3GODA

Structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
DISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Immune system
molecule keywords Cas1
total genus 115
structure length 320
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01867 Cas_Cas1 CRISPR associated protein Cas1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3godA02
3.100.10.20 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3godA01
4W8KA 4N06A 4XTKA 4WJ0A 3GODA 5DLJA 3NKEA 5DQTA 5DS5A 5DQZA 5DS4A 3NKDA 5DS6A 2YZSA 4P6IC 4QDLA 5FCLA
chains in the Genus database with same CATH superfamily
5A69A 2YHSA 1ZW2A 2YLIA 4YT5A 1MMAA 4U5HA 3S27A 3CCUO 3PMRA 2KK1A 1TWAA 5KYUB 3IQTA 1ORJA 3HNIA 4CS8A 1W2WA 2R02A 4CS8C 1ZHTA 2H7BA 1TFKB 5HV9A 2XSEA 3FAPB 3HKKA 3E9VA 4NTAA 3RQGA 4BJ5A 256BA 2EIMC 1QLEC 1YDIA 1K8AP 4KBLA 4YN0B 4IGGA 3CCML 4LLCA 3CPWK 3Q7GA 3G71L 2VCBA 2XS1A 1YARO 4O7GA 3CC4L 2ASRA 4Q5SF 1T9KA 2IXNA 1FR0A 2XS8A 3MYIA 4MS2A 3KYIA 1UG7A 4KI2A 4G7ZF 2YEVA 3T6GB 3O39A 4E7SA 1ORSC 3F46A 5BQHA 2R9RB 2A6EF 4MVZA 1VLSA 2YL3A 3LS0A 3O55A 2CNWD 2KJGA 4ER9A 2C04A 3EH1A 4JEBA 1YITO 1VQ7O 4O6YA 1EKYA 2ZXPA 4CBEA 1T6UA 3U5SA 4DBQA 1IW7F 1IZMA 1GQAA 5EHHA 1YJ9O 1A7EA 4CJGA 2XL4A 1HY5A 3KPHA 2HFIA 5B1BC 3EHMA 5DLJA 1MMDA 4RD9A 3QMKA 2A68F 2HS5A 3ZQVA 4DJ9A 3AG3C 1NLXA 3L1MA 2X0CA 1Y6DA 1M56C 1W2BK 2V26A 4JURI 3US6A 1M90M 4FAPB 3FDQA 3ASOC 1YHQO 5E3CA 1KC8M 2OTLL 1VQNO 3H2UA 1HMDA 4GQHA 3NYJA 2I15A 5KYYA 4H4KC 3FMSA 4G7HF 3K6BA 4K0DA 2I8BA 2CYDA 1ZYRF 1ORYA 1QKRA 1TFOB 3CCVL 1TWHA 4XEVA 3I55L 3U3FA 1PD0A 4BJ1A 2IXOA 5JUAA 1QVGK 1YI2O 2BL2A 2IBFA 2J0XA 2YLGA 3KKBA 3TOMA 3TQOA 3UMHA 4AL1A 2Q00A 5JVEA 3CCQL 2WB7A 2W4BA 1RKCA 2Q3TA 2XRHA 3IQ5A 3T9OA 1WATA 5JLIA 3FOOA 5L3VA 3EFOA 2R7OA 4PR9A 5B1AC 3CMEO 3IEEA 4I3MA 4IAQA 2LD6A 3C7JA 3Q6MA 1L7CA 2HV6A 1BBHA 2M64A 3NDBB 3AQCA 2NG1A 4YL0A 1SZIA 4W8PA 3U2LA 1WTYA 4JVSA 2E87A 3EH2A 1YIJL 3CD6O 3CC4O 4C3BA 2EIKC 5L0CA 2LK4A 1JR8A 1Z7Qc 2Y3DA 1V4AA 4ZLDA 3OW2K 3CCJO 3ZG1A 1NU7D 2OQMA 1Q0DA 2J9VA 3M4CA 4OINF 3DE8A 4BJ6A 4DRJB 2KW3C 4YJWA 5COMA 1D1CA 1JMWA 2OKUA 4XWJA 1VQLL 4CIHA 3RYLA 2IOQA 2R7WA 1EI7A 3NYLA 4XPWA 3X2QC 2OTJO 1A41A 1ZHWA 2PP4A 2OG2A 1YITL 4ULWA 2OCCC 4UDVA 1RJ9A 5EK0A 4E0HA 3WODF 1U0BB 3RKOF 3RQEA 5L0DA 4NTFA 2KSFA 4U5EE 2W45A 3CZ6A 1Q0KA 5IY5C 3BRJA 2YQYA 2G3KA 4BEJA 3CSKA 4J30B 4OD5A 4HFFB 2F22A 1OW7A 1DOVA 3PCVA 4JRZA 5DVWA 5F5HA 4E0IA 2A1DD 3T4RA 1LM3B 3EGDA 2P1AA 1C17M 1KD1M 3TD7A 3CCMO 1KQSN 1FMVA 4LACB 1NJIM 4CS7A 1FNTc 4Q7CA 2Y3HA 4J7TA 4K1OA 2NUTB 3UMIA 4YT8A 4NC3A 3GEHA 3JYYA 3M15A 4NCQA 4ZLCA 4MVUA 4JTAB 5KYYB 4ONSA 1PV3A 2LFDA 3K66A 3UGOA 3K1IA 3EGDB 2BE5F 2IM8A 3CCEO 1LE2A 3HTKC 5T3WA 4CSAA 1CGME 4JKVA 1RKEA 2HJ3A 2XLVA 2ZXOA 4YL3A 3CCEL 1E2XA 4QDLA 1LKXA 3JZ0A 4B6IA 3V7OA 3BEHA 1GS9A 1Z3IX 1NSGB 1M2VB 3LLKA 2JD3A 2VASA 4O79A 1BR2A 3GEIA 4Z9HA 3AJMA 5KYWB 2XXAA 3CC2L 3AOUA 2HKVA 2CNWA 4JTCB 4CX9A 4IB4A 1Q82P 2KGOA 3IHUA 1JAFA 1MMGA 1YYJA 4I1MA 2KQ9A 4I1OB 4CDYA 4G7OF 1CGOA 1A0BA 4IARA 3B9QA 2JX0A 1I4YA 3T6BA 5DS5A 1M2VA 3MLGA 4BPMA 2A69F 1FFHA 3KH2A 2J8WA 1KD1P 1VQ9L 2OTJL 1G8XA 3HNLA 1H7IA 4O6MA 1Q86M 2KNHA 4E7ZA 1D0XA 2J45A 3A9CA 1VQ4L 2R05A 4Z9JA 1HE1A 1FMWA 3B71A 2CW0F 3LEOA 4U5CE 1QQ3A 3LLIA 1SMYF 4ULVA 3S29A 1RCPA 2IXMA 4MTGA 1JJ2N 2C03A 3JRMO 1NBBA 2J7PD 1OKKA 3UNGC 1M57C 2J9BA 2ZPAA 5COFA 2EPLX 1RMVA 4WGYA 2QA4O 5AGFA 3QZCA 4N4WA 1MQVA 2OJQA 4F4BA 3GEEA 2QUPA 4L6RA 4K7BA 1UFBA 2L81A 2PX3A 1VYKA 5JRAA 3G4ZA 1HMOA 3B29A 3IQCA 4MVRA 5JT4A 2Q9AA 2P0NA 4OIRF 4PJJA 1VQKL 5A6AA 2DB4A 3AGUA 1TQGA 3JRTA 3W2VA 1N8RP 2DGJA 4ANJA 1W2BN 5E33A 4BJTA 4PJNA 1MNEA 4BJ6C 4U5FE 4WJ0A 4DRHB 1NFNA 3SYNA 3TULA 5F5FA 5A6KA 1JPNA 1S7ZA 2PNOA 3AG4C 5DS4A 1YVIA 1CPQA 1WOLA 1BDJB 3M4BA 1S05A 3S9OA 3ZWIA 2R7VA 3O6XA 1VQ7L 3S90A 5BQIA 3H65A 3LNRA 3Q7LA 5JSLA 3G4SO 3HNKA 2EPMX 2YL1A 3I5QA 5T1DB 3CC7O 1VLTA 3FOPA 1T6IA 1J8MF 2AWYA 4OIPF 2PF4E 2H7VC 2QE9A 4U5GA 3HJCA 3SNHA 3U8PA 3CMAO 3CCRL 1Q81M 4AE4B 3QVZA 5L0JA 2MWQA 3CC7L 1YJWL 1VQML 5CI8A 1O5HA 2HJMA 3GM3A 1K40A 3EFOB 4PFPA 3J06A 4CIPA 2L6GA 1M1KM 4LDKA 3WHNA 2UUIA 5KYXB 1S72O 1YLMA 2M4EA 3EZHA 3NG1A 5L0FA 2CCYA 4IJJA 1Q7YM 3OA1A 4JJGA 3LUTB 1ZHYA 4DVYP 3DI5A 4D4XA 2XXAB 1VQPO 1QSPA 1TKNA 3O10A 1WWPA 4J32B 1G5ZA 3ITFA 3DXJF 3CEXA 4G0HA 1SYQA 1VB5A 3QW0A 4CDVA 1M6TA 1EQ1A 1B68A 3DAFA 3TJ5A 2XL8A 2YL7A 2OTLO 3CC2O 3G71O 3OW2N 1L3PA 4XPYA 1VQOO 1T01A 2XL6A 4QI0A 2IXPA 5B3IA 4WGZA 4KNWA 3I56O 3GM2A 3DJNB 1VQNL 4AX2A 3KYJA 5CIVA 4OIQF 4U5BE 2W4MA 3S84A 1YHQL 2J46A 2L7AA 1VMAA 1OKKD 3AG1C 5DS6A 2RD9A 1K04A 2YLDA 4HFKB 4EWCA 5L3QA 3DD7A 1K05A 3JSZA 2XLMA 1XZPA 4EHPA 3I4UA 4LLEA 1ZZPA 1FFTC 1BR1A 4J7YA 2J9UA 1MNDA 3CXCN 1OCOC 1NZEA 3CCSO 1YZCA 4H54A 1RXQA 1R4TA 3GODA 2YKZA 2DYRC 2WL8A 2GFHA 2R7QA 4P9FA 3V5XA 4HEAJ 2NUTA 3ZIBA 2V3CC 1VQKO 2LIGA 4XLNF 1C03A 1EA8A 2PX0A 3VYWA 4EUKB 3GM1A 4LDQA 3POVA 2NUPB 1Q0FA 1WGWA 3NKEA 5DQTA 3G50A 3N2ZB 3S0XA 3L8IA 4E18A 3QTHA 1JRAA 1SR2A 1RJ9B 3ZDLA 3ZVRA 3U0CA 3RW0A 2VB6A 4U9DA 2FGYA 3W4YA 3U9MA 2NPUA 1NJIP 2WZGA 1GM5A 3U2MA 1U6HA 3B0VC 2R7SA 2XLOA 1WN0A 1A7VA 4X0RA 3TK0A 2CGEA 3DE9A 2ZD9A 1N1CA 4D4NA 5FCLA 3QVYA 1Z6AA 1YA9A 4JJFA 3NYMA 1TWGA 5GPGB 1ZU5A 2DYSC 2QLAA 2HMQA 3MFNA 3WAQA 4EKWA 3VAYA 5KYXA 4MTOA 3IPMO 3WG7C 4PFOA 5CI9A 2EPNA 2A0BA 2LFFA 3M1CB 3DZAA 3DAGA 1MMNA 3K7DA 3DM5A 3C8GA 1ZW3A 1J8YF 1QVGN 4JZAA 2HUJA 3SXZA 4DOZA 4Q4ZF 5BUOA 2X51A 1S72L 3K1IC 1QVXA 5KYUA 5KYNA 1V74B 1Z23A 3CCJL 2LP4A 4PJLA 1YA7O 4NTBA 2AWCA 1ZU4A 2AVKA 2OJED 2G62A 1NFOA 3M79A 3SXYA 2P61A 3ZSUA 1K73M 3EG9A 2NSFA 4DVZA 1C02A 4MVMA 4EBKA 4EBBA 4XEFA 2WZFA 1VQ8L 3NRHA 3ASNC 2GWWA 3FXHA 2QEXO 1O3UA 3B0PA 3EGXB 3UR3C 3ZC4A 1OXBA 2EINC 2MHRA 2B0JA 3I5PA 3C8ZA 4GYTA 1U89A 4G78A 3L0IA 3CCQO 4BG0A 1RKEB 3ZTMA 2J9WA 5T3TA 1A7DA 5AC5A 2XLHA 2D4UA 2WZLA 3FAJA 5AC4A 1LS4A 4AL0A 3I55O 1SF8A 1HE9A 1OCZC 2Y3BA 3CCVO 4GEHA 1OCRC 3GORA 3OWTA 3C8GD 4JE9A 3TOLA 4RDAA 3EQLF 4Z9IA 1QPUA 4YT2A 1KC8P 1M90P 2YVKA 2ICWG 3G6EL 5K0IA 1QVFK 4E17A 4MVSA 4OIOF 3CPWN 1FTSA 3JT1A 4WABA 1XZQA 1TR2A 1M1KP 2KC3A 2W9YA 1QZXA 4P9TA 2Y39A 3CMEL 3RIPA 3LAYA 4JCHA 1ST6A 1D1BA 2OU6A 2WVNA 1OW8A 1G4US 1Y4CA 1YJ9L 1VQLO 2B0HA 3KMIA 2G3VA 5L0GA 1K73P 1OCCC 3S28A 1N8RM 2LSEA 2XLWA 4XEKA 4XTKA 2A0UA 4CS9A 1O87A 1OW6A 3W8IA 1V55C 5B3SC 2AP3A 2J0WA 2Y69C 1PCXA 2J7PA 1ZHZA 3CCLO 1LS1A 3RQFA 3VM6A 1E86A 2R7TA 3EPVA 1K9MP 2VH3A 3JSEO 1FAPB 5E3AA 4AE4A 1Z5ZA 5TJ5E 1VQ9O 2VCCA 1Q0GA 2P7VA 1LIHA 3C62A 2HMZA 4FX5A 4XQ1A 2QA4L 4W8KA 2ZXWC 3EZIA 3GWLA 4XLPF 2ZXRA 3W2WA 4JEAA 3W8HA 4U9EA 4BEMJ 3CQZA 5E2QA 4JCZA 1TWCA 3LNMB 1YJGA 2D5RB 2VCAA 2EPKX 4YL1A 4A4AA 2EPOA 1YYXA 1AUEA 2HSQA 3NKDA 5L0IA 2GA0A 2L6FA 3LEVA 4C3DA 3N0TA 3CCUL 4JIOA 1Q82M 2R7RA 3R7CA 1E85A 2FFHA 4MW3A 1Q0MA 2QNLA 3MX3A 4FWVA 1KQSK 3C18A 2L9JA 4EBJA 2QEXL 4MVQA 4PACA 1XWJA 5JS5A 3ZQYA 2YL0A 5F28E 3SZRA 2XLEA 1JOGA 4N06A 2CDQA 3V5ZA 3T6JA 1H9TA 1OR2A 2UUHA 2ETSA 2QY9A 5EGYA 3K33A 4P6IC 1NU9C 1VQMO 2EIJC 1E84A 2Y3GA 1LI5A 4JW1A 2TMVP 1D1AA 4XPXA 3C63A 5FZTA 3VRCA 3NMIA 1OQCA 4R32A 1VQ4O 1JPJA 2XLDA 1VQOL 3GWNA 1APCA 3A11A 1QVFN 3C8GB 3U8VA 4A2NB 3OEOA 4IRUA 1AEPA 1LI7A 2MYSA 2RSEB 1KNYA 3FVYA 3JYHA 2NSGA 3LJBA 4O6NA 3SP1A 3AG2C 4MVOA 5JP7A 4U5DE 3X1OA 3CCLL 3G4XA 3IQ6A 3V5YA 1VQPL 5BQGA 3TJ6A 3EGXA 3PHF2 2R03A 3CCSL 4BJ5C 4RBNA 3AQBA 5COGA 1I4ZA 1NG1A 1H9GA 2KYHA 2A6HF 3AGTA 3DM9B 3MBGA 2OEXA 2GAQA 2HV7A 4MQ9F 5A6JA 4AK9A 3B0UX 1D0YA 1H6GA 1R5ID 3RH3A 1KU2A 2HSBA 4KC9A 3U3BA 4YT4A 2BC5A 1LE4A 4C3EA 4LDRA 3PDMP 1K9MM 1VYIA 5KYWA 3I56L 1VOMA 3H2VA 4DRIB 2HZ8A 2OEVA 2Z15A 1DOWA 2QTVA 2R25A 3L8JA 3F47A 2WVQA 3ECSA 3K1HA 5HSWA 3EHNA 1KTMA 1CPRA 1K8AM 1YZAA 3LS1A 1VQ5L 2O9XA 1CGNA 1M2OA 3R2PA 1HW2A 3DKAA 2LCHA 2L6HA 4I44A 3SXKA 3NMKA 4CDAA 2YRFA 4N6CA 3HLZA 2YWAA 4QI2A 4JTDB 3JTLO 1V54C 3UGPA 4YK5A 1YIJO 4M63A 2LQGA 3CMAL 3CCRO 2IYLD 4DXWA 3MYFA 2DI3A 3KL4A 1F1MA 2EILC 1YJWO 1E83A 1LPEA 2Q9BA 4DBRA 3SXMA 2H7OA 4CS9C 3G4SL 4NQFA 2PBEA 4OD4A 4KNVA 1D0ZA 2R7UA 5DQZA 3FHDA 3QW1A 4HE8D 2VC9A 2FAPB 2NUPA 2P6VA 2PFDA 2XM4A 1JJ2K 3CAXA 4MNDA 3G6EO 3SEOA 1YJNL 1Q86P 3ZTZA 1LVKA 1VQ6O 4IWBA 3GANA 5L0HA 1BR4A 1OR3A 3ABMC 3ATPA 3LESA 1VQ6L 3RF3A 1YJNO 5D92A 1I5NA 2H8AA 2YZSA 3DJUB 3UMKA 3DWWA 2WVOA 3NMJA 5D91A 1AVOB 3CD6L 4MTFA 4NY3A 4YWQA 4CSAC 1WASA 1Z63A 3EJNA 3ABLC 4PK4A 3JCUQ 5A6BD 1VQ8O 2GDCA 3HNJA 3Q6NA 3RFYA 1T6QA 2OOCA 1G4WR 1T5OA 1ZHXA 1VTMP 1BZ4A 2XM0A 4IAOA 4LERA 3EG9B 4CJOA 3DMDA 3N24A 1PD1A 4PJMA 2Q4FA 4FESA 1HW1A 2AU5A 3ABKC 3L34A 1GGQA 2Q7RA 3E70C 2JPUA 3RVZA 1Q81P 3RVYA 4MW8A 1OXKA 4JC7A 4N6HA 3VF0A 4EIYA 5A6BA 3U9JA 1ZVZA 2Q9CA 4C7OA 4C7OB 2R7XA 3CXCK 1Q7YP 1YAUO 1YI2L 1VQ5O 1VK5A
chains in the Genus database with same CATH topology
2YHSA 3CCUO 4YT5A 1MMAA 4U5HA 3S27A 3PMRA 1TWAA 4CS8A 1W2WA 4CS8C 1ZHTA 2H7BA 2XSEA 4BJ5A 3E9VA 2EIMC 1QLEC 1K8AP 4KBLA 4YN0B 3CCML 4LLCA 3CPWK 3Q7GA 3G71L 4O7GA 3CC4L 4Q5SF 2IXNA 4KI2A 4G7ZF 2YEVA 3O39A 4E7SA 3F46A 2A6EF 3LS0A 2CNWD 2KJGA 2C04A 3EH1A 1YITO 1VQ7O 4O6YA 2ZXPA 4CBEA 4DBQA 1IW7F 1IZMA 5EHHA 1YJ9O 2XL4A 5B1BC 3EHMA 5DLJA 1MMDA 4RD9A 3QMKA 2A68F 3AG3C 1M56C 1W2BK 2V26A 4JURI 1M90M 3FDQA 3ASOC 1YHQO 5E3CA 1KC8M 2OTLL 1VQNO 3NYJA 5KYYA 4H4KC 4G7HF 3K6BA 4K0DA 2I8BA 1ZYRF 3CCVL 1TWHA 3I55L 1PD0A 4BJ1A 2IXOA 1QVGK 1YI2O 2J0XA 3KKBA 3UMHA 3CCQL 2WB7A 2W4BA 2XRHA 2Q3TA 5L3VA 3EFOA 2R7OA 5B1AC 3CMEO 3IEEA 4I3MA 3Q6MA 2HV6A 3NDBB 3AQCA 2NG1A 1SZIA 4JVSA 2E87A 3EH2A 1YIJL 3CD6O 3CC4O 4C3BA 2EIKC 2Y3DA 4ZLDA 3OW2K 3CCJO 3ZG1A 1NU7D 2J9VA 4OINF 4BJ6A 2KW3C 4YJWA 1D1CA 4XWJA 1VQLL 4CIHA 3RYLA 2IOQA 2R7WA 3NYLA 2OTJO 3X2QC 1ZHWA 2PP4A 2OG2A 1YITL 4ULWA 2OCCC 1RJ9A 3WODF 3RKOF 4U5EE 2W45A 3CZ6A 5IY5C 2G3KA 4BEJA 3CSKA 4J30B 4OD5A 4HFFB 5DVWA 5F5HA 2A1DD 3T4RA 1KD1M 3EGDA 1KQSN 3TD7A 3CCMO 1FMVA 4LACB 1NJIM 4CS7A 4Q7CA 2Y3HA 2NUTB 3UMIA 4YT8A 4ZLCA 5KYYB 3UGOA 3K66A 3EGDB 2BE5F 3CCEO 3HTKC 5T3WA 4CSAA 2ZXOA 4QDLA 1LKXA 4B6IA 3V7OA 1Z3IX 1M2VB 3LLKA 2JD3A 2VASA 4O79A 1BR2A 5KYWB 2XXAA 3CC2L 2CNWA 1Q82P 2KGOA 1MMGA 4I1OB 4I1MA 2KQ9A 4G7OF 3B9QA 3T6BA 5DS5A 1M2VA 3MLGA 1KD1P 2A69F 1FFHA 3KH2A 1VQ9L 2OTJL 1G8XA 4O6MA 1Q86M 2KNHA 4E7ZA 1D0XA 2J45A 1VQ4L 1FMWA 2CW0F 3S29A 4U5CE 3LLIA 1SMYF 2IXMA 1JJ2N 2C03A 2J7PD 1OKKA 3UNGC 1M57C 2ZPAA 2QA4O 4F4BA 3QZCA 4K7BA 2L81A 2PX3A 1VYKA 2Q9AA 4OIRF 4PJJA 1VQKL 3W2VA 3JRTA 1N8RP 2DGJA 4ANJA 1W2BN 5E33A 4BJTA 4PJNA 1MNEA 4BJ6C 4U5FE 4WJ0A 3SYNA 5F5FA 1JPNA 1S7ZA 3AG4C 5DS4A 2R7VA 3O6XA 1VQ7L 3H65A 3LNRA 3Q7LA 3G4SO 3CC7O 3I5QA 5T1DB 1J8MF 4OIPF 2PF4E 2H7VC 4U5GA 3HJCA 3SNHA 3CMAO 3CCRL 1Q81M 4AE4B 3CC7L 2MWQA 1YJWL 1VQML 5CI8A 1O5HA 3EFOB 4PFPA 1M1KM 5KYXB 1S72O 2M4EA 3EZHA 3NG1A 4IJJA 1Q7YM 3OA1A 4JJGA 1ZHYA 4DVYP 2XXAB 1VQPO 1TKNA 4J32B 3ITFA 3DXJF 4G0HA 3DAFA 2OTLO 3CC2O 3OW2N 1VQOO 4QI0A 2IXPA 3I56O 4KNWA 1VQNL 3DJNB 4AX2A 4OIQF 4U5BE 2W4MA 1YHQL 2J46A 5DS6A 1VMAA 1OKKD 3AG1C 4HFKB 4EWCA 5L3QA 3DD7A 3JSZA 3I4UA 4LLEA 3CXCN 1FFTC 1BR1A 3CCSO 2J9UA 1MNDA 1OCOC 1NZEA 3GODA 2DYRC 2WL8A 2GFHA 2R7QA 2V3CC 4HEAJ 2NUTA 1VQKO 2R7SA 4XLNF 2PX0A 3VYWA 3POVA 2NUPB 1WGWA 3NKEA 5DQTA 3N2ZB 3S0XA 1RJ9B 3ZVRA 2VB6A 2FGYA 1NJIP 2WZGA 3B0VC 4X0RA 2CGEA 1N1CA 5FCLA 3G71O 1Z6AA 4JJFA 5KYUB 3NYMA 1TWGA 1ZU5A 2DYSC 5KYXA 3VAYA 3WG7C 4PFOA 5CI9A 3M1CB 4P6IC 3K7DA 3DZAA 3DAGA 1MMNA 3DM5A 1QVGN 1J8YF 4JZAA 4DOZA 4Q4ZF 5BUOA 2X51A 1S72L 3K1IC 5KYUA 5KYNA 3CCJL 1Z23A 4PJLA 1ZU4A 2G62A 3ZSUA 1K73M 3EG9A 4DVZA 4EBBA 2WZFA 1VQ8L 3NRHA 3ASNC 3CCEL 3B0PA 3EGXB 3UR3C 3ZC4A 2EINC 3I5PA 2B0JA 4GYTA 3L0IA 3CCQO 4BG0A 2J9WA 5T3TA 2WZLA 3FAJA 3I55O 1SF8A 1OCZC 2Y3BA 3CCVO 4GEHA 1OCRC 3OWTA 1KC8P 4RDAA 3EQLF 4YT2A 1M90P 3G6EL 1QVFK 4OIOF 3CPWN 1FTSA 3JT1A 1TR2A 1M1KP 2W9YA 1QZXA 2Y39A 3CMEL 3RIPA 3LAYA 4JCHA 1ST6A 1D1BA 2WVNA 1YJ9L 1VQLO 3KMIA 2G3VA 1N8RM 1K73P 1OCCC 3S28A 2LSEA 4XTKA 4CS9A 1O87A 3W8IA 1V55C 5B3SC 2J0WA 2Y69C 1PCXA 2J7PA 1ZHZA 3CCLO 1LS1A 1K9MP 2R7TA 3EPVA 2VH3A 4AE4A 5E3AA 1Z5ZA 1VQ9O 2P7VA 4FX5A 2QA4L 4W8KA 2ZXWC 3EZIA 4XLPF 2ZXRA 3W2WA 3W8HA 3CQZA 5E2QA 1TWCA 2D5RB 3NKDA 3LEVA 4C3DA 3N0TA 3CCUL 1Q82M 2R7RA 2FFHA 3MX3A 4FWVA 1KQSK 2L9JA 2QEXL 3SZRA 4N06A 2CDQA 3T6JA 2QY9A 5EGYA 3K33A 1VQMO 1NU9C 2EIJC 2Y3GA 4JW1A 1D1AA 1VQ4O 1JPJA 1VQOL 1QVFN 4A2NB 3OEOA 4IRUA 3ZIBA 2MYSA 3JYHA 3FVYA 3SP1A 3X1OA 4O6NA 3LJBA 3CCLL 3AG2C 4U5DE 1VQPL 3EGXA 3PHF2 3CCSL 4BJ5C 4RBNA 3AQBA 1NG1A 3DM9B 2A6HF 2HV7A 4MQ9F 3B0UX 4AK9A 1D0YA 3RH3A 1KU2A 4YT4A 4KC9A 4C3EA 1K9MM 1VYIA 5KYWA 3I56L 1VOMA 2Z15A 2QTVA 3F47A 2WVQA 3ECSA 3K1HA 5HSWA 3EHNA 1K8AM 3LS1A 1VQ5L 2O9XA 1M2OA 4I44A 3HLZA 4QI2A 3UGPA 1V54C 1YIJO 4M63A 3CMAL 3CCRO 2IYLD 3KL4A 2EILC 1YJWO 2Q9BA 4DBRA 2H7OA 4CS9C 3G4SL 4OD4A 4KNVA 1D0ZA 2R7UA 5DQZA 3FHDA 4HE8D 2NUPA 2P6VA 2PFDA 1JJ2K 4MNDA 3G6EO 1Q86P 3SEOA 1YJNL 1LVKA 1VQ6O 4IWBA 3GANA 1BR4A 3ABMC 3LESA 1VQ6L 1YJNO 5D92A 2YZSA 3DJUB 3UMKA 5D91A 2WVOA 3CD6L 4NY3A 4YWQA 4CSAC 1Z63A 3EJNA 3ABLC 4PK4A 3JCUQ 1VQ8O 3Q6NA 3RFYA 1ZHXA 4IAOA 4LERA 3EG9B 3DMDA 3N24A 1PD1A 4PJMA 4FESA 3ABKC 3L34A 1Q81P 3E70C 4C7OA 2Q9CA 2R7XA 4C7OB 3CXCK 1Q7YP 2QEXO 1YI2L 1VQ5O 1VK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8K A;  4N06 A;  4XTK A;  4WJ0 A;  3GOD A;  5DLJ A;  3NKE A;  5DQT A;  5DS5 A;  5DQZ A;  5DS4 A;  3NKD A;  5DS6 A;  2YZS A;  4P6I C;  4QDL A;  5FCL A; 
#chains in the Genus database with same CATH topology
 5A69 A;  2YHS A;  1ZW2 A;  2YLI A;  4YT5 A;  1MMA A;  4U5H A;  3S27 A;  3CCU O;  3PMR A;  2KK1 A;  1TWA A;  5KYU B;  3IQT A;  1ORJ A;  3HNI A;  4CS8 A;  1W2W A;  2R02 A;  4CS8 C;  1ZHT A;  2H7B A;  1TFK B;  5HV9 A;  2XSE A;  3FAP B;  3HKK A;  3E9V A;  4NTA A;  3RQG A;  4BJ5 A;  256B A;  2EIM C;  1QLE C;  1YDI A;  1K8A P;  4KBL A;  4YN0 B;  4IGG A;  3CCM L;  4LLC A;  3CPW K;  3Q7G A;  3G71 L;  2VCB A;  2XS1 A;  1YAR O;  4O7G A;  3CC4 L;  2ASR A;  4Q5S F;  1T9K A;  2IXN A;  1FR0 A;  2XS8 A;  3MYI A;  4MS2 A;  3KYI A;  1UG7 A;  4KI2 A;  4G7Z F;  2YEV A;  3T6G B;  3O39 A;  4E7S A;  1ORS C;  3F46 A;  5BQH A;  2R9R B;  2A6E F;  4MVZ A;  1VLS A;  2YL3 A;  3LS0 A;  3O55 A;  2CNW D;  2KJG A;  4ER9 A;  2C04 A;  3EH1 A;  4JEB A;  1YIT O;  1VQ7 O;  4O6Y A;  1EKY A;  2ZXP A;  4CBE A;  1T6U A;  3U5S A;  4DBQ A;  1IW7 F;  1IZM A;  1GQA A;  5EHH A;  1YJ9 O;  1A7E A;  4CJG A;  2XL4 A;  1HY5 A;  3KPH A;  2HFI A;  5B1B C;  3EHM A;  5DLJ A;  1MMD A;  4RD9 A;  3QMK A;  2A68 F;  2HS5 A;  3ZQV A;  4DJ9 A;  3AG3 C;  1NLX A;  3L1M A;  2X0C A;  1Y6D A;  1M56 C;  1W2B K;  2V26 A;  4JUR I;  3US6 A;  1M90 M;  4FAP B;  3FDQ A;  3ASO C;  1YHQ O;  5E3C A;  1KC8 M;  2OTL L;  1VQN O;  3H2U A;  1HMD A;  4GQH A;  3NYJ A;  2I15 A;  5KYY A;  4H4K C;  3FMS A;  4G7H F;  3K6B A;  4K0D A;  2I8B A;  2CYD A;  1ZYR F;  1ORY A;  1QKR A;  1TFO B;  3CCV L;  1TWH A;  4XEV A;  3I55 L;  3U3F A;  1PD0 A;  4BJ1 A;  2IXO A;  5JUA A;  1QVG K;  1YI2 O;  2BL2 A;  2IBF A;  2J0X A;  2YLG A;  3KKB A;  3TOM A;  3TQO A;  3UMH A;  4AL1 A;  2Q00 A;  5JVE A;  3CCQ L;  2WB7 A;  2W4B A;  1RKC A;  2Q3T A;  2XRH A;  3IQ5 A;  3T9O A;  1WAT A;  5JLI A;  3FOO A;  5L3V A;  3EFO A;  2R7O A;  4PR9 A;  5B1A C;  3CME O;  3IEE A;  4I3M A;  4IAQ A;  2LD6 A;  3C7J A;  3Q6M A;  1L7C A;  2HV6 A;  1BBH A;  2M64 A;  3NDB B;  3AQC A;  2NG1 A;  4YL0 A;  1SZI A;  4W8P A;  3U2L A;  1WTY A;  4JVS A;  2E87 A;  3EH2 A;  1YIJ L;  3CD6 O;  3CC4 O;  4C3B A;  2EIK C;  5L0C A;  2LK4 A;  1JR8 A;  1Z7Q c;  2Y3D A;  1V4A A;  4ZLD A;  3OW2 K;  3CCJ O;  3ZG1 A;  1NU7 D;  2OQM A;  1Q0D A;  2J9V A;  3M4C A;  4OIN F;  3DE8 A;  4BJ6 A;  4DRJ B;  2KW3 C;  4YJW A;  5COM A;  1D1C A;  1JMW A;  2OKU A;  4XWJ A;  1VQL L;  4CIH A;  3RYL A;  2IOQ A;  2R7W A;  1EI7 A;  3NYL A;  4XPW A;  3X2Q C;  2OTJ O;  1A41 A;  1ZHW A;  2PP4 A;  2OG2 A;  1YIT L;  4ULW A;  2OCC C;  4UDV A;  1RJ9 A;  5EK0 A;  4E0H A;  3WOD F;  1U0B B;  3RKO F;  3RQE A;  5L0D A;  4NTF A;  2KSF A;  4U5E E;  2W45 A;  3CZ6 A;  1Q0K A;  5IY5 C;  3BRJ A;  2YQY A;  2G3K A;  4BEJ A;  3CSK A;  4J30 B;  4OD5 A;  4HFF B;  2F22 A;  1OW7 A;  1DOV A;  3PCV A;  4JRZ A;  5DVW A;  5F5H A;  4E0I A;  2A1D D;  3T4R A;  1LM3 B;  3EGD A;  2P1A A;  1C17 M;  1KD1 M;  3TD7 A;  3CCM O;  1KQS N;  1FMV A;  4LAC B;  1NJI M;  4CS7 A;  1FNT c;  4Q7C A;  2Y3H A;  4J7T A;  4K1O A;  2NUT B;  3UMI A;  4YT8 A;  4NC3 A;  3GEH A;  3JYY A;  3M15 A;  4NCQ A;  4ZLC A;  4MVU A;  4JTA B;  5KYY B;  4ONS A;  1PV3 A;  2LFD A;  3K66 A;  3UGO A;  3K1I A;  3EGD B;  2BE5 F;  2IM8 A;  3CCE O;  1LE2 A;  3HTK C;  5T3W A;  4CSA A;  1CGM E;  4JKV A;  1RKE A;  2HJ3 A;  2XLV A;  2ZXO A;  4YL3 A;  3CCE L;  1E2X A;  4QDL A;  1LKX A;  3JZ0 A;  4B6I A;  3V7O A;  3BEH A;  1GS9 A;  1Z3I X;  1NSG B;  1M2V B;  3LLK A;  2JD3 A;  2VAS A;  4O79 A;  1BR2 A;  3GEI A;  4Z9H A;  3AJM A;  5KYW B;  2XXA A;  3CC2 L;  3AOU A;  2HKV A;  2CNW A;  4JTC B;  4CX9 A;  4IB4 A;  1Q82 P;  2KGO A;  3IHU A;  1JAF A;  1MMG A;  1YYJ A;  4I1M A;  2KQ9 A;  4I1O B;  4CDY A;  4G7O F;  1CGO A;  1A0B A;  4IAR A;  3B9Q A;  2JX0 A;  1I4Y A;  3T6B A;  5DS5 A;  1M2V A;  3MLG A;  4BPM A;  2A69 F;  1FFH A;  3KH2 A;  2J8W A;  1KD1 P;  1VQ9 L;  2OTJ L;  1G8X A;  3HNL A;  1H7I A;  4O6M A;  1Q86 M;  2KNH A;  4E7Z A;  1D0X A;  2J45 A;  3A9C A;  1VQ4 L;  2R05 A;  4Z9J A;  1HE1 A;  1FMW A;  3B71 A;  2CW0 F;  3LEO A;  4U5C E;  1QQ3 A;  3LLI A;  1SMY F;  4ULV A;  3S29 A;  1RCP A;  2IXM A;  4MTG A;  1JJ2 N;  2C03 A;  3JRM O;  1NBB A;  2J7P D;  1OKK A;  3UNG C;  1M57 C;  2J9B A;  2ZPA A;  5COF A;  2EPL X;  1RMV A;  4WGY A;  2QA4 O;  5AGF A;  3QZC A;  4N4W A;  1MQV A;  2OJQ A;  4F4B A;  3GEE A;  2QUP A;  4L6R A;  4K7B A;  1UFB A;  2L81 A;  2PX3 A;  1VYK A;  5JRA A;  3G4Z A;  1HMO A;  3B29 A;  3IQC A;  4MVR A;  5JT4 A;  2Q9A A;  2P0N A;  4OIR F;  4PJJ A;  1VQK L;  5A6A A;  2DB4 A;  3AGU A;  1TQG A;  3JRT A;  3W2V A;  1N8R P;  2DGJ A;  4ANJ A;  1W2B N;  5E33 A;  4BJT A;  4PJN A;  1MNE A;  4BJ6 C;  4U5F E;  4WJ0 A;  4DRH B;  1NFN A;  3SYN A;  3TUL A;  5F5F A;  5A6K A;  1JPN A;  1S7Z A;  2PNO A;  3AG4 C;  5DS4 A;  1YVI A;  1CPQ A;  1WOL A;  1BDJ B;  3M4B A;  1S05 A;  3S9O A;  3ZWI A;  2R7V A;  3O6X A;  1VQ7 L;  3S90 A;  5BQI A;  3H65 A;  3LNR A;  3Q7L A;  5JSL A;  3G4S O;  3HNK A;  2EPM X;  2YL1 A;  3I5Q A;  5T1D B;  3CC7 O;  1VLT A;  3FOP A;  1T6I A;  1J8M F;  2AWY A;  4OIP F;  2PF4 E;  2H7V C;  2QE9 A;  4U5G A;  3HJC A;  3SNH A;  3U8P A;  3CMA O;  3CCR L;  1Q81 M;  4AE4 B;  3QVZ A;  5L0J A;  2MWQ A;  3CC7 L;  1YJW L;  1VQM L;  5CI8 A;  1O5H A;  2HJM A;  3GM3 A;  1K40 A;  3EFO B;  4PFP A;  3J06 A;  4CIP A;  2L6G A;  1M1K M;  4LDK A;  3WHN A;  2UUI A;  5KYX B;  1S72 O;  1YLM A;  2M4E A;  3EZH A;  3NG1 A;  5L0F A;  2CCY A;  4IJJ A;  1Q7Y M;  3OA1 A;  4JJG A;  3LUT B;  1ZHY A;  4DVY P;  3DI5 A;  4D4X A;  2XXA B;  1VQP O;  1QSP A;  1TKN A;  3O10 A;  1WWP A;  4J32 B;  1G5Z A;  3ITF A;  3DXJ F;  3CEX A;  4G0H A;  1SYQ A;  1VB5 A;  3QW0 A;  4CDV A;  1M6T A;  1EQ1 A;  1B68 A;  3DAF A;  3TJ5 A;  2XL8 A;  2YL7 A;  2OTL O;  3CC2 O;  3G71 O;  3OW2 N;  1L3P A;  4XPY A;  1VQO O;  1T01 A;  2XL6 A;  4QI0 A;  2IXP A;  5B3I A;  4WGZ A;  4KNW A;  3I56 O;  3GM2 A;  3DJN B;  1VQN L;  4AX2 A;  3KYJ A;  5CIV A;  4OIQ F;  4U5B E;  2W4M A;  3S84 A;  1YHQ L;  2J46 A;  2L7A A;  1VMA A;  1OKK D;  3AG1 C;  5DS6 A;  2RD9 A;  1K04 A;  2YLD A;  4HFK B;  4EWC A;  5L3Q A;  3DD7 A;  1K05 A;  3JSZ A;  2XLM A;  1XZP A;  4EHP A;  3I4U A;  4LLE A;  1ZZP A;  1FFT C;  1BR1 A;  4J7Y A;  2J9U A;  1MND A;  3CXC N;  1OCO C;  1NZE A;  3CCS O;  1YZC A;  4H54 A;  1RXQ A;  1R4T A;  3GOD A;  2YKZ A;  2DYR C;  2WL8 A;  2GFH A;  2R7Q A;  4P9F A;  3V5X A;  4HEA J;  2NUT A;  3ZIB A;  2V3C C;  1VQK O;  2LIG A;  4XLN F;  1C03 A;  1EA8 A;  2PX0 A;  3VYW A;  4EUK B;  3GM1 A;  4LDQ A;  3POV A;  2NUP B;  1Q0F A;  1WGW A;  3NKE A;  5DQT A;  3G50 A;  3N2Z B;  3S0X A;  3L8I A;  4E18 A;  3QTH A;  1JRA A;  1SR2 A;  1RJ9 B;  3ZDL A;  3ZVR A;  3U0C A;  3RW0 A;  2VB6 A;  4U9D A;  2FGY A;  3W4Y A;  3U9M A;  2NPU A;  1NJI P;  2WZG A;  1GM5 A;  3U2M A;  1U6H A;  3B0V C;  2R7S A;  2XLO A;  1WN0 A;  1A7V A;  4X0R A;  3TK0 A;  2CGE A;  3DE9 A;  2ZD9 A;  1N1C A;  4D4N A;  5FCL A;  3QVY A;  1Z6A A;  1YA9 A;  4JJF A;  3NYM A;  1TWG A;  5GPG B;  1ZU5 A;  2DYS C;  2QLA A;  2HMQ A;  3MFN A;  3WAQ A;  4EKW A;  3VAY A;  5KYX A;  4MTO A;  3IPM O;  3WG7 C;  4PFO A;  5CI9 A;  2EPN A;  2A0B A;  2LFF A;  3M1C B;  3DZA A;  3DAG A;  1MMN A;  3K7D A;  3DM5 A;  3C8G A;  1ZW3 A;  1J8Y F;  1QVG N;  4JZA A;  2HUJ A;  3SXZ A;  4DOZ A;  4Q4Z F;  5BUO A;  2X51 A;  1S72 L;  3K1I C;  1QVX A;  5KYU A;  5KYN A;  1V74 B;  1Z23 A;  3CCJ L;  2LP4 A;  4PJL A;  1YA7 O;  4NTB A;  2AWC A;  1ZU4 A;  2AVK A;  2OJE D;  2G62 A;  1NFO A;  3M79 A;  3SXY A;  2P61 A;  3ZSU A;  1K73 M;  3EG9 A;  2NSF A;  4DVZ A;  1C02 A;  4MVM A;  4EBK A;  4EBB A;  4XEF A;  2WZF A;  1VQ8 L;  3NRH A;  3ASN C;  2GWW A;  3FXH A;  2QEX O;  1O3U A;  3B0P A;  3EGX B;  3UR3 C;  3ZC4 A;  1OXB A;  2EIN C;  2MHR A;  2B0J A;  3I5P A;  3C8Z A;  4GYT A;  1U89 A;  4G78 A;  3L0I A;  3CCQ O;  4BG0 A;  1RKE B;  3ZTM A;  2J9W A;  5T3T A;  1A7D A;  5AC5 A;  2XLH A;  2D4U A;  2WZL A;  3FAJ A;  5AC4 A;  1LS4 A;  4AL0 A;  3I55 O;  1SF8 A;  1HE9 A;  1OCZ C;  2Y3B A;  3CCV O;  4GEH A;  1OCR C;  3GOR A;  3OWT A;  3C8G D;  4JE9 A;  3TOL A;  4RDA A;  3EQL F;  4Z9I A;  1QPU A;  4YT2 A;  1KC8 P;  1M90 P;  2YVK A;  2ICW G;  3G6E L;  5K0I A;  1QVF K;  4E17 A;  4MVS A;  4OIO F;  3CPW N;  1FTS A;  3JT1 A;  4WAB A;  1XZQ A;  1TR2 A;  1M1K P;  2KC3 A;  2W9Y A;  1QZX A;  4P9T A;  2Y39 A;  3CME L;  3RIP A;  3LAY A;  4JCH A;  1ST6 A;  1D1B A;  2OU6 A;  2WVN A;  1OW8 A;  1G4U S;  1Y4C A;  1YJ9 L;  1VQL O;  2B0H A;  3KMI A;  2G3V A;  5L0G A;  1K73 P;  1OCC C;  3S28 A;  1N8R M;  2LSE A;  2XLW A;  4XEK A;  4XTK A;  2A0U A;  4CS9 A;  1O87 A;  1OW6 A;  3W8I A;  1V55 C;  5B3S C;  2AP3 A;  2J0W A;  2Y69 C;  1PCX A;  2J7P A;  1ZHZ A;  3CCL O;  1LS1 A;  3RQF A;  3VM6 A;  1E86 A;  2R7T A;  3EPV A;  1K9M P;  2VH3 A;  3JSE O;  1FAP B;  5E3A A;  4AE4 A;  1Z5Z A;  5TJ5 E;  1VQ9 O;  2VCC A;  1Q0G A;  2P7V A;  1LIH A;  3C62 A;  2HMZ A;  4FX5 A;  4XQ1 A;  2QA4 L;  4W8K A;  2ZXW C;  3EZI A;  3GWL A;  4XLP F;  2ZXR A;  3W2W A;  4JEA A;  3W8H A;  4U9E A;  4BEM J;  3CQZ A;  5E2Q A;  4JCZ A;  1TWC A;  3LNM B;  1YJG A;  2D5R B;  2VCA A;  2EPK X;  4YL1 A;  4A4A A;  2EPO A;  1YYX A;  1AUE A;  2HSQ A;  3NKD A;  5L0I A;  2GA0 A;  2L6F A;  3LEV A;  4C3D A;  3N0T A;  3CCU L;  4JIO A;  1Q82 M;  2R7R A;  3R7C A;  1E85 A;  2FFH A;  4MW3 A;  1Q0M A;  2QNL A;  3MX3 A;  4FWV A;  1KQS K;  3C18 A;  2L9J A;  4EBJ A;  2QEX L;  4MVQ A;  4PAC A;  1XWJ A;  5JS5 A;  3ZQY A;  2YL0 A;  5F28 E;  3SZR A;  2XLE A;  1JOG A;  4N06 A;  2CDQ A;  3V5Z A;  3T6J A;  1H9T A;  1OR2 A;  2UUH A;  2ETS A;  2QY9 A;  5EGY A;  3K33 A;  4P6I C;  1NU9 C;  1VQM O;  2EIJ C;  1E84 A;  2Y3G A;  1LI5 A;  4JW1 A;  2TMV P;  1D1A A;  4XPX A;  3C63 A;  5FZT A;  3VRC A;  3NMI A;  1OQC A;  4R32 A;  1VQ4 O;  1JPJ A;  2XLD A;  1VQO L;  3GWN A;  1APC A;  3A11 A;  1QVF N;  3C8G B;  3U8V A;  4A2N B;  3OEO A;  4IRU A;  1AEP A;  1LI7 A;  2MYS A;  2RSE B;  1KNY A;  3FVY A;  3JYH A;  2NSG A;  3LJB A;  4O6N A;  3SP1 A;  3AG2 C;  4MVO A;  5JP7 A;  4U5D E;  3X1O A;  3CCL L;  3G4X A;  3IQ6 A;  3V5Y A;  1VQP L;  5BQG A;  3TJ6 A;  3EGX A;  3PHF 2;  2R03 A;  3CCS L;  4BJ5 C;  4RBN A;  3AQB A;  5COG A;  1I4Z A;  1NG1 A;  1H9G A;  2KYH A;  2A6H F;  3AGT A;  3DM9 B;  3MBG A;  2OEX A;  2GAQ A;  2HV7 A;  4MQ9 F;  5A6J A;  4AK9 A;  3B0U X;  1D0Y A;  1H6G A;  1R5I D;  3RH3 A;  1KU2 A;  2HSB A;  4KC9 A;  3U3B A;  4YT4 A;  2BC5 A;  1LE4 A;  4C3E A;  4LDR A;  3PDM P;  1K9M M;  1VYI A;  5KYW A;  3I56 L;  1VOM A;  3H2V A;  4DRI B;  2HZ8 A;  2OEV A;  2Z15 A;  1DOW A;  2QTV A;  2R25 A;  3L8J A;  3F47 A;  2WVQ A;  3ECS A;  3K1H A;  5HSW A;  3EHN A;  1KTM A;  1CPR A;  1K8A M;  1YZA A;  3LS1 A;  1VQ5 L;  2O9X A;  1CGN A;  1M2O A;  3R2P A;  1HW2 A;  3DKA A;  2LCH A;  2L6H A;  4I44 A;  3SXK A;  3NMK A;  4CDA A;  2YRF A;  4N6C A;  3HLZ A;  2YWA A;  4QI2 A;  4JTD B;  3JTL O;  1V54 C;  3UGP A;  4YK5 A;  1YIJ O;  4M63 A;  2LQG A;  3CMA L;  3CCR O;  2IYL D;  4DXW A;  3MYF A;  2DI3 A;  3KL4 A;  1F1M A;  2EIL C;  1YJW O;  1E83 A;  1LPE A;  2Q9B A;  4DBR A;  3SXM A;  2H7O A;  4CS9 C;  3G4S L;  4NQF A;  2PBE A;  4OD4 A;  4KNV A;  1D0Z A;  2R7U A;  5DQZ A;  3FHD A;  3QW1 A;  4HE8 D;  2VC9 A;  2FAP B;  2NUP A;  2P6V A;  2PFD A;  2XM4 A;  1JJ2 K;  3CAX A;  4MND A;  3G6E O;  3SEO A;  1YJN L;  1Q86 P;  3ZTZ A;  1LVK A;  1VQ6 O;  4IWB A;  3GAN A;  5L0H A;  1BR4 A;  1OR3 A;  3ABM C;  3ATP A;  3LES A;  1VQ6 L;  3RF3 A;  1YJN O;  5D92 A;  1I5N A;  2H8A A;  2YZS A;  3DJU B;  3UMK A;  3DWW A;  2WVO A;  3NMJ A;  5D91 A;  1AVO B;  3CD6 L;  4MTF A;  4NY3 A;  4YWQ A;  4CSA C;  1WAS A;  1Z63 A;  3EJN A;  3ABL C;  4PK4 A;  3JCU Q;  5A6B D;  1VQ8 O;  2GDC A;  3HNJ A;  3Q6N A;  3RFY A;  1T6Q A;  2OOC A;  1G4W R;  1T5O A;  1ZHX A;  1VTM P;  1BZ4 A;  2XM0 A;  4IAO A;  4LER A;  3EG9 B;  4CJO A;  3DMD A;  3N24 A;  1PD1 A;  4PJM A;  2Q4F A;  4FES A;  1HW1 A;  2AU5 A;  3ABK C;  3L34 A;  1GGQ A;  2Q7R A;  3E70 C;  2JPU A;  3RVZ A;  1Q81 P;  3RVY A;  4MW8 A;  1OXK A;  4JC7 A;  4N6H A;  3VF0 A;  4EIY A;  5A6B A;  3U9J A;  1ZVZ A;  2Q9C A;  4C7O A;  4C7O B;  2R7X A;  3CXC K;  1Q7Y P;  1YAU O;  1YI2 L;  1VQ5 O;  1VK5 A; 
#chains in the Genus database with same CATH homology
 2YHS A;  3CCU O;  4YT5 A;  1MMA A;  4U5H A;  3S27 A;  3PMR A;  1TWA A;  4CS8 A;  1W2W A;  4CS8 C;  1ZHT A;  2H7B A;  2XSE A;  4BJ5 A;  3E9V A;  2EIM C;  1QLE C;  1K8A P;  4KBL A;  4YN0 B;  3CCM L;  4LLC A;  3CPW K;  3Q7G A;  3G71 L;  4O7G A;  3CC4 L;  4Q5S F;  2IXN A;  4KI2 A;  4G7Z F;  2YEV A;  3O39 A;  4E7S A;  3F46 A;  2A6E F;  3LS0 A;  2CNW D;  2KJG A;  2C04 A;  3EH1 A;  1YIT O;  1VQ7 O;  4O6Y A;  2ZXP A;  4CBE A;  4DBQ A;  1IW7 F;  1IZM A;  5EHH A;  1YJ9 O;  2XL4 A;  5B1B C;  3EHM A;  5DLJ A;  1MMD A;  4RD9 A;  3QMK A;  2A68 F;  3AG3 C;  1M56 C;  1W2B K;  2V26 A;  4JUR I;  1M90 M;  3FDQ A;  3ASO C;  1YHQ O;  5E3C A;  1KC8 M;  2OTL L;  1VQN O;  3NYJ A;  5KYY A;  4H4K C;  4G7H F;  3K6B A;  4K0D A;  2I8B A;  1ZYR F;  3CCV L;  1TWH A;  3I55 L;  1PD0 A;  4BJ1 A;  2IXO A;  1QVG K;  1YI2 O;  2J0X A;  3KKB A;  3UMH A;  3CCQ L;  2WB7 A;  2W4B A;  2XRH A;  2Q3T A;  5L3V A;  3EFO A;  2R7O A;  5B1A C;  3CME O;  3IEE A;  4I3M A;  3Q6M A;  2HV6 A;  3NDB B;  3AQC A;  2NG1 A;  1SZI A;  4JVS A;  2E87 A;  3EH2 A;  1YIJ L;  3CD6 O;  3CC4 O;  4C3B A;  2EIK C;  2Y3D A;  4ZLD A;  3OW2 K;  3CCJ O;  3ZG1 A;  1NU7 D;  2J9V A;  4OIN F;  4BJ6 A;  2KW3 C;  4YJW A;  1D1C A;  4XWJ A;  1VQL L;  4CIH A;  3RYL A;  2IOQ A;  2R7W A;  3NYL A;  2OTJ O;  3X2Q C;  1ZHW A;  2PP4 A;  2OG2 A;  1YIT L;  4ULW A;  2OCC C;  1RJ9 A;  3WOD F;  3RKO F;  4U5E E;  2W45 A;  3CZ6 A;  5IY5 C;  2G3K A;  4BEJ A;  3CSK A;  4J30 B;  4OD5 A;  4HFF B;  5DVW A;  5F5H A;  2A1D D;  3T4R A;  1KD1 M;  3EGD A;  1KQS N;  3TD7 A;  3CCM O;  1FMV A;  4LAC B;  1NJI M;  4CS7 A;  4Q7C A;  2Y3H A;  2NUT B;  3UMI A;  4YT8 A;  4ZLC A;  5KYY B;  3UGO A;  3K66 A;  3EGD B;  2BE5 F;  3CCE O;  3HTK C;  5T3W A;  4CSA A;  2ZXO A;  4QDL A;  1LKX A;  4B6I A;  3V7O A;  1Z3I X;  1M2V B;  3LLK A;  2JD3 A;  2VAS A;  4O79 A;  1BR2 A;  5KYW B;  2XXA A;  3CC2 L;  2CNW A;  1Q82 P;  2KGO A;  1MMG A;  4I1O B;  4I1M A;  2KQ9 A;  4G7O F;  3B9Q A;  3T6B A;  5DS5 A;  1M2V A;  3MLG A;  1KD1 P;  2A69 F;  1FFH A;  3KH2 A;  1VQ9 L;  2OTJ L;  1G8X A;  4O6M A;  1Q86 M;  2KNH A;  4E7Z A;  1D0X A;  2J45 A;  1VQ4 L;  1FMW A;  2CW0 F;  3S29 A;  4U5C E;  3LLI A;  1SMY F;  2IXM A;  1JJ2 N;  2C03 A;  2J7P D;  1OKK A;  3UNG C;  1M57 C;  2ZPA A;  2QA4 O;  4F4B A;  3QZC A;  4K7B A;  2L81 A;  2PX3 A;  1VYK A;  2Q9A A;  4OIR F;  4PJJ A;  1VQK L;  3W2V A;  3JRT A;  1N8R P;  2DGJ A;  4ANJ A;  1W2B N;  5E33 A;  4BJT A;  4PJN A;  1MNE A;  4BJ6 C;  4U5F E;  4WJ0 A;  3SYN A;  5F5F A;  1JPN A;  1S7Z A;  3AG4 C;  5DS4 A;  2R7V A;  3O6X A;  1VQ7 L;  3H65 A;  3LNR A;  3Q7L A;  3G4S O;  3CC7 O;  3I5Q A;  5T1D B;  1J8M F;  4OIP F;  2PF4 E;  2H7V C;  4U5G A;  3HJC A;  3SNH A;  3CMA O;  3CCR L;  1Q81 M;  4AE4 B;  3CC7 L;  2MWQ A;  1YJW L;  1VQM L;  5CI8 A;  1O5H A;  3EFO B;  4PFP A;  1M1K M;  5KYX B;  1S72 O;  2M4E A;  3EZH A;  3NG1 A;  4IJJ A;  1Q7Y M;  3OA1 A;  4JJG A;  1ZHY A;  4DVY P;  2XXA B;  1VQP O;  1TKN A;  4J32 B;  3ITF A;  3DXJ F;  4G0H A;  3DAF A;  2OTL O;  3CC2 O;  3OW2 N;  1VQO O;  4QI0 A;  2IXP A;  3I56 O;  4KNW A;  1VQN L;  3DJN B;  4AX2 A;  4OIQ F;  4U5B E;  2W4M A;  1YHQ L;  2J46 A;  5DS6 A;  1VMA A;  1OKK D;  3AG1 C;  4HFK B;  4EWC A;  5L3Q A;  3DD7 A;  3JSZ A;  3I4U A;  4LLE A;  3CXC N;  1FFT C;  1BR1 A;  3CCS O;  2J9U A;  1MND A;  1OCO C;  1NZE A;  3GOD A;  2DYR C;  2WL8 A;  2GFH A;  2R7Q A;  2V3C C;  4HEA J;  2NUT A;  1VQK O;  2R7S A;  4XLN F;  2PX0 A;  3VYW A;  3POV A;  2NUP B;  1WGW A;  3NKE A;  5DQT A;  3N2Z B;  3S0X A;  1RJ9 B;  3ZVR A;  2VB6 A;  2FGY A;  1NJI P;  2WZG A;  3B0V C;  4X0R A;  2CGE A;  1N1C A;  5FCL A;  3G71 O;  1Z6A A;  4JJF A;  5KYU B;  3NYM A;  1TWG A;  1ZU5 A;  2DYS C;  5KYX A;  3VAY A;  3WG7 C;  4PFO A;  5CI9 A;  3M1C B;  4P6I C;  3K7D A;  3DZA A;  3DAG A;  1MMN A;  3DM5 A;  1QVG N;  1J8Y F;  4JZA A;  4DOZ A;  4Q4Z F;  5BUO A;  2X51 A;  1S72 L;  3K1I C;  5KYU A;  5KYN A;  3CCJ L;  1Z23 A;  4PJL A;  1ZU4 A;  2G62 A;  3ZSU A;  1K73 M;  3EG9 A;  4DVZ A;  4EBB A;  2WZF A;  1VQ8 L;  3NRH A;  3ASN C;  3CCE L;  3B0P A;  3EGX B;  3UR3 C;  3ZC4 A;  2EIN C;  3I5P A;  2B0J A;  4GYT A;  3L0I A;  3CCQ O;  4BG0 A;  2J9W A;  5T3T A;  2WZL A;  3FAJ A;  3I55 O;  1SF8 A;  1OCZ C;  2Y3B A;  3CCV O;  4GEH A;  1OCR C;  3OWT A;  1KC8 P;  4RDA A;  3EQL F;  4YT2 A;  1M90 P;  3G6E L;  1QVF K;  4OIO F;  3CPW N;  1FTS A;  3JT1 A;  1TR2 A;  1M1K P;  2W9Y A;  1QZX A;  2Y39 A;  3CME L;  3RIP A;  3LAY A;  4JCH A;  1ST6 A;  1D1B A;  2WVN A;  1YJ9 L;  1VQL O;  3KMI A;  2G3V A;  1N8R M;  1K73 P;  1OCC C;  3S28 A;  2LSE A;  4XTK A;  4CS9 A;  1O87 A;  3W8I A;  1V55 C;  5B3S C;  2J0W A;  2Y69 C;  1PCX A;  2J7P A;  1ZHZ A;  3CCL O;  1LS1 A;  1K9M P;  2R7T A;  3EPV A;  2VH3 A;  4AE4 A;  5E3A A;  1Z5Z A;  1VQ9 O;  2P7V A;  4FX5 A;  2QA4 L;  4W8K A;  2ZXW C;  3EZI A;  4XLP F;  2ZXR A;  3W2W A;  3W8H A;  3CQZ A;  5E2Q A;  1TWC A;  2D5R B;  3NKD A;  3LEV A;  4C3D A;  3N0T A;  3CCU L;  1Q82 M;  2R7R A;  2FFH A;  3MX3 A;  4FWV A;  1KQS K;  2L9J A;  2QEX L;  3SZR A;  4N06 A;  2CDQ A;  3T6J A;  2QY9 A;  5EGY A;  3K33 A;  1VQM O;  1NU9 C;  2EIJ C;  2Y3G A;  4JW1 A;  1D1A A;  1VQ4 O;  1JPJ A;  1VQO L;  1QVF N;  4A2N B;  3OEO A;  4IRU A;  3ZIB A;  2MYS A;  3JYH A;  3FVY A;  3SP1 A;  3X1O A;  4O6N A;  3LJB A;  3CCL L;  3AG2 C;  4U5D E;  1VQP L;  3EGX A;  3PHF 2;  3CCS L;  4BJ5 C;  4RBN A;  3AQB A;  1NG1 A;  3DM9 B;  2A6H F;  2HV7 A;  4MQ9 F;  3B0U X;  4AK9 A;  1D0Y A;  3RH3 A;  1KU2 A;  4YT4 A;  4KC9 A;  4C3E A;  1K9M M;  1VYI A;  5KYW A;  3I56 L;  1VOM A;  2Z15 A;  2QTV A;  3F47 A;  2WVQ A;  3ECS A;  3K1H A;  5HSW A;  3EHN A;  1K8A M;  3LS1 A;  1VQ5 L;  2O9X A;  1M2O A;  4I44 A;  3HLZ A;  4QI2 A;  3UGP A;  1V54 C;  1YIJ O;  4M63 A;  3CMA L;  3CCR O;  2IYL D;  3KL4 A;  2EIL C;  1YJW O;  2Q9B A;  4DBR A;  2H7O A;  4CS9 C;  3G4S L;  4OD4 A;  4KNV A;  1D0Z A;  2R7U A;  5DQZ A;  3FHD A;  4HE8 D;  2NUP A;  2P6V A;  2PFD A;  1JJ2 K;  4MND A;  3G6E O;  1Q86 P;  3SEO A;  1YJN L;  1LVK A;  1VQ6 O;  4IWB A;  3GAN A;  1BR4 A;  3ABM C;  3LES A;  1VQ6 L;  1YJN O;  5D92 A;  2YZS A;  3DJU B;  3UMK A;  5D91 A;  2WVO A;  3CD6 L;  4NY3 A;  4YWQ A;  4CSA C;  1Z63 A;  3EJN A;  3ABL C;  4PK4 A;  3JCU Q;  1VQ8 O;  3Q6N A;  3RFY A;  1ZHX A;  4IAO A;  4LER A;  3EG9 B;  3DMD A;  3N24 A;  1PD1 A;  4PJM A;  4FES A;  3ABK C;  3L34 A;  1Q81 P;  3E70 C;  4C7O A;  2Q9C A;  2R7X A;  4C7O B;  3CXC K;  1Q7Y P;  2QEX O;  1YI2 L;  1VQ5 O;  1VK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...