3GODA

Structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
b'DISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cas1
publication title Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Immune system
total genus 115
structure length 320
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01867 Cas_Cas1 CRISPR associated protein Cas1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3godA02
3.100.10.20 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3godA01
5DS5A 2YZSA 5DQZA 4P6IC 5DQTA 3NKDA 4QDLA 3GODA 4W8KA 5DS4A 4XTKA 5DS6A 5DLJA 4WJ0A 5FCLA 3NKEA 4N06A
chains in the Genus database with same CATH superfamily
1M2VB 1C03A 3K1IA 4PJJA 2E87A 1XWJA 5E3CA 2YRFA 2LFDA 2YLDA 2R7QA 3CZ6A 3LNMB 3RQEA 1OR3A 3AG1C 4EBJA 3SXKA 1QVGK 3CPWK 1Q0DA 1OW7A 1TWGA 4GEHA 3K66A 1VQLL 4YWQA 3CMAL 4C3BA 2G3VA 1IW7F 4Z9HA 1Y6DA 3UNGC 2GWWA 4OIQF 3O6XA 3AG2C 1VQ9O 4JCZA 1Q7YM 5E2QA 1H9TA 4JJFA 3RQFA 1Q82M 1VQOL 1NJIM 2PBEA 4A2NB 4CS8A 4W8KA 1O3UA 4LDKA 3GM1A 3BRJA 3U2MA 4XTKA 2HFIA 1NFOA 1J8YF 2R7RA 3TOMA 3C8ZA 4CS9C 2HV6A 3G71O 1SYQA 3DMDA 3DWWA 1Z6AA 1YIJL 1BR2A 3EGDA 1A7DA 5COGA 1TFOB 2X51A 2XS8A 3Q6NA 1J8MF 4G78A 1SZIA 3U3BA 4JRZA 3JCUQ 3DAGA 3EZHA 4J30B 1VQ4O 3FAJA 1M2OA 2XSEA 1K9MM 4DBRA 1YHQO 4PACA 3C63A 2DYSC 2QUPA 4WGYA 2OTLL 4U5CE 1VQ6O 4Q5SF 5B1BC 1I4ZA 1WGWA 3I5PA 1RXQA 1A0BA 3QW1A 2R7WA 3AQBA 1WOLA 4E17A 1NZEA 5L0JA 3B0UX 3CMEO 1QVFN 3V5YA 3NYJA 3DM9B 4BJ5A 5KYYB 2CYDA 3ZIBA 5E33A 1EA8A 1QZXA 1ZHWA 1VQ8L 2XL4A 1Q0FA 3MLGA 3B0PA 5A69A 3TK0A 3H2VA 4JKVA 1I4YA 5A6AA 4N6CA 3CC4O 1BR1A 1W2BK 3LS1A 1ZYRF 2O9XA 1VQ5O 3CCEO 1OCCC 3VF0A 4XWJA 5DVWA 2HZ8A 4AK9A 3U8PA 5KYWB 3K6BA 2W4BA 3CCVO 5CI8A 4RDAA 3DE8A 3X1OA 1NG1A 3K1IC 3N24A 3LLIA 3SEOA 3RW0A 2YL1A 1Q0GA 4AL0A 4CJGA 4YT4A 4CS7A 4NY3A 3DKAA 1YJWO 3T9OA 3UMHA 4I3MA 4PFOA 3QZCA 2MHRA 256BA 4I44A 2ZPAA 2R25A 4O6YA 3DAFA 5B1AC 3CQZA 2AWYA 3EGXA 3QTHA 5L0FA 3ABLC 4O6MA 2YVKA 2Q4FA 1Q82P 1YJGA 1ORJA 3T4RA 1VQNL 5COFA 3NDBB 4CS8C 1MQVA 2NUTA 3QVZA 2W45A 5BQGA 1FMVA 4HEAJ 3RVZA 1U89A 1KD1M 3MYFA 2Z15A 1NLXA 1C17M 2R7OA 1ZHTA 2EIKC 4IB4A 4IWBA 1RKCA 2H7BA 4LDRA 4AX2A 3IHUA 2WL8A 2X0CA 5AC5A 1S05A 1KC8M 1JPNA 3CC7L 4MVQA 4C7OA 4KNWA 2B0HA 2YQYA 4XPXA 3AQCA 5D91A 2J9BA 4JVSA 1K9MP 3KH2A 3U9JA 2ICWG 3A9CA 4KNVA 5CI9A 1E84A 5EHHA 3ZQVA 4D4XA 4MTFA 2EPOA 2ZXWC 2NPUA 4JZAA 1FFHA 3S28A 3DZAA 1BZ4A 4DRJB 1VQKO 4P9FA 1YITL 1VLSA 4N06A 2NSFA 1K40A 2J9VA 4JEBA 1QPUA 2IXMA 4XPYA 3CCJL 2FFHA 2PNOA 2Y3BA 2R03A 4EHPA 1K73M 2B0JA 1B68A 1LPEA 4QDLA 3CCML 1VQMO 2YLIA 3GM2A 2ZD9A 2R7VA 1D1CA 4UDVA 2IM8A 3MYIA 4OD4A 2VCBA 3EG9B 1RJ9B 1Q86P 4E18A 2A68F 2BL2A 1JOGA 1BDJB 3IQ6A 4BEJA 5D92A 1MMDA 4D4NA 2XLEA 2XLWA 1V54C 2P7VA 2KW3C 1VMAA 2Q9AA 1VK5A 2HKVA 3MFNA 3F46A 1XZPA 1GM5A 4LACB 1O87A 3SXYA 1QLEC 4E7ZA 3PDMP 2XLVA 3LNRA 3V5ZA 3M4BA 3L8IA 1V4AA 2QEXO 3HNKA 1I5NA 4G7OF 3L34A 4Q7CA 2WZGA 1Q0MA 5GPGB 1M90P 5L0DA 5EGYA 2W4MA 3S27A 2R7TA 2YL7A 4MVMA 3U3FA 5KYXB 4XEKA 3JTLO 4YT5A 4MVOA 2ETSA 4ULVA 4P6IC 3EFOB 3LS0A 4IAOA 1KD1P 2YKZA 2XM4A 2D4UA 4LLCA 4XLPF 1DOVA 4DVZA 1WWPA 4U9DA 2YEVA 1OR2A 2R7UA 1PV3A 4ER9A 1BBHA 1NSGB 5TJ5E 3HLZA 1Q81M 1VOMA 2G3KA 4NCQA 1OCZC 2DI3A 3X2QC 3TOLA 1ORSC 3ZVRA 2OEVA 5A6BD 2H7VC 3ZTZA 5L3QA 4BEMJ 2Y3HA 2FGYA 3ZDLA 1E83A 3I56L 3C7JA 3CCUO 2J8WA 2KK1A 2L6FA 1F1MA 2F22A 1YJNL 3GORA 2VC9A 4EUKB 4GQHA 3CEXA 2TMVP 5A6BA 5KYNA 2KYHA 3GWNA 2CGEA 3SNHA 1Z23A 1YJ9L 2QLAA 4AL1A 2C03A 3CC7O 2HV7A 3E9VA 3ZSUA 2LCHA 3US6A 1YI2O 3KMIA 1ZHXA 1TWHA 5KYUA 4RBNA 1D1BA 4U5EE 2L6GA 4XEFA 2EPLX 3L1MA 2EILC 2A0UA 3FHDA 1VTMP 4E7SA 1Q0KA 1SR2A 3KYJA 3A11A 2GA0A 1OKKA 4CSAA 4U5GA 2L81A 4J7TA 1Z5ZA 2HSBA 3RH3A 5EK0A 4P9TA 4FAPB 2KJGA 5JT4A 4PJMA 3WHNA 1YAUO 4MW3A 3QVYA 5DS4A 3TD7A 3OEOA 1G4WR 4BPMA 3S9OA 2WVNA 1S72L 1VQ7L 2J7PD 3R2PA 3O39A 3NYMA 1OCRC 3GODA 3I55L 5KYYA 1VYIA 1FTSA 1LI5A 4DXWA 3JRMO 4XLNF 1D0YA 4W8PA 3EPVA 4EWCA 3VAYA 2ZXOA 4BJ6C 2J7PA 1TFKB 3CCQL 4G7ZF 1E2XA 5JUAA 3I5QA 2HMQA 1PD1A 3B71A 3UR3C 2V3CC 3W2VA 3U5SA 2XXAA 3NMKA 3DJNB 1T9KA 1AVOB 3CCSO 3VM6A 3S29A 1Q81P 4DBQA 4U5HA 3W2WA 3KL4A 1UFBA 2Q3TA 3J06A 3EGDB 4DJ9A 2ASRA 4DOZA 5AC4A 4XQ1A 2KC3A 3G6EL 3CD6L 5JLIA 2W9YA 4JTDB 2RSEB 1HMOA 2R7XA 4OINF 3C18A 2VB6A 2CDQA 4OIOF 3NRHA 1K8AM 1YVIA 2P0NA 2OTJO 2V26A 3NG1A 3S90A 3UMKA 3RYLA 1HE9A 3OW2N 4AE4A 3CCRL 2A69F 4JURI 2A1DD 2YZSA 3TQOA 4I1OB 3MBGA 3DI5A 3QW0A 3G4SO 2ZXRA 3CAXA 4MTGA 2MWQA 3VYWA 1W2WA 2A0BA 1YJNO 3ZG1A 1Q7YP 1D1AA 3Q7GA 4CSAC 2IBFA 1NJIP 4K1OA 4IJJA 1JJ2K 1SF8A 4YT2A 3SXMA 2OJQA 2CCYA 1AUEA 1FMWA 1Y4CA 2VH3A 2XLMA 3GM3A 1VQLO 1A7EA 1A41A 5T1DB 3CMAO 4MW8A 2M64A 4CJOA 4JTCB 5DLJA 2XLOA 1W2BN 1OW8A 1RMVA 1YA7O 3HNJA 4YL0A 3EGXB 4IRUA 2HUJA 4EBKA 1MMGA 5T3WA 1VB5A 4KBLA 2IOQA 1VQOO 1WTYA 2JD3A 4OD5A 3JYHA 5JS5A 2NUPA 3Q7LA 2EPMX 3TULA 1T5OA 4E0HA 1QSPA 4L6RA 2YWAA 3PCVA 2H7OA 2ZXPA 2Y3GA 2NUTB 3RIPA 4BJ5C 1C02A 1YLMA 2UUHA 3C8GD 3U2LA 1ZU4A 2KNHA 3FOOA 2J0WA 1G4US 1RKEB 3Q6MA 1FFTC 2OG2A 3SZRA 4Z9JA 3WG7C 1YIJO 3GEHA 2LIGA 1FNTc 2PF4E 4NQFA 3NKEA 2Q7RA 1YYXA 4MVUA 2R05A 1LE4A 4C7OB 4IGGA 3AGTA 2Q00A 3C8GA 3KPHA 2OTLO 3W8IA 5K0IA 3O10A 4JEAA 1GGQA 3B9QA 3ASOC 2Y39A 3KYIA 4PK4A 2GDCA 1CGNA 1TWCA 3S84A 3T6JA 4CDVA 3DE9A 1JAFA 1K8AP 3FMSA 3IQCA 3G71L 1LKXA 1Z63A 4BJTA 4QI2A 3DD7A 5COMA 1VQ8O 3RKOF 3M4CA 4U9EA 1VQ4L 1NBBA 3V5XA 3LESA 3JZ0A 1HW1A 1YHQL 5L0IA 4IAQA 1MMNA 1VQ6L 1EKYA 3G6EO 2LSEA 3G4XA 1LE2A 2EPNA 3UMIA 1R5ID 3CMEL 2AP3A 2J9UA 3U0CA 2HS5A 4FWVA 4YJWA 5JVEA 5DQZA 3ZQYA 2P61A 2PFDA 1HMDA 1OXKA 1PD0A 4HE8D 5FZTA 3HTKC 3ABMC 3IEEA 1A7VA 3CCRO 3RF3A 3ASNC 4H54A 4MVSA 3CC4L 3CSKA 4XEVA 3ZWIA 1VQ5L 1ZHZA 3CCEL 4O7GA 1M56C 3LEOA 4WABA 1KC8P 2HMZA 5BQIA 1M2VA 2LP4A 3CCVL 1QKRA 3FOPA 4FX5A 3BEHA 4JJGA 2JX0A 3L8JA 4EIYA 5IY5C 3U9MA 1VQNO 1E85A 1YJWL 2IXNA 2FAPB 1VYKA 3SXZA 4G7HF 3SP1A 2A6EF 5HSWA 1JR8A 2R9RB 5FCLA 2QY9A 1K73P 3AOUA 3CC2L 4R32A 4J7YA 1TWAA 3LUTB 2L6HA 5DS5A 1OQCA 1CPRA 1OW6A 4G0HA 2XS1A 1JRAA 1ZVZA 4GYTA 3EJNA 4YK5A 3NMIA 2Y3DA 3ATPA 4YL1A 1OKKD 1LS1A 1FR0A 1L7CA 4ZLCA 4F4BA 3H65A 1LIHA 1QVFK 1LM3B 3V7OA 5L0CA 1K04A 1T6IA 4ZLDA 2YHSA 4OIPF 1YITO 3CXCN 2OOCA 2R02A 2YL0A 2Q9CA 3CCJO 2WZFA 2VCCA 3LEVA 4QI0A 1XZQA 3CCLL 1KQSN 3PMRA 3RQGA 1N8RM 1LS4A 3CCMO 1CGOA 1VQPL 3DM5A 2J0XA 5L0HA 4B6IA 1EI7A 5JP7A 1NFNA 3JSZA 3KKBA 2Q9BA 1JPJA 1CGME 2VCAA 1U0BB 4K0DA 2CNWD 1RCPA 3G50A 3E70C 1EQ1A 3PHF2 1VQKL 5KYUB 3HKKA 5B3IA 2J9WA 1M6TA 1WN0A 1YARO 4KI2A 3EQLF 3B0VC 4K7BA 1D0XA 3FXHA 1ZW2A 3OW2K 4ONSA 4JW1A 2DB4A 2IYLD 2GAQA 3K1HA 5B3SC 4A4AA 3T6BA 2CNWA 4NTAA 3U8VA 1VQML 1DOWA 4CDAA 1M1KM 2I8BA 3ZTMA 3L0IA 1K05A 2KQ9A 2EIMC 1R4TA 1M57C 4IARA 5KYWA 4HFFB 1QVGN 3CPWN 3ECSA 4BG0A 4MNDA 4EBBA 4XPWA 1OXBA 1QVXA 2YL3A 3K33A 1GQAA 2AVKA 2QA4L 2OJED 3SYNA 4I1MA 3JT1A 4JTAB 3NMJA 2DGJA 4C3DA 4Z9IA 4PFPA 2XLHA 5DQTA 4O6NA 1MMAA 2RD9A 3F47A 1H7IA 4X0RA 2LFFA 2VASA 2QEXL 4Q4ZF 2BC5A 4CBEA 2H8AA 2L7AA 1V55C 2NG1A 1Q86M 3RFYA 4MVZA 4FESA 2OEXA 2XXAB 4ULWA 1S7ZA 5BUOA 4N6HA 1YDIA 1VLTA 3QMKA 5A6KA 3TJ5A 3N0TA 3GEIA 2LD6A 2XM0A 4BJ1A 1JMWA 2AU5A 3NKDA 3T6GB 1BR4A 3UGPA 3W4YA 1HY5A 3M79A 3I56O 2QTVA 1V74B 3HNLA 1U6HA 3EZIA 2OU6A 4MTOA 1FAPB 2AWCA 4MVRA 1KTMA 1NU7D 3CC2O 2DYRC 1ZU5A 1KNYA 1N8RP 1ZZPA 3ABKC 2OCCC 1YJ9O 3IQ5A 1M90M 1SMYF 2P6VA 1QQ3A 2IXOA 1HW2A 4O79A 3DXJF 1APCA 2XRHA 2EPKX 3GEEA 4PR9A 2HJ3A 4U5FE 4AE4B 3FAPB 4JIOA 2L9JA 4NTFA 3CCUL 4EKWA 3K7DA 4YL3A 4U5BE 3UGOA 1RKEA 3N2ZB 4E0IA 2R7SA 3NYLA 5JRAA 3CCLO 2XLDA 1M1KP 4CIHA 3EG9A 1RJ9A 2QNLA 5AGFA 1VQPO 2A6HF 3W8HA 1YI2L 2OQMA 4J32B 4RD9A 4PJLA 3H2UA 3LLKA 4U5DE 1H6GA 1S72O 1VQ7O 3EHMA 5F5FA 4LDQA 1LI7A 4ANJA 4DRIB 3I55O 1ZHYA 3S0XA 3EH2A 3AG3C 4PJNA 1TQGA 5BQHA 1VQ9L 1NU9C 2P1AA 4MQ9F 1GS9A 2D5RB 2HJMA 2C04A 2KSFA 2CW0F 2WVOA 2PX3A 5L0GA 3CCQO 4NC3A 3B29A 3AJMA 5T3TA 1G8XA 3GWLA 4CDYA 3AGUA 3M15A 3R7CA 3LJBA 2NUPB 3JRTA 1JJ2N 2EINC 2QE9A 1H9GA 3O55A 2I15A 3JSEO 3ZC4A 4KC9A 1Z3IX 4CX9A 5KYXA 1PCXA 3LAYA 2LQGA 3JYYA 1CPQA 1LVKA 1WATA 2JPUA 1T6QA 3GANA 5JSLA 2QA4O 4NTBA 2KGOA 1HE1A 4JC7A 4DVYP 3EFOA 1N1CA 4M63A 3CD6O 2G62A 4HFKB 2J45A 2MYSA 1YYJA 4DRHB 3C8GB 4N4WA 1E86A 4WJ0A 2XL6A 2Y69C 4WGZA 1WASA 4LERA 3HJCA 1TKNA 4YN0B 3IPMO 1ST6A 2M4EA 3CCSL 1T01A 2NSGA 4CS9A 3FDQA 1Z7Qc 2GFHA 1YZAA 1YZCA 3C62A 3M1CB 2LK4A 1ZW3A 5DS6A 4JCHA 4JE9A 4H4KC 5L3VA 3OA1A 2WVQA 1AEPA 3MX3A 5F28E 5CIVA 1OCOC 1ORYA 2OKUA 3CXCK 3OWTA 4BJ6A 4YT8A 3WAQA 3TJ6A 1G5ZA 2BE5F 1KQSK 1KU2A 3ITFA 2EIJC 2WB7A 3RVYA 2WZLA 3WODF 2XL8A 1MNDA 2PX0A 2OTJL 3EHNA 4LLEA 3VRCA 1T6UA 3AG4C 2IXPA 3IQTA 4OIRF 1O5HA 1MNEA 3I4UA 1D0ZA 2UUIA 5F5HA 2PP4A 2HSQA 4CIPA 3HNIA 3G4ZA 5E3AA 3EH1A 3G4SL 4C3EA 5A6JA 3POVA 1UG7A 3FVYA 1L3PA 2YLGA 4MS2A 1YA9A 3DJUB 1IZMA 1TR2A 2J46A 5HV9A
chains in the Genus database with same CATH topology
4EBBA 1M2VB 1VQLO 4PJJA 2E87A 5T1DB 3CMAO 5E3CA 3K33A 2R7QA 3CZ6A 2QEXO 2QA4L 3AG1C 5DLJA 4G7OF 3SYNA 4I1MA 3JT1A 3L34A 1QVGK 1W2BN 3CPWK 2DGJA 4Q7CA 4C3DA 4PFPA 2WZGA 3EGXB 4IRUA 5DQTA 1TWGA 4O6NA 1M90P 1MMAA 4GEHA 3K66A 1VQLL 4YWQA 3F47A 5EGYA 4X0RA 3CMAL 2W4MA 4C3BA 2VASA 1MMGA 2G3VA 5T3WA 4KBLA 1IW7F 2QEXL 2IOQA 1VQOO 2JD3A 3S27A 2R7TA 4OD5A 4Q4ZF 3JYHA 4CBEA 2NUPA 3Q7LA 5KYXB 1V55C 2NG1A 3UNGC 1Q86M 3RFYA 4FESA 4YT5A 2H7OA 2ZXPA 3O6XA 4OIQF 2Y3GA 3AG2C 1VQ9O 2NUTB 3RIPA 4ULWA 1S7ZA 2XXAB 1Q7YM 4BJ5C 5E2QA 5BUOA 4P6IC 3QMKA 4JJFA 1ZU4A 1Q82M 2KNHA 3N0TA 1VQOL 1NJIM 3EFOB 3LS0A 2J0WA 4IAOA 1KD1P 3Q6MA 1FFTC 4A2NB 2OG2A 3SZRA 3WG7C 1YIJO 4BJ1A 3NKDA 4CS8A 4LLCA 1BR4A 4XLPF 3UGPA 4DVZA 2YEVA 4W8KA 2PF4E 3NKEA 2R7UA 4XTKA 3HLZA 3I56O 1J8YF 2QTVA 2R7RA 4C7OB 1Q81M 1VOMA 2G3KA 4CS9C 2HV6A 3G71O 1OCZC 3EZIA 3DMDA 3X2QC 2OTLO 3W8IA 3ZVRA 1Z6AA 1YIJL 3B9QA 1BR2A 3EGDA 3ASOC 2Y39A 2H7VC 2X51A 3Q6NA 4PK4A 1J8MF 5L3QA 1NU7D 1SZIA 3CC2O 2DYRC 1TWCA 3JCUQ 3T6JA 2Y3HA 3DAGA 1ZU5A 2FGYA 3EZHA 4J30B 1N8RP 1VQ4O 3FAJA 1M2OA 2XSEA 3I56L 3ABKC 2OCCC 1K9MM 4DBRA 1YJ9O 1M90M 3CCUO 1K8AP 1YHQO 3G71L 1SMYF 2DYSC 1LKXA 2P6VA 1Z63A 2IXOA 4O79A 2OTLL 4U5CE 4BJTA 1YJNL 1VQ6O 3DXJF 4Q5SF 4QI2A 3DD7A 5B1BC 2XRHA 1WGWA 3I5PA 1VQ8O 2R7WA 3AQBA 4U5FE 3RKOF 1NZEA 3B0UX 4AE4B 5KYNA 3CMEO 1VQ4L 2CGEA 3SNHA 3LESA 1QVFN 1Z23A 2L9JA 3NYJA 1YJ9L 3DM9B 3CCUL 4BJ5A 1YHQL 2C03A 5KYYB 3CC7O 2HV7A 3K7DA 3E9VA 3ZIBA 3ZSUA 1MMNA 1VQ6L 5E33A 3G6EO 4U5BE 1QZXA 2LSEA 1YI2O 3UGOA 1ZHWA 1ZHXA 3KMIA 3N2ZB 1TWHA 2R7SA 1VQ8L 5KYUA 4RBNA 3UMIA 1D1BA 2XL4A 3MLGA 4U5EE 3CMEL 3B0PA 3NYLA 3CCLO 1M1KP 4CIHA 2J9UA 3EG9A 3CC4O 1BR1A 1W2BK 3LS1A 1RJ9A 1ZYRF 2O9XA 1VQ5O 1VQPO 3CCEO 4FWVA 2A6HF 3W8HA 4YJWA 1OCCC 4J32B 2EILC 1YI2L 3FHDA 5DQZA 4E7SA 4RD9A 4PJLA 4XWJA 3LLKA 5DVWA 2PFDA 4AK9A 1PD0A 4HE8D 5KYWB 3HTKC 3K6BA 4U5DE 1OKKA 4CSAA 4U5GA 1S72O 2L81A 3ABMC 1VQ7O 3IEEA 3EHMA 2W4BA 3CCVO 5CI8A 5F5FA 3CCRO 3ASNC 1Z5ZA 4RDAA 3RH3A 3X1OA 4ANJA 3CC4L 1NG1A 3K1IC 3CSKA 3N24A 3LLIA 2KJGA 3I55O 1VQ5L 1ZHYA 1ZHZA 3S0XA 3EH2A 4PJMA 3CCEL 4O7GA 3SEOA 3AG3C 1M56C 4PJNA 5DS4A 3TD7A 4YT4A 3OEOA 4CS7A 1VQ9L 1KC8P 1NU9C 4NY3A 2WVNA 1YJWO 3UMHA 1M2VA 1S72L 1VQ7L 2J7PD 4I3MA 4MQ9F 2D5RB 3O39A 3NYMA 2C04A 3CCVL 2CW0F 2WVOA 2PX3A 4PFOA 4FX5A 1OCRC 3CCQO 3QZCA 3GODA 4JJGA 5T3TA 3I55L 1G8XA 5KYYA 4I44A 2ZPAA 1VYIA 1FTSA 5IY5C 4O6YA 3DAFA 5B1AC 3CQZA 3LJBA 2NUPB 4XLNF 1VQNO 1D0YA 3EGXA 1YJWL 3JRTA 1JJ2N 2EINC 2IXNA 3EPVA 1VYKA 4EWCA 3VAYA 2ZXOA 4G7HF 4BJ6C 3SP1A 2A6EF 2J7PA 3ZC4A 3CCQL 3ABLC 4O6MA 4G7ZF 5HSWA 4KC9A 5FCLA 1Z3IX 1Q82P 2QY9A 3I5QA 1K73P 3CC2L 5KYXA 1PCXA 3T4RA 3LAYA 1TWAA 1VQNL 1LVKA 1PD1A 3UR3C 2V3CC 3NDBB 3W2VA 3GANA 4CS8C 5DS5A 2NUTA 2XXAA 2QA4O 2KGOA 2W45A 3DJNB 1FMVA 4G0HA 4HEAJ 4DVYP 3CCSO 4GYTA 3EJNA 3S29A 3EFOA 1N1CA 4M63A 2Y3DA 3CD6O 1Q81P 4DBQA 2G62A 4HFKB 1KD1M 2J45A 2Z15A 4U5HA 1OKKD 1LS1A 3W2WA 2MYSA 2R7OA 1ZHTA 3KL4A 4ZLCA 2EIKC 4IWBA 4F4BA 3H65A 4WJ0A 1QVFK 2Y69C 2H7BA 3V7OA 2Q3TA 4AX2A 3EGDB 4LERA 2WL8A 3HJCA 1TKNA 4YN0B 1JPNA 1KC8M 3CC7L 4DOZA 4ZLDA 1ST6A 2M4EA 4C7OA 2YHSA 4OIPF 3CCSL 4KNWA 3AQCA 5D91A 4JVSA 1YITO 3G6EL 1K9MP 3KH2A 4CS9A 3FDQA 3CD6L 4KNVA 2GFHA 3CXCN 5CI9A 2W9YA 5EHHA 2Q9CA 3M1CB 3CCJO 2R7XA 2WZFA 5DS6A 4JCHA 5L3VA 4H4KC 3LEVA 3OA1A 2ZXWC 2WVQA 4JZAA 4QI0A 1FFHA 4OINF 3S28A 3CCLL 3DZAA 1KQSN 2VB6A 3PMRA 2CDQA 4OIOF 1VQKO 1N8RM 3MX3A 3CCMO 3NRHA 1VQPL 3DM5A 2J0XA 1OCOC 1YITL 3CXCK 4N06A 4B6IA 3OWTA 4BJ6A 4YT8A 1K8AM 2J9VA 2OTJO 2IXMA 2V26A 3JSZA 3KKBA 2Q9BA 3NG1A 3CCJL 1JPJA 2FFHA 2Y3BA 3UMKA 3RYLA 2BE5F 4K0DA 1KQSK 1KU2A 3OW2N 2CNWD 1K73M 2B0JA 3E70C 3ITFA 4AE4A 3CCRL 2EIJC 2WB7A 3PHF2 2A69F 4JURI 2A1DD 1VQKL 5KYUB 2YZSA 2WZLA 4QDLA 4I1OB 3CCML 3WODF 1VQMO 2J9WA 4KI2A 1MNDA 2PX0A 3EQLF 2R7VA 3B0VC 4K7BA 2OTJL 1D0XA 1D1CA 3EHNA 4OD4A 4LLEA 3EG9B 3G4SO 2ZXRA 1RJ9B 2MWQA 3OW2K 3VYWA 1Q86P 2A68F 3AG4C 1W2WA 2IXPA 4JW1A 4BEJA 4OIRF 2IYLD 1YJNO 1O5HA 3K1HA 5B3SC 3ZG1A 1Q7YP 1MNEA 3T6BA 2CNWA 3I4UA 5D92A 1D0ZA 1VQML 5F5HA 1MMDA 1D1AA 2PP4A 3Q7GA 4CSAC 1M1KM 2I8BA 1V54C 2P7VA 1NJIP 2KW3C 3L0IA 1VMAA 2Q9AA 5E3AA 4IJJA 1VK5A 3EH1A 3G4SL 4C3EA 1JJ2K 3F46A 2KQ9A 2EIMC 3POVA 1SF8A 1M57C 4LACB 3FVYA 1O87A 4YT2A 4HFFB 5KYWA 3DJUB 1FMWA 1QLEC 4E7ZA 1IZMA 1QVGN 1TR2A 2VH3A 3CPWN 2J46A 3ECSA 4BG0A 3LNRA 4MNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DS5 A;  2YZS A;  5DQZ A;  4P6I C;  5DQT A;  3NKD A;  4QDL A;  3GOD A;  4W8K A;  5DS4 A;  4XTK A;  5DS6 A;  5DLJ A;  4WJ0 A;  5FCL A;  3NKE A;  4N06 A; 
#chains in the Genus database with same CATH topology
 1M2V B;  1C03 A;  3K1I A;  4PJJ A;  2E87 A;  1XWJ A;  5E3C A;  2YRF A;  2LFD A;  2YLD A;  2R7Q A;  3CZ6 A;  3LNM B;  3RQE A;  1OR3 A;  3AG1 C;  4EBJ A;  3SXK A;  1QVG K;  3CPW K;  1Q0D A;  1OW7 A;  1TWG A;  4GEH A;  3K66 A;  1VQL L;  4YWQ A;  3CMA L;  4C3B A;  2G3V A;  1IW7 F;  4Z9H A;  1Y6D A;  3UNG C;  2GWW A;  4OIQ F;  3O6X A;  3AG2 C;  1VQ9 O;  4JCZ A;  1Q7Y M;  5E2Q A;  1H9T A;  4JJF A;  3RQF A;  1Q82 M;  1VQO L;  1NJI M;  2PBE A;  4A2N B;  4CS8 A;  4W8K A;  1O3U A;  4LDK A;  3GM1 A;  3BRJ A;  3U2M A;  4XTK A;  2HFI A;  1NFO A;  1J8Y F;  2R7R A;  3TOM A;  3C8Z A;  4CS9 C;  2HV6 A;  3G71 O;  1SYQ A;  3DMD A;  3DWW A;  1Z6A A;  1YIJ L;  1BR2 A;  3EGD A;  1A7D A;  5COG A;  1TFO B;  2X51 A;  2XS8 A;  3Q6N A;  1J8M F;  4G78 A;  1SZI A;  3U3B A;  4JRZ A;  3JCU Q;  3DAG A;  3EZH A;  4J30 B;  1VQ4 O;  3FAJ A;  1M2O A;  2XSE A;  1K9M M;  4DBR A;  1YHQ O;  4PAC A;  3C63 A;  2DYS C;  2QUP A;  4WGY A;  2OTL L;  4U5C E;  1VQ6 O;  4Q5S F;  5B1B C;  1I4Z A;  1WGW A;  3I5P A;  1RXQ A;  1A0B A;  3QW1 A;  2R7W A;  3AQB A;  1WOL A;  4E17 A;  1NZE A;  5L0J A;  3B0U X;  3CME O;  1QVF N;  3V5Y A;  3NYJ A;  3DM9 B;  4BJ5 A;  5KYY B;  2CYD A;  3ZIB A;  5E33 A;  1EA8 A;  1QZX A;  1ZHW A;  1VQ8 L;  2XL4 A;  1Q0F A;  3MLG A;  3B0P A;  5A69 A;  3TK0 A;  3H2V A;  4JKV A;  1I4Y A;  5A6A A;  4N6C A;  3CC4 O;  1BR1 A;  1W2B K;  3LS1 A;  1ZYR F;  2O9X A;  1VQ5 O;  3CCE O;  1OCC C;  3VF0 A;  4XWJ A;  5DVW A;  2HZ8 A;  4AK9 A;  3U8P A;  5KYW B;  3K6B A;  2W4B A;  3CCV O;  5CI8 A;  4RDA A;  3DE8 A;  3X1O A;  1NG1 A;  3K1I C;  3N24 A;  3LLI A;  3SEO A;  3RW0 A;  2YL1 A;  1Q0G A;  4AL0 A;  4CJG A;  4YT4 A;  4CS7 A;  4NY3 A;  3DKA A;  1YJW O;  3T9O A;  3UMH A;  4I3M A;  4PFO A;  3QZC A;  2MHR A;  256B A;  4I44 A;  2ZPA A;  2R25 A;  4O6Y A;  3DAF A;  5B1A C;  3CQZ A;  2AWY A;  3EGX A;  3QTH A;  5L0F A;  3ABL C;  4O6M A;  2YVK A;  2Q4F A;  1Q82 P;  1YJG A;  1ORJ A;  3T4R A;  1VQN L;  5COF A;  3NDB B;  4CS8 C;  1MQV A;  2NUT A;  3QVZ A;  2W45 A;  5BQG A;  1FMV A;  4HEA J;  3RVZ A;  1U89 A;  1KD1 M;  3MYF A;  2Z15 A;  1NLX A;  1C17 M;  2R7O A;  1ZHT A;  2EIK C;  4IB4 A;  4IWB A;  1RKC A;  2H7B A;  4LDR A;  4AX2 A;  3IHU A;  2WL8 A;  2X0C A;  5AC5 A;  1S05 A;  1KC8 M;  1JPN A;  3CC7 L;  4MVQ A;  4C7O A;  4KNW A;  2B0H A;  2YQY A;  4XPX A;  3AQC A;  5D91 A;  2J9B A;  4JVS A;  1K9M P;  3KH2 A;  3U9J A;  2ICW G;  3A9C A;  4KNV A;  5CI9 A;  1E84 A;  5EHH A;  3ZQV A;  4D4X A;  4MTF A;  2EPO A;  2ZXW C;  2NPU A;  4JZA A;  1FFH A;  3S28 A;  3DZA A;  1BZ4 A;  4DRJ B;  1VQK O;  4P9F A;  1YIT L;  1VLS A;  4N06 A;  2NSF A;  1K40 A;  2J9V A;  4JEB A;  1QPU A;  2IXM A;  4XPY A;  3CCJ L;  2FFH A;  2PNO A;  2Y3B A;  2R03 A;  4EHP A;  1K73 M;  2B0J A;  1B68 A;  1LPE A;  4QDL A;  3CCM L;  1VQM O;  2YLI A;  3GM2 A;  2ZD9 A;  2R7V A;  1D1C A;  4UDV A;  2IM8 A;  3MYI A;  4OD4 A;  2VCB A;  3EG9 B;  1RJ9 B;  1Q86 P;  4E18 A;  2A68 F;  2BL2 A;  1JOG A;  1BDJ B;  3IQ6 A;  4BEJ A;  5D92 A;  1MMD A;  4D4N A;  2XLE A;  2XLW A;  1V54 C;  2P7V A;  2KW3 C;  1VMA A;  2Q9A A;  1VK5 A;  2HKV A;  3MFN A;  3F46 A;  1XZP A;  1GM5 A;  4LAC B;  1O87 A;  3SXY A;  1QLE C;  4E7Z A;  3PDM P;  2XLV A;  3LNR A;  3V5Z A;  3M4B A;  3L8I A;  1V4A A;  2QEX O;  3HNK A;  1I5N A;  4G7O F;  3L34 A;  4Q7C A;  2WZG A;  1Q0M A;  5GPG B;  1M90 P;  5L0D A;  5EGY A;  2W4M A;  3S27 A;  2R7T A;  2YL7 A;  4MVM A;  3U3F A;  5KYX B;  4XEK A;  3JTL O;  4YT5 A;  4MVO A;  2ETS A;  4ULV A;  4P6I C;  3EFO B;  3LS0 A;  4IAO A;  1KD1 P;  2YKZ A;  2XM4 A;  2D4U A;  4LLC A;  4XLP F;  1DOV A;  4DVZ A;  1WWP A;  4U9D A;  2YEV A;  1OR2 A;  2R7U A;  1PV3 A;  4ER9 A;  1BBH A;  1NSG B;  5TJ5 E;  3HLZ A;  1Q81 M;  1VOM A;  2G3K A;  4NCQ A;  1OCZ C;  2DI3 A;  3X2Q C;  3TOL A;  1ORS C;  3ZVR A;  2OEV A;  5A6B D;  2H7V C;  3ZTZ A;  5L3Q A;  4BEM J;  2Y3H A;  2FGY A;  3ZDL A;  1E83 A;  3I56 L;  3C7J A;  3CCU O;  2J8W A;  2KK1 A;  2L6F A;  1F1M A;  2F22 A;  1YJN L;  3GOR A;  2VC9 A;  4EUK B;  4GQH A;  3CEX A;  2TMV P;  5A6B A;  5KYN A;  2KYH A;  3GWN A;  2CGE A;  3SNH A;  1Z23 A;  1YJ9 L;  2QLA A;  4AL1 A;  2C03 A;  3CC7 O;  2HV7 A;  3E9V A;  3ZSU A;  2LCH A;  3US6 A;  1YI2 O;  3KMI A;  1ZHX A;  1TWH A;  5KYU A;  4RBN A;  1D1B A;  4U5E E;  2L6G A;  4XEF A;  2EPL X;  3L1M A;  2EIL C;  2A0U A;  3FHD A;  1VTM P;  4E7S A;  1Q0K A;  1SR2 A;  3KYJ A;  3A11 A;  2GA0 A;  1OKK A;  4CSA A;  4U5G A;  2L81 A;  4J7T A;  1Z5Z A;  2HSB A;  3RH3 A;  5EK0 A;  4P9T A;  4FAP B;  2KJG A;  5JT4 A;  4PJM A;  3WHN A;  1YAU O;  4MW3 A;  3QVY A;  5DS4 A;  3TD7 A;  3OEO A;  1G4W R;  4BPM A;  3S9O A;  2WVN A;  1S72 L;  1VQ7 L;  2J7P D;  3R2P A;  3O39 A;  3NYM A;  1OCR C;  3GOD A;  3I55 L;  5KYY A;  1VYI A;  1FTS A;  1LI5 A;  4DXW A;  3JRM O;  4XLN F;  1D0Y A;  4W8P A;  3EPV A;  4EWC A;  3VAY A;  2ZXO A;  4BJ6 C;  2J7P A;  1TFK B;  3CCQ L;  4G7Z F;  1E2X A;  5JUA A;  3I5Q A;  2HMQ A;  1PD1 A;  3B71 A;  3UR3 C;  2V3C C;  3W2V A;  3U5S A;  2XXA A;  3NMK A;  3DJN B;  1T9K A;  1AVO B;  3CCS O;  3VM6 A;  3S29 A;  1Q81 P;  4DBQ A;  4U5H A;  3W2W A;  3KL4 A;  1UFB A;  2Q3T A;  3J06 A;  3EGD B;  4DJ9 A;  2ASR A;  4DOZ A;  5AC4 A;  4XQ1 A;  2KC3 A;  3G6E L;  3CD6 L;  5JLI A;  2W9Y A;  4JTD B;  2RSE B;  1HMO A;  2R7X A;  4OIN F;  3C18 A;  2VB6 A;  2CDQ A;  4OIO F;  3NRH A;  1K8A M;  1YVI A;  2P0N A;  2OTJ O;  2V26 A;  3NG1 A;  3S90 A;  3UMK A;  3RYL A;  1HE9 A;  3OW2 N;  4AE4 A;  3CCR L;  2A69 F;  4JUR I;  2A1D D;  2YZS A;  3TQO A;  4I1O B;  3MBG A;  3DI5 A;  3QW0 A;  3G4S O;  2ZXR A;  3CAX A;  4MTG A;  2MWQ A;  3VYW A;  1W2W A;  2A0B A;  1YJN O;  3ZG1 A;  1Q7Y P;  1D1A A;  3Q7G A;  4CSA C;  2IBF A;  1NJI P;  4K1O A;  4IJJ A;  1JJ2 K;  1SF8 A;  4YT2 A;  3SXM A;  2OJQ A;  2CCY A;  1AUE A;  1FMW A;  1Y4C A;  2VH3 A;  2XLM A;  3GM3 A;  1VQL O;  1A7E A;  1A41 A;  5T1D B;  3CMA O;  4MW8 A;  2M64 A;  4CJO A;  4JTC B;  5DLJ A;  2XLO A;  1W2B N;  1OW8 A;  1RMV A;  1YA7 O;  3HNJ A;  4YL0 A;  3EGX B;  4IRU A;  2HUJ A;  4EBK A;  1MMG A;  5T3W A;  1VB5 A;  4KBL A;  2IOQ A;  1VQO O;  1WTY A;  2JD3 A;  4OD5 A;  3JYH A;  5JS5 A;  2NUP A;  3Q7L A;  2EPM X;  3TUL A;  1T5O A;  4E0H A;  1QSP A;  4L6R A;  2YWA A;  3PCV A;  2H7O A;  2ZXP A;  2Y3G A;  2NUT B;  3RIP A;  4BJ5 C;  1C02 A;  1YLM A;  2UUH A;  3C8G D;  3U2L A;  1ZU4 A;  2KNH A;  3FOO A;  2J0W A;  1G4U S;  1RKE B;  3Q6M A;  1FFT C;  2OG2 A;  3SZR A;  4Z9J A;  3WG7 C;  1YIJ O;  3GEH A;  2LIG A;  1FNT c;  2PF4 E;  4NQF A;  3NKE A;  2Q7R A;  1YYX A;  4MVU A;  2R05 A;  1LE4 A;  4C7O B;  4IGG A;  3AGT A;  2Q00 A;  3C8G A;  3KPH A;  2OTL O;  3W8I A;  5K0I A;  3O10 A;  4JEA A;  1GGQ A;  3B9Q A;  3ASO C;  2Y39 A;  3KYI A;  4PK4 A;  2GDC A;  1CGN A;  1TWC A;  3S84 A;  3T6J A;  4CDV A;  3DE9 A;  1JAF A;  1K8A P;  3FMS A;  3IQC A;  3G71 L;  1LKX A;  1Z63 A;  4BJT A;  4QI2 A;  3DD7 A;  5COM A;  1VQ8 O;  3RKO F;  3M4C A;  4U9E A;  1VQ4 L;  1NBB A;  3V5X A;  3LES A;  3JZ0 A;  1HW1 A;  1YHQ L;  5L0I A;  4IAQ A;  1MMN A;  1VQ6 L;  1EKY A;  3G6E O;  2LSE A;  3G4X A;  1LE2 A;  2EPN A;  3UMI A;  1R5I D;  3CME L;  2AP3 A;  2J9U A;  3U0C A;  2HS5 A;  4FWV A;  4YJW A;  5JVE A;  5DQZ A;  3ZQY A;  2P61 A;  2PFD A;  1HMD A;  1OXK A;  1PD0 A;  4HE8 D;  5FZT A;  3HTK C;  3ABM C;  3IEE A;  1A7V A;  3CCR O;  3RF3 A;  3ASN C;  4H54 A;  4MVS A;  3CC4 L;  3CSK A;  4XEV A;  3ZWI A;  1VQ5 L;  1ZHZ A;  3CCE L;  4O7G A;  1M56 C;  3LEO A;  4WAB A;  1KC8 P;  2HMZ A;  5BQI A;  1M2V A;  2LP4 A;  3CCV L;  1QKR A;  3FOP A;  4FX5 A;  3BEH A;  4JJG A;  2JX0 A;  3L8J A;  4EIY A;  5IY5 C;  3U9M A;  1VQN O;  1E85 A;  1YJW L;  2IXN A;  2FAP B;  1VYK A;  3SXZ A;  4G7H F;  3SP1 A;  2A6E F;  5HSW A;  1JR8 A;  2R9R B;  5FCL A;  2QY9 A;  1K73 P;  3AOU A;  3CC2 L;  4R32 A;  4J7Y A;  1TWA A;  3LUT B;  2L6H A;  5DS5 A;  1OQC A;  1CPR A;  1OW6 A;  4G0H A;  2XS1 A;  1JRA A;  1ZVZ A;  4GYT A;  3EJN A;  4YK5 A;  3NMI A;  2Y3D A;  3ATP A;  4YL1 A;  1OKK D;  1LS1 A;  1FR0 A;  1L7C A;  4ZLC A;  4F4B A;  3H65 A;  1LIH A;  1QVF K;  1LM3 B;  3V7O A;  5L0C A;  1K04 A;  1T6I A;  4ZLD A;  2YHS A;  4OIP F;  1YIT O;  3CXC N;  2OOC A;  2R02 A;  2YL0 A;  2Q9C A;  3CCJ O;  2WZF A;  2VCC A;  3LEV A;  4QI0 A;  1XZQ A;  3CCL L;  1KQS N;  3PMR A;  3RQG A;  1N8R M;  1LS4 A;  3CCM O;  1CGO A;  1VQP L;  3DM5 A;  2J0X A;  5L0H A;  4B6I A;  1EI7 A;  5JP7 A;  1NFN A;  3JSZ A;  3KKB A;  2Q9B A;  1JPJ A;  1CGM E;  2VCA A;  1U0B B;  4K0D A;  2CNW D;  1RCP A;  3G50 A;  3E70 C;  1EQ1 A;  3PHF 2;  1VQK L;  5KYU B;  3HKK A;  5B3I A;  2J9W A;  1M6T A;  1WN0 A;  1YAR O;  4KI2 A;  3EQL F;  3B0V C;  4K7B A;  1D0X A;  3FXH A;  1ZW2 A;  3OW2 K;  4ONS A;  4JW1 A;  2DB4 A;  2IYL D;  2GAQ A;  3K1H A;  5B3S C;  4A4A A;  3T6B A;  2CNW A;  4NTA A;  3U8V A;  1VQM L;  1DOW A;  4CDA A;  1M1K M;  2I8B A;  3ZTM A;  3L0I A;  1K05 A;  2KQ9 A;  2EIM C;  1R4T A;  1M57 C;  4IAR A;  5KYW A;  4HFF B;  1QVG N;  3CPW N;  3ECS A;  4BG0 A;  4MND A;  4EBB A;  4XPW A;  1OXB A;  1QVX A;  2YL3 A;  3K33 A;  1GQA A;  2AVK A;  2QA4 L;  2OJE D;  3SYN A;  4I1M A;  3JT1 A;  4JTA B;  3NMJ A;  2DGJ A;  4C3D A;  4Z9I A;  4PFP A;  2XLH A;  5DQT A;  4O6N A;  1MMA A;  2RD9 A;  3F47 A;  1H7I A;  4X0R A;  2LFF A;  2VAS A;  2QEX L;  4Q4Z F;  2BC5 A;  4CBE A;  2H8A A;  2L7A A;  1V55 C;  2NG1 A;  1Q86 M;  3RFY A;  4MVZ A;  4FES A;  2OEX A;  2XXA B;  4ULW A;  1S7Z A;  5BUO A;  4N6H A;  1YDI A;  1VLT A;  3QMK A;  5A6K A;  3TJ5 A;  3N0T A;  3GEI A;  2LD6 A;  2XM0 A;  4BJ1 A;  1JMW A;  2AU5 A;  3NKD A;  3T6G B;  1BR4 A;  3UGP A;  3W4Y A;  1HY5 A;  3M79 A;  3I56 O;  2QTV A;  1V74 B;  3HNL A;  1U6H A;  3EZI A;  2OU6 A;  4MTO A;  1FAP B;  2AWC A;  4MVR A;  1KTM A;  1NU7 D;  3CC2 O;  2DYR C;  1ZU5 A;  1KNY A;  1N8R P;  1ZZP A;  3ABK C;  2OCC C;  1YJ9 O;  3IQ5 A;  1M90 M;  1SMY F;  2P6V A;  1QQ3 A;  2IXO A;  1HW2 A;  4O79 A;  3DXJ F;  1APC A;  2XRH A;  2EPK X;  3GEE A;  4PR9 A;  2HJ3 A;  4U5F E;  4AE4 B;  3FAP B;  4JIO A;  2L9J A;  4NTF A;  3CCU L;  4EKW A;  3K7D A;  4YL3 A;  4U5B E;  3UGO A;  1RKE A;  3N2Z B;  4E0I A;  2R7S A;  3NYL A;  5JRA A;  3CCL O;  2XLD A;  1M1K P;  4CIH A;  3EG9 A;  1RJ9 A;  2QNL A;  5AGF A;  1VQP O;  2A6H F;  3W8H A;  1YI2 L;  2OQM A;  4J32 B;  4RD9 A;  4PJL A;  3H2U A;  3LLK A;  4U5D E;  1H6G A;  1S72 O;  1VQ7 O;  3EHM A;  5F5F A;  4LDQ A;  1LI7 A;  4ANJ A;  4DRI B;  3I55 O;  1ZHY A;  3S0X A;  3EH2 A;  3AG3 C;  4PJN A;  1TQG A;  5BQH A;  1VQ9 L;  1NU9 C;  2P1A A;  4MQ9 F;  1GS9 A;  2D5R B;  2HJM A;  2C04 A;  2KSF A;  2CW0 F;  2WVO A;  2PX3 A;  5L0G A;  3CCQ O;  4NC3 A;  3B29 A;  3AJM A;  5T3T A;  1G8X A;  3GWL A;  4CDY A;  3AGU A;  3M15 A;  3R7C A;  3LJB A;  2NUP B;  3JRT A;  1JJ2 N;  2EIN C;  2QE9 A;  1H9G A;  3O55 A;  2I15 A;  3JSE O;  3ZC4 A;  4KC9 A;  1Z3I X;  4CX9 A;  5KYX A;  1PCX A;  3LAY A;  2LQG A;  3JYY A;  1CPQ A;  1LVK A;  1WAT A;  2JPU A;  1T6Q A;  3GAN A;  5JSL A;  2QA4 O;  4NTB A;  2KGO A;  1HE1 A;  4JC7 A;  4DVY P;  3EFO A;  1N1C A;  4M63 A;  3CD6 O;  2G62 A;  4HFK B;  2J45 A;  2MYS A;  1YYJ A;  4DRH B;  3C8G B;  4N4W A;  1E86 A;  4WJ0 A;  2XL6 A;  2Y69 C;  4WGZ A;  1WAS A;  4LER A;  3HJC A;  1TKN A;  4YN0 B;  3IPM O;  1ST6 A;  2M4E A;  3CCS L;  1T01 A;  2NSG A;  4CS9 A;  3FDQ A;  1Z7Q c;  2GFH A;  1YZA A;  1YZC A;  3C62 A;  3M1C B;  2LK4 A;  1ZW3 A;  5DS6 A;  4JCH A;  4JE9 A;  4H4K C;  5L3V A;  3OA1 A;  2WVQ A;  1AEP A;  3MX3 A;  5F28 E;  5CIV A;  1OCO C;  1ORY A;  2OKU A;  3CXC K;  3OWT A;  4BJ6 A;  4YT8 A;  3WAQ A;  3TJ6 A;  1G5Z A;  2BE5 F;  1KQS K;  1KU2 A;  3ITF A;  2EIJ C;  2WB7 A;  3RVY A;  2WZL A;  3WOD F;  2XL8 A;  1MND A;  2PX0 A;  2OTJ L;  3EHN A;  4LLE A;  3VRC A;  1T6U A;  3AG4 C;  2IXP A;  3IQT A;  4OIR F;  1O5H A;  1MNE A;  3I4U A;  1D0Z A;  2UUI A;  5F5H A;  2PP4 A;  2HSQ A;  4CIP A;  3HNI A;  3G4Z A;  5E3A A;  3EH1 A;  3G4S L;  4C3E A;  5A6J A;  3POV A;  1UG7 A;  3FVY A;  1L3P A;  2YLG A;  4MS2 A;  1YA9 A;  3DJU B;  1IZM A;  1TR2 A;  2J46 A;  5HV9 A; 
#chains in the Genus database with same CATH homology
 4EBB A;  1M2V B;  1VQL O;  4PJJ A;  2E87 A;  5T1D B;  3CMA O;  5E3C A;  3K33 A;  2R7Q A;  3CZ6 A;  2QEX O;  2QA4 L;  3AG1 C;  5DLJ A;  4G7O F;  3SYN A;  4I1M A;  3JT1 A;  3L34 A;  1QVG K;  1W2B N;  3CPW K;  2DGJ A;  4Q7C A;  4C3D A;  4PFP A;  2WZG A;  3EGX B;  4IRU A;  5DQT A;  1TWG A;  4O6N A;  1M90 P;  1MMA A;  4GEH A;  3K66 A;  1VQL L;  4YWQ A;  3F47 A;  5EGY A;  4X0R A;  3CMA L;  2W4M A;  4C3B A;  2VAS A;  1MMG A;  2G3V A;  5T3W A;  4KBL A;  1IW7 F;  2QEX L;  2IOQ A;  1VQO O;  2JD3 A;  3S27 A;  2R7T A;  4OD5 A;  4Q4Z F;  3JYH A;  4CBE A;  2NUP A;  3Q7L A;  5KYX B;  1V55 C;  2NG1 A;  3UNG C;  1Q86 M;  3RFY A;  4FES A;  4YT5 A;  2H7O A;  2ZXP A;  3O6X A;  4OIQ F;  2Y3G A;  3AG2 C;  1VQ9 O;  2NUT B;  3RIP A;  4ULW A;  1S7Z A;  2XXA B;  1Q7Y M;  4BJ5 C;  5E2Q A;  5BUO A;  4P6I C;  3QMK A;  4JJF A;  1ZU4 A;  1Q82 M;  2KNH A;  3N0T A;  1VQO L;  1NJI M;  3EFO B;  3LS0 A;  2J0W A;  4IAO A;  1KD1 P;  3Q6M A;  1FFT C;  4A2N B;  2OG2 A;  3SZR A;  3WG7 C;  1YIJ O;  4BJ1 A;  3NKD A;  4CS8 A;  4LLC A;  1BR4 A;  4XLP F;  3UGP A;  4DVZ A;  2YEV A;  4W8K A;  2PF4 E;  3NKE A;  2R7U A;  4XTK A;  3HLZ A;  3I56 O;  1J8Y F;  2QTV A;  2R7R A;  4C7O B;  1Q81 M;  1VOM A;  2G3K A;  4CS9 C;  2HV6 A;  3G71 O;  1OCZ C;  3EZI A;  3DMD A;  3X2Q C;  2OTL O;  3W8I A;  3ZVR A;  1Z6A A;  1YIJ L;  3B9Q A;  1BR2 A;  3EGD A;  3ASO C;  2Y39 A;  2H7V C;  2X51 A;  3Q6N A;  4PK4 A;  1J8M F;  5L3Q A;  1NU7 D;  1SZI A;  3CC2 O;  2DYR C;  1TWC A;  3JCU Q;  3T6J A;  2Y3H A;  3DAG A;  1ZU5 A;  2FGY A;  3EZH A;  4J30 B;  1N8R P;  1VQ4 O;  3FAJ A;  1M2O A;  2XSE A;  3I56 L;  3ABK C;  2OCC C;  1K9M M;  4DBR A;  1YJ9 O;  1M90 M;  3CCU O;  1K8A P;  1YHQ O;  3G71 L;  1SMY F;  2DYS C;  1LKX A;  2P6V A;  1Z63 A;  2IXO A;  4O79 A;  2OTL L;  4U5C E;  4BJT A;  1YJN L;  1VQ6 O;  3DXJ F;  4Q5S F;  4QI2 A;  3DD7 A;  5B1B C;  2XRH A;  1WGW A;  3I5P A;  1VQ8 O;  2R7W A;  3AQB A;  4U5F E;  3RKO F;  1NZE A;  3B0U X;  4AE4 B;  5KYN A;  3CME O;  1VQ4 L;  2CGE A;  3SNH A;  3LES A;  1QVF N;  1Z23 A;  2L9J A;  3NYJ A;  1YJ9 L;  3DM9 B;  3CCU L;  4BJ5 A;  1YHQ L;  2C03 A;  5KYY B;  3CC7 O;  2HV7 A;  3K7D A;  3E9V A;  3ZIB A;  3ZSU A;  1MMN A;  1VQ6 L;  5E33 A;  3G6E O;  4U5B E;  1QZX A;  2LSE A;  1YI2 O;  3UGO A;  1ZHW A;  1ZHX A;  3KMI A;  3N2Z B;  1TWH A;  2R7S A;  1VQ8 L;  5KYU A;  4RBN A;  3UMI A;  1D1B A;  2XL4 A;  3MLG A;  4U5E E;  3CME L;  3B0P A;  3NYL A;  3CCL O;  1M1K P;  4CIH A;  2J9U A;  3EG9 A;  3CC4 O;  1BR1 A;  1W2B K;  3LS1 A;  1RJ9 A;  1ZYR F;  2O9X A;  1VQ5 O;  1VQP O;  3CCE O;  4FWV A;  2A6H F;  3W8H A;  4YJW A;  1OCC C;  4J32 B;  2EIL C;  1YI2 L;  3FHD A;  5DQZ A;  4E7S A;  4RD9 A;  4PJL A;  4XWJ A;  3LLK A;  5DVW A;  2PFD A;  4AK9 A;  1PD0 A;  4HE8 D;  5KYW B;  3HTK C;  3K6B A;  4U5D E;  1OKK A;  4CSA A;  4U5G A;  1S72 O;  2L81 A;  3ABM C;  1VQ7 O;  3IEE A;  3EHM A;  2W4B A;  3CCV O;  5CI8 A;  5F5F A;  3CCR O;  3ASN C;  1Z5Z A;  4RDA A;  3RH3 A;  3X1O A;  4ANJ A;  3CC4 L;  1NG1 A;  3K1I C;  3CSK A;  3N24 A;  3LLI A;  2KJG A;  3I55 O;  1VQ5 L;  1ZHY A;  1ZHZ A;  3S0X A;  3EH2 A;  4PJM A;  3CCE L;  4O7G A;  3SEO A;  3AG3 C;  1M56 C;  4PJN A;  5DS4 A;  3TD7 A;  4YT4 A;  3OEO A;  4CS7 A;  1VQ9 L;  1KC8 P;  1NU9 C;  4NY3 A;  2WVN A;  1YJW O;  3UMH A;  1M2V A;  1S72 L;  1VQ7 L;  2J7P D;  4I3M A;  4MQ9 F;  2D5R B;  3O39 A;  3NYM A;  2C04 A;  3CCV L;  2CW0 F;  2WVO A;  2PX3 A;  4PFO A;  4FX5 A;  1OCR C;  3CCQ O;  3QZC A;  3GOD A;  4JJG A;  5T3T A;  3I55 L;  1G8X A;  5KYY A;  4I44 A;  2ZPA A;  1VYI A;  1FTS A;  5IY5 C;  4O6Y A;  3DAF A;  5B1A C;  3CQZ A;  3LJB A;  2NUP B;  4XLN F;  1VQN O;  1D0Y A;  3EGX A;  1YJW L;  3JRT A;  1JJ2 N;  2EIN C;  2IXN A;  3EPV A;  1VYK A;  4EWC A;  3VAY A;  2ZXO A;  4G7H F;  4BJ6 C;  3SP1 A;  2A6E F;  2J7P A;  3ZC4 A;  3CCQ L;  3ABL C;  4O6M A;  4G7Z F;  5HSW A;  4KC9 A;  5FCL A;  1Z3I X;  1Q82 P;  2QY9 A;  3I5Q A;  1K73 P;  3CC2 L;  5KYX A;  1PCX A;  3T4R A;  3LAY A;  1TWA A;  1VQN L;  1LVK A;  1PD1 A;  3UR3 C;  2V3C C;  3NDB B;  3W2V A;  3GAN A;  4CS8 C;  5DS5 A;  2NUT A;  2XXA A;  2QA4 O;  2KGO A;  2W45 A;  3DJN B;  1FMV A;  4G0H A;  4HEA J;  4DVY P;  3CCS O;  4GYT A;  3EJN A;  3S29 A;  3EFO A;  1N1C A;  4M63 A;  2Y3D A;  3CD6 O;  1Q81 P;  4DBQ A;  2G62 A;  4HFK B;  1KD1 M;  2J45 A;  2Z15 A;  4U5H A;  1OKK D;  1LS1 A;  3W2W A;  2MYS A;  2R7O A;  1ZHT A;  3KL4 A;  4ZLC A;  2EIK C;  4IWB A;  4F4B A;  3H65 A;  4WJ0 A;  1QVF K;  2Y69 C;  2H7B A;  3V7O A;  2Q3T A;  4AX2 A;  3EGD B;  4LER A;  2WL8 A;  3HJC A;  1TKN A;  4YN0 B;  1JPN A;  1KC8 M;  3CC7 L;  4DOZ A;  4ZLD A;  1ST6 A;  2M4E A;  4C7O A;  2YHS A;  4OIP F;  3CCS L;  4KNW A;  3AQC A;  5D91 A;  4JVS A;  1YIT O;  3G6E L;  1K9M P;  3KH2 A;  4CS9 A;  3FDQ A;  3CD6 L;  4KNV A;  2GFH A;  3CXC N;  5CI9 A;  2W9Y A;  5EHH A;  2Q9C A;  3M1C B;  3CCJ O;  2R7X A;  2WZF A;  5DS6 A;  4JCH A;  5L3V A;  4H4K C;  3LEV A;  3OA1 A;  2ZXW C;  2WVQ A;  4JZA A;  4QI0 A;  1FFH A;  4OIN F;  3S28 A;  3CCL L;  3DZA A;  1KQS N;  2VB6 A;  3PMR A;  2CDQ A;  4OIO F;  1VQK O;  1N8R M;  3MX3 A;  3CCM O;  3NRH A;  1VQP L;  3DM5 A;  2J0X A;  1OCO C;  1YIT L;  3CXC K;  4N06 A;  4B6I A;  3OWT A;  4BJ6 A;  4YT8 A;  1K8A M;  2J9V A;  2OTJ O;  2IXM A;  2V26 A;  3JSZ A;  3KKB A;  2Q9B A;  3NG1 A;  3CCJ L;  1JPJ A;  2FFH A;  2Y3B A;  3UMK A;  3RYL A;  2BE5 F;  4K0D A;  1KQS K;  1KU2 A;  3OW2 N;  2CNW D;  1K73 M;  2B0J A;  3E70 C;  3ITF A;  4AE4 A;  3CCR L;  2EIJ C;  2WB7 A;  3PHF 2;  2A69 F;  4JUR I;  2A1D D;  1VQK L;  5KYU B;  2YZS A;  2WZL A;  4QDL A;  4I1O B;  3CCM L;  3WOD F;  1VQM O;  2J9W A;  4KI2 A;  1MND A;  2PX0 A;  3EQL F;  2R7V A;  3B0V C;  4K7B A;  2OTJ L;  1D0X A;  1D1C A;  3EHN A;  4OD4 A;  4LLE A;  3EG9 B;  3G4S O;  2ZXR A;  1RJ9 B;  2MWQ A;  3OW2 K;  3VYW A;  1Q86 P;  2A68 F;  3AG4 C;  1W2W A;  2IXP A;  4JW1 A;  4BEJ A;  4OIR F;  2IYL D;  1YJN O;  1O5H A;  3K1H A;  5B3S C;  3ZG1 A;  1Q7Y P;  1MNE A;  3T6B A;  2CNW A;  3I4U A;  5D92 A;  1D0Z A;  1VQM L;  5F5H A;  1MMD A;  1D1A A;  2PP4 A;  3Q7G A;  4CSA C;  1M1K M;  2I8B A;  1V54 C;  2P7V A;  1NJI P;  2KW3 C;  3L0I A;  1VMA A;  2Q9A A;  5E3A A;  4IJJ A;  1VK5 A;  3EH1 A;  3G4S L;  4C3E A;  1JJ2 K;  3F46 A;  2KQ9 A;  2EIM C;  3POV A;  1SF8 A;  1M57 C;  4LAC B;  3FVY A;  1O87 A;  4YT2 A;  4HFF B;  5KYW A;  3DJU B;  1FMW A;  1QLE C;  4E7Z A;  1IZM A;  1QVG N;  1TR2 A;  2VH3 A;  3CPW N;  2J46 A;  3ECS A;  4BG0 A;  3LNR A;  4MND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...