEH A;  4JTA B;  4O6N A;  2R7R A;  3FVY A;  1JJ2 K;  3S9O A;  4XPW A;  4AE4 B;  4NY3 A;  2ICW G;  3HLZ A;  4LDR A;  1QLE C;  1TWC A;  2X51 A;  3AQC A;  3HKK A;  3K7D A;  4YJW A;  1E86 A;  3GM1 A;  3O6X A;  3CC2 L;  1L7C A;  4ZLC A;  2Q9A A;  2KK1 A;  1MMD A;  1TQG A;  3ITF A;  1ORJ A;  2R05 A;  3ZDL A;  4O7G A;  3ZVR A;  4DVZ A;  3EFO B;  3LEV A;  5B3I A;  2KW3 C;  3MX3 A;  1OCZ C;  3SNH A;  3NYL A;  4BJ6 C;  5DS6 A;  3CCS O;  3JSE O;  4MVZ A;  4IAQ A;  2Q9B A;  3G4X A;  2P7V A;  3CCE O;  1YIJ L;  2OJQ A;  1NG1 A;  1YHQ L;  1W2W A;  5L0F A;  1W2B N;  3ABM C;  2Z15 A;  1Q86 M;  1VQK O;  5CI9 A;  1C03 A;  4XPY A;  2R7W A;  4G7Z F;  3LLI A;  3T9O A;  5A6K A;  4U5D E;  1OCR C;  3E9V A;  1JPN A;  2DI3 A;  2Q9C A;  4CDV A;  5A6A A;  4JIO A;  2R25 A;  2WZL A;  4A2N B;  2HV7 A;  3EGD B;  5EK0 A;  4CIH A;  3GEI A;  5D91 A;  3HNI A;  1M1K M;  4AE4 A;  1YIT O;  4MVM A;  4JTD B;  5E33 A;  3UR3 C;  2VB6 A;  3MYI A;  4ULW A;  1ORY A;  1XZQ A;  2CNW A;  1VQ6 O;  3X2Q C;  1VQ7 L;  2EIL C;  2AWY A;  2H7V C;  2J9U A;  3T6G B;  4AX2 A;  2G3K A;  4I1M A;  2KNH A;  1D0Z A;  2UUI A;  2LFF A;  3US6 A;  3FAJ A;  1N8R P;  1JOG A;  1S7Z A;  3DD7 A;  2MYS A;  3V5Z A;  1CPR A;  3WOD F;  4UDV A;  4MVO A;  5KYY A;  3SXM A;  1VQ7 O;  3N0T A;  5L3V A;  1ST6 A;  4E0H A;  3LEO A;  4ER9 A;  2V26 A;  2E87 A;  2YL1 A;  1D1A A;  1LE4 A;  1JPJ A;  2AP3 A;  1L3P A;  4KNV A;  4YT5 A;  3RKO F;  3CCR O;  3I55 L;  4PFP A;  2HV6 A;  4JVS A;  1QVF N;  1DOW A;  2YVK A;  3JTL O;  1OKK A;  3U3B A;  1Q82 M;  4U5C E;  3CPW K;  3QW1 A;  4FX5 A;  4XPX A;  5T3W A;  3S84 A;  2XS1 A;  2R7U A;  4JC7 A;  3I56 L;  4QI0 A;  4YL1 A;  2BL2 A;  3B0V C;  2LD6 A;  3CCJ O;  2VH3 A;  3R2P A;  3LLK A;  1ZW2 A;  3O55 A;  5KYU A;  3TUL A;  2TMV P;  1DOV A;  2VAS A;  3DAF A;  1KTM A;  3FAP B;  1YJG A;  4DJ9 A;  3S90 A;  1LI5 A;  4E18 A;  2JD3 A;  3QMK A;  5JS5 A;  3CCS L;  3SZR A;  4PFO A;  4FAP B;  1CPQ A;  2ZXO A;  4QI2 A;  3GM3 A;  1FMV A;  1I4Y A;  2WZF A;  1NU9 C;  4HE8 D;  1OW6 A;  3K33 A;  3OW2 K;  2LCH A;  3ZTM A;  4PJL A;  1MNE A;  4G7O F;  2IYL D;  2EIK C;  2NUT B;  4DVY P;  1VQ5 L;  3C8G A;  1IZM A;  1ZZP A;  1ZU5 A;  3L1M A;  1WOL A;  4C3D A;  2P1A A;  1UFB A;  1ZU4 A;  2PBE A;  2J45 A;  1ZW3 A;  2XL4 A;  3L0I A;  4MVS A;  4XWJ A;  1W2B K;  3BRJ A;  2YEV A;  1SF8 A;  1TFO B;  3AGT A;  1E84 A;  3CCQ L;  5GPG B;  2IOQ A;  3B71 A;  3WAQ A;  5HSW A;  4OIQ F;  1VYI A;  2F22 A;  2J46 A;  2Y3D A;  3Q7G A;  4DRI B;  1YJN L;  4GQH A;  3C8G B;  3F47 A;  3NYJ A;  3UGO A;  1CGN A;  1G4U S;  3RQE A;  3DE9 A;  4YT4 A;  1TFK B;  2HSB A;  3PDM P;  2XXA B;  2OTL L;  2VCA A;  2EPK X;  2ZPA A;  2P61 A;  2QY9 A;  4U5G A;  2ZXP A;  4DRJ B;  2R7V A;  1ZHZ A;  2XRH A;  5BQG A;  3PCV A;  4ULV A;  1WWP A;  4N06 A;  3RIP A;  3Q6M A;  2A69 F;  4LAC B;  4C3E A;  1LM3 B;  3LUT B;  1B68 A;  4YN0 B;  5T3T A;  2P6V A;  3EGX B;  1IW7 F;  4NCQ A;  2D5R B;  3V7O A;  3I55 O;  3CCU O;  1YZA A;  3QTH A;  2HUJ A;  4XTK A;  3W4Y A;  1VB5 A;  2A6E F;  1O5H A;  3MFN A;  3RW0 A;  2WVO A;  2XLD A;  4MTO A;  5E3A A;  4BJ5 A;  4YT2 A;  1NJI M;  2Y3B A;  3MBG A;  1CGO A;  2Y39 A;  4NTA A;  3AGU A;  4BJ1 A;  1VQ9 L;  1BR1 A;  3ECS A;  1U0B B;  5BQH A;  4G78 A;  4XEF A;  5A6B A;  3U3F A;  1VQN O;  3GM2 A;  1Q0G A;  4GEH A;  4QDL A;  2ZXW C;  2J0W A;  3C8G D;  1M2V A;  3I5P A;  4JJG A;  1PD0 A;  5JSL A;  1YA7 O;  1V54 C;  1ZHY A;  3R7C A;  1RXQ A;  4D4X A;  4BG0 A;  3DXJ F;  5HV9 A;  1OW7 A;  1LPE A;  2O9X A;  2RSE B;  1VQO L;  2YLD A;  3T6J A;  3MLG A;  1KC8 M;  3CD6 L;  2R02 A;  4IB4 A;  1OR3 A;  2QNL A; 
#chains in the Genus database with same CATH homology
 1Z3I X;  2XSE A;  4CS8 A;  3UGP A;  3CCM L;  4KI2 A;  2IXN A;  4OIP F;  1N1C A;  2PFD A;  2OTJ L;  1VQL O;  5DVW A;  1VQ6 L;  3EFO A;  1M57 C;  4JUR I;  4JW1 A;  4PJM A;  3S0X A;  4K7B A;  3S28 A;  1YIT L;  2WVQ A;  3VAY A;  3CC2 O;  2C04 A;  3Q6N A;  3EPV A;  1K8A P;  2J7P A;  5BUO A;  3KL4 A;  4P6I C;  5KYY B;  3EHN A;  4EWC A;  3CCE L;  3SP1 A;  1BR2 A;  1LS1 A;  2PX3 A;  3PHF 2;  2BE5 F;  3IEE A;  5F5H A;  2V3C C;  1TWG A;  2WL8 A;  3KKB A;  1TR2 A;  4I1O B;  2NUP B;  1S72 L;  1KQS N;  1VQN L;  4BEJ A;  3N24 A;  1VQ4 O;  1Z23 A;  2KQ9 A;  1TWA A;  2R7S A;  2W4M A;  1MMA A;  5D92 A;  4DOZ A;  4Q7C A;  3LS1 A;  3ZSU A;  5KYW A;  3CD6 O;  1YJN O;  2R7T A;  1VQO O;  3UMK A;  1TWH A;  1J8Y F;  3CCL O;  4LLC A;  2J0X A;  2H7O A;  3W2W A;  2OCC C;  4LLE A;  3DZA A;  4HFF B;  3CME L;  3ZG1 A;  4BJ6 A;  1D0X A;  4CBE A;  3G6E O;  3G71 O;  3OA1 A;  4O79 A;  1FMW A;  2WVN A;  4RBN A;  4CS9 A;  4U5H A;  5DQZ A;  4JZA A;  3UMI A;  3NKE A;  5L3Q A;  3EH2 A;  2LSE A;  5DS5 A;  1QVG N;  4MND A;  3K1H A;  4IJJ A;  2G3V A;  5FCL A;  3S27 A;  5DS4 A;  2CDQ A;  1Q81 M;  1PD1 A;  2KJG A;  1M90 P;  1WGW A;  4G7H F;  3NKD A;  3L34 A;  1D1B A;  2GFH A;  4HEA J;  3DJU B;  4RD9 A;  4W8K A;  1LKX A;  1VQ4 L;  3RYL A;  3X1O A;  2CNW D;  1S72 O;  1J8M F;  2C03 A;  2QEX O;  1KD1 M;  4E7Z A;  2Y3H A;  1VOM A;  5B1A C;  3TD7 A;  3UMH A;  2IXO A;  3CC7 L;  3EQL F;  4H4K C;  4JCH A;  2G62 A;  4XLP F;  3EGX A;  2OTJ O;  2R7O A;  1M1K P;  3I5Q A;  5F5F A;  4CS8 C;  3CXC N;  3CQZ A;  3NYM A;  4CSA C;  3W8H A;  1K8A M;  4CS7 A;  2NUT A;  4XLN F;  1ZYR F;  1Z63 A;  4G0H A;  4OIR F;  1K73 M;  4Q4Z F;  3RH3 A;  5B3S C;  3NDB B;  4O6M A;  3ASN C;  1PCX A;  2W45 A;  1FFT C;  3O39 A;  2W4B A;  3JT1 A;  4HFK B;  2PF4 E;  4F4B A;  2FGY A;  4OIO F;  1YJ9 O;  4OIN F;  3CCM O;  1MND A;  1NZE A;  1YI2 L;  1VQ9 O;  4KBL A;  3ABL C;  1VQM L;  1V55 C;  3JRT A;  1K9M M;  2WB7 A;  1M56 C;  2EIM C;  4BJT A;  2M4E A;  3CCR L;  2EIJ C;  2EIN C;  5E2Q A;  3AG2 C;  2XXA A;  1RJ9 A;  3Q7L A;  1YI2 O;  4U5E E;  1ZHX A;  1OCC C;  1QVG K;  1Z5Z A;  4U5F E;  4CSA A;  3JSZ A;  2Q3T A;  3CZ6 A;  1QZX A;  1Q81 P;  1M90 M;  2Y69 C;  3G4S L;  5CI8 A;  3CCV O;  4X0R A;  5DLJ A;  3NRH A;  3CPW N;  2QEX L;  1SZI A;  5EHH A;  1FFH A;  2W9Y A;  2IXM A;  1MMN A;  4Q5S F;  5KYN A;  4YWQ A;  2L81 A;  2R7X A;  4ZLD A;  1VQ8 O;  3HTK C;  4OD4 A;  4FES A;  3GOD A;  3W2V A;  1D0Y A;  1VQK L;  3W8I A;  3CMA O;  3KH2 A;  1VQ5 O;  1RJ9 B;  1VQ8 L;  1SMY F;  3OW2 N;  3AG1 C;  3JCU Q;  3K6B A;  3OEO A;  3UNG C;  5KYU B;  1YJW O;  2CW0 F;  2YZS A;  2QA4 O;  3T6B A;  1M2O A;  3LAY A;  2L9J A;  1YJW L;  4I3M A;  3ABK C;  3CCQ O;  3CCV L;  1KD1 P;  1ZHW A;  4J30 B;  2A6H F;  1Z6A A;  3CCJ L;  3EZH A;  3CMA L;  2PX0 A;  4RDA A;  3B0U X;  4K0D A;  3G6E L;  3G71 L;  1LVK A;  3CC4 L;  3EG9 A;  3LES A;  5IY5 C;  2A1D D;  1VK5 A;  2PP4 A;  3B9Q A;  4WJ0 A;  3EGD A;  4DBQ A;  2R7Q A;  3F46 A;  3PMR A;  4C3B A;  3POV A;  5KYX A;  2DYS C;  3NG1 A;  2OG2 A;  2B0J A;  4IRU A;  4MQ9 F;  4BJ5 C;  4KC9 A;  3G4S O;  2H7B A;  3EZI A;  4I44 A;  3I56 O;  4OD5 A;  2WZG A;  1VMA A;  5E3C A;  1YJ9 L;  5KYW B;  1Q82 P;  1M2V B;  3JYH A;  4C7O B;  3N2Z B;  4PJN A;  4FWV A;  1MMG A;  3ASO C;  3K66 A;  3LJB A;  5B1B C;  3AQB A;  3VYW A;  2CGE A;  1VQM O;  3SEO A;  5T1D B;  2YHS A;  1K73 P;  2Y3G A;  4J32 B;  3EHM A;  3FHD A;  3EH1 A;  3DM9 B;  1YHQ O;  4KNW A;  1YIJ O;  2J7P D;  4GYT A;  1K9M P;  2J9W A;  3LNR A;  2A68 F;  2NUP A;  4B6I A;  3OWT A;  3LS0 A;  4LER A;  1VQL L;  3S29 A;  1JJ2 N;  1OCO C;  5DQT A;  1D1C A;  2MWQ A;  1TKN A;  1Q86 P;  2NG1 A;  4CS9 C;  3E70 C;  1NJI P;  3RFY A;  1FTS A;  1KQS K;  1KU2 A;  4YT8 A;  3I4U A;  3ZIB A;  3DAG A;  3ZC4 A;  3HJC A;  2ZXR A;  4ANJ A;  4PJJ A;  3CC7 O;  1N8R M;  3WG7 C;  3GAN A;  3K1I C;  1KC8 P;  1O87 A;  3B0P A;  4AK9 A;  4E7S A;  2DGJ A;  2IXP A;  3AG4 C;  4M63 A;  3CSK A;  3CXC K;  1NU7 D;  3DM5 A;  1VQP O;  3CME O;  3DMD A;  3SYN A;  4O6Y A;  3AG3 C;  3CCL L;  1VQP L;  3CC4 O;  1Q7Y P;  3EJN A;  3DJN B;  5EGY A;  4IAO A;  3FDQ A;  4JJF A;  2OTL O;  3H65 A;  4U5B E;  3KMI A;  2KGO A;  2I8B A;  1QVF K;  2J9V A;  2QA4 L;  3CCU L;  1G8X A;  2QTV A;  5KYX B;  1VYK A;  1Q7Y M;  4IWB A;  1BR4 A;  4C7O A;  3EG9 B;  1ZHT A;  4DBR A;  4PK4 A;  3QZC A;  4EBB A;  3M1C B;  1YJN L;  2FFH A;  1OKK D;  2DYR C;  3T4R A;  2R7R A;  4O6N A;  3FVY A;  1JJ2 K;  4AE4 B;  4NY3 A;  3HLZ A;  1QLE C;  1TWC A;  2X51 A;  3AQC A;  3K7D A;  4YJW A;  3O6X A;  3CC2 L;  4ZLC A;  2Q9A A;  1MMD A;  3ITF A;  3ZVR A;  4DVZ A;  4O7G A;  3EFO B;  3LEV A;  2KW3 C;  3MX3 A;  1OCZ C;  3SNH A;  3NYL A;  4BJ6 C;  5DS6 A;  3CCS O;  3CCE O;  2Q9B A;  1YIJ L;  2P7V A;  1NG1 A;  1YHQ L;  1W2W A;  1W2B N;  1Q86 M;  3ABM C;  2Z15 A;  1VQK O;  5CI9 A;  2R7W A;  4G7Z F;  3LLI A;  4U5D E;  1OCR C;  3E9V A;  1JPN A;  2Q9C A;  2WZL A;  4A2N B;  2HV7 A;  3EGD B;  4CIH A;  5D91 A;  1M1K M;  4AE4 A;  1YIT O;  5E33 A;  3UR3 C;  2VB6 A;  4ULW A;  2CNW A;  1VQ6 O;  3X2Q C;  1VQ7 L;  2EIL C;  2J9U A;  2H7V C;  4AX2 A;  2G3K A;  4I1M A;  2KNH A;  1D0Z A;  1N8R P;  3FAJ A;  3WOD F;  1S7Z A;  3DD7 A;  2MYS A;  5KYY A;  1VQ7 O;  3N0T A;  5L3V A;  1ST6 A;  2V26 A;  2E87 A;  1D1A A;  1JPJ A;  4KNV A;  4YT5 A;  3RKO F;  3CCR O;  3I55 L;  4PFP A;  2HV6 A;  4JVS A;  1QVF N;  1OKK A;  1Q82 M;  4U5C E;  3CPW K;  5T3W A;  4FX5 A;  2R7U A;  3I56 L;  4QI0 A;  3B0V C;  3CCJ O;  2VH3 A;  3LLK A;  5KYU A;  2VAS A;  3DAF A;  3CCS L;  2JD3 A;  3QMK A;  3SZR A;  4PFO A;  4QI2 A;  2ZXO A;  1FMV A;  2WZF A;  1NU9 C;  4HE8 D;  3K33 A;  3OW2 K;  4PJL A;  1MNE A;  4G7O F;  2IYL D;  2EIK C;  2NUT B;  4DVY P;  1VQ5 L;  1IZM A;  1ZU5 A;  4C3D A;  1ZU4 A;  3L0I A;  2J45 A;  2XL4 A;  4XWJ A;  1W2B K;  2YEV A;  1SF8 A;  3CCQ L;  2IOQ A;  5HSW A;  4OIQ F;  1VYI A;  2J46 A;  2Y3D A;  3Q7G A;  3F47 A;  3NYJ A;  3UGO A;  4YT4 A;  2XXA B;  2OTL L;  2ZPA A;  2QY9 A;  4U5G A;  2ZXP A;  2R7V A;  1ZHZ A;  2XRH A;  3RIP A;  4N06 A;  3Q6M A;  2A69 F;  4LAC B;  4C3E A;  4YN0 B;  5T3T A;  2P6V A;  3EGX B;  1IW7 F;  2D5R B;  3V7O A;  3I55 O;  3CCU O;  4XTK A;  2A6E F;  1O5H A;  4BJ5 A;  2WVO A;  4YT2 A;  5E3A A;  1NJI M;  2Y3B A;  4BJ1 A;  2Y39 A;  1VQ9 L;  1BR1 A;  3ECS A;  1VQN O;  4GEH A;  4QDL A;  2ZXW C;  2J0W A;  3I5P A;  1M2V A;  4JJG A;  1PD0 A;  1V54 C;  1ZHY A;  4BG0 A;  3DXJ F;  2O9X A;  1VQO L;  1KC8 M;  3T6J A;  3MLG A;  3CD6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...