3GODA

Structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
DISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cas1
publication title Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 115
structure length 320
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01867 Cas_Cas1 CRISPR associated protein Cas1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3godA02
3.100.10.20 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3godA01
3NKDA 5DQZA 4WJ0A 5DLJA 3NKEA 4QDLA 4XTKA 5DS4A 5DQTA 2YZSA 5FCLA 5DS5A 3GODA 4P6IC 4N06A 4W8KA 5DS6A
chains in the Genus database with same CATH superfamily
3ZTMA 4CBEA 4B6IA 3NYLA 3IEEA 4FAPB 5DQTA 1YJWO 2YLIA 2QA4O 1QZXA 1ZHYA 3TQOA 1WOLA 2YQYA 1KNYA 1YJWL 4YT4A 1M2VB 4HE8D 1VQMO 5F5HA 4XEKA 1E2XA 4JKVA 3UR3C 3V5YA 2CW0F 2AWYA 1TR2A 1YA9A 5JRAA 2LIGA 1VQML 2HFIA 1VQ4L 2NSFA 1BBHA 3LLKA 1YJNO 2PNOA 1JPNA 2Y3DA 4DOZA 2UUHA 1YJNL 2AWCA 3CZ6A 3RFYA 4BJTA 4P9TA 4LDKA 4PJJA 3TD7A 3W2VA 5COMA 3NG1A 3HTKC 1I4ZA 4IB4A 2ZXWC 1E84A 2NUTB 3EPVA 2WVOA 3V5XA 3CCQO 3X2QC 3JYYA 5CI8A 2J0XA 2LFDA 3N0TA 2L6HA 1VQLO 1XZQA 3K1IA 3RYLA 3CCVL 3CCQL 3RF3A 3DJNB 4O6NA 1YHQO 2IM8A 1C17M 1DOWA 4DVYP 2EPMX 3OWTA 1VQLL 2CNWD 1HMOA 4U5EE 3ZIBA 1Q0MA 3KPHA 1YHQL 4MTGA 1QKRA 3SNHA 3RQFA 3C62A 1XZPA 1D1CA 2YL7A 4JTCB 3ZTZA 3JT1A 3CMAO 1T5OA 4MW8A 5D92A 5T3TA 2QUPA 3U8VA 3US6A 1VQ9O 2HMQA 2XLWA 4LLCA 2Y69C 3DE9A 4CIHA 3L8JA 2NUPB 3CMAL 5BUOA 3S29A 3B0UX 1VQ9L 5DVWA 4PJMA 2EPKX 3B9QA 1OR2A 5A6BD 4ULVA 2ASRA 2L6FA 1KU2A 2L7AA 4CSAA 2L81A 1FFHA 2FFHA 4U9DA 3FDQA 3G6EO 3ZG1A 2OU6A 3MLGA 1Q7YP 4YT5A 1D0XA 4JW1A 3EGXB 2IOQA 1Q0GA 2EPOA 2YZSA 3ITFA 2CCYA 1M6TA 2HZ8A 3OA1A 4EBJA 4YT2A 3RQEA 1FMVA 3RKOF 2OOCA 5JP7A 2E87A 2A6HF 3VF0A 4JZAA 3FOPA 5T1DB 1K8AM 1V74B 3HJCA 2PFDA 3WHNA 2HV6A 2IXPA 1VK5A 2VB6A 2J0WA 1QQ3A 3N2ZB 3E70C 4KNWA 2WVQA 2PBEA 3U3FA 3DE8A 1MMDA 3PHF2 3G4SL 1AEPA 3GM2A 4BEMJ 4AL1A 1ZHWA 3S9OA 2LK4A 4Z9JA 1H9GA 4PFPA 4J30B 3T4RA 2VH3A 3CD6O 3FOOA 1TQGA 4CJOA 3M79A 5D91A 1YA7O 1CPRA 2IXOA 3M4BA 3NYMA 3M1CB 3B0VC 5T3WA 3RW0A 3CD6L 1A7DA 2A0UA 4EUKB 4MVOA 5A6JA 4G7OF 1Q0KA 4LLEA 2P6VA 3S27A 1E86A 3G50A 2ZPAA 2Q9CA 4U5BE 4J32B 1VQNL 4N6HA 2AU5A 1V55C 4I1OB 2NUPA 1E85A 1HW1A 1ZVZA 1JPJA 1NLXA 2R7VA 3DM5A 4RBNA 3E9VA 5E3CA 4FWVA 2GDCA 5F5FA 1Y6DA 3OW2K 4HFFB 3AOUA 5E3AA 1FNTc 1YDIA 3K1IC 3VM6A 2KJGA 3HLZA 1L3PA 3ZSUA 2JX0A 3H65A 1Z7Qc 1JOGA 3Q7GA 1Q0FA 2OJQA 2VCAA 3K7DA 4DJ9A 3EGXA 5KYXA 3FAPB 4ER9A 2XL4A 2Q3TA 4JRZA 3U9MA 1MMAA 4FX5A 3LESA 3QW0A 1QPUA 4U5HA 2PP4A 2DGJA 1QLEC 5DS6A 4LDQA 1Q81P 3TK0A 2KC3A 4MVZA 2C03A 3DWWA 5JSLA 2Q4FA 2ZXPA 1RKCA 3JSZA 5BQHA 4ONSA 2OTJO 4NTBA 1R4TA 1JRAA 4F4BA 2JD3A 4YWQA 1YZCA 1QVXA 2OTJL 2LSEA 3C7JA 3EG9A 4CSAC 3K33A 4DRIB 4C3BA 2F22A 1T01A 4QI2A 3RIPA 2YLGA 2FGYA 3FVYA 5COGA 3CCRO 2A68F 5A6AA 4CS7A 4OIQF 2R25A 2YEVA 1FR0A 4BJ6A 2QEXL 3CCRL 4CDYA 4Q5SF 4D4XA 1YARO 5CIVA 4BPMA 2J9UA 4O79A 1ST6A 4XLNF 3PCVA 1ZU5A 1LVKA 1QVGN 4I3MA 3B71A 1VMAA 1ZW2A 2VCBA 2YLDA 4KNVA 2QTVA 4JVSA 3U9JA 1LPEA 4GEHA 3WG7C 2Y3GA 2NG1A 4O6MA 2C04A 3EFOB 2EILC 1CGOA 3LNRA 4P6IC 2WZLA 3S28A 3QMKA 1Q82P 3U8PA 3GANA 5JT4A 3I56O 4ULWA 4PJNA 2R7QA 1JMWA 3EZHA 4WABA 2R7TA 3U3BA 1NFNA 2L9JA 2EIMC 5JLIA 5JUAA 2DYRC 3I56L 2BC5A 1D1BA 1KC8P 3NMKA 3EHNA 1ZZPA 4MS2A 4Q7CA 2R7UA 4EHPA 1QVFN 2QA4L 2DI3A 2YRFA 3MX3A 4JEAA 4U9EA 3AGTA 3QZCA 2TMVP 5L0DA 4XEFA 1VQ8O 4YT8A 2BE5F 3AG4C 3N24A 1OW7A 1K04A 4ZLDA 1CGNA 5COFA 4C3DA 3HNJA 4U5DE 1VQ8L 1S05A 2W4MA 2YL3A 3J06A 1K9MP 2M64A 3B29A 4KC9A 4LDRA 2G3KA 3DAFA 1M1KM 2IXNA 1MQVA 4JCHA 4YJWA 3LS0A 3U0CA 3SXKA 2WZFA 4Z9HA 4U5GA 3EHMA 3U5SA 4EBBA 1K73P 3ABMC 4CJGA 2XS8A 3UMKA 1MMNA 3KKBA 2H7VC 1WTYA 2OQMA 3ASNC 3L8IA 1KQSK 2EINC 2XLEA 1YITO 3CXCK 3IQ6A 3X1OA 3TJ6A 3ASOC 4XPWA 2G3VA 4OD5A 3H2VA 4YL0A 4XEVA 2OCCC 3JYHA 3G71O 1YITL 3ZC4A 3IPMO 3IHUA 2VCCA 1D0YA 1VQKO 2J45A 3AG3C 4BG0A 4MW3A 4AX2A 3RVYA 3G71L 4JTAB 3FHDA 4CDVA 4N4WA 1ZU4A 4O7GA 1VQKL 1HE1A 3Q7LA 3TULA 2KYHA 2XLMA 1JJ2K 3SXMA 5KYUB 2KSFA 1S72O 1LS1A 1G4WR 2J8WA 3BRJA 1ZW3A 1W2WA 1N8RP 1HMDA 1W2BK 2A69F 1OCCC 1OW8A 3NYJA 1M56C 2A1DD 2GWWA 3NMJA 1OQCA 4D4NA 2DYSC 2KW3C 3LEVA 2XLDA 3EFOA 1ZHZA 2WVNA 2W9YA 3M4CA 5FCLA 1NU9C 2LP4A 3DXJF 1LIHA 3LS1A 5A6KA 3ABLC 2H7OA 2Q7RA 2BL2A 2KQ9A 3T6JA 2Z15A 1I5NA 4IWBA 5KYXB 4OIPF 3G6EL 1V54C 1YI2O 4H54A 4PJLA 5L0GA 1SZIA 2QNLA 3LUTB 4BJ5A 2OG2A 1YI2L 4JURI 2YHSA 3M15A 3RH3A 1SYQA 4C7OB 2X51A 4E7ZA 2R02A 4G7ZF 3HNIA 3AQBA 3F47A 4X0RA 3TOMA 3FMSA 3GWNA 4NTFA 3LLIA 3R2PA 3W8IA 4YL3A 2VASA 3EH2A 1TFOB 2J9VA 3EG9B 3RQGA 1NJIP 1PD1A 1H6GA 2KGOA 1YAUO 1SF8A 5KYWA 1S7ZA 3O39A 1VOMA 2A0BA 1AVOB 1VB5A 1MNDA 2R05A 3POVA 1YVIA 3CPWK 5EK0A 2XLOA 4G0HA 3JZ0A 1NSGB 2M4EA 1ZYRF 1NFOA 1UFBA 1U0BB 1RJ9A 5E33A 5TJ5E 1Q0DA 1BZ4A 5AC4A 2HS5A 1A0BA 3SXZA 3H2UA 1LS4A 3Q6NA 4JCZA 2W4BA 2HKVA 256BA 2XSEA 2VC9A 1JR8A 1RCPA 1GQAA 1E83A 4JJGA 1C02A 3SP1A 3T6GB 5KYUA 1RKEB 4A2NB 2LQGA 2NSGA 1FAPB 1YZAA 2HJ3A 3UMHA 1VLTA 5DLJA 5IY5C 1OKKA 3FXHA 2V26A 2XM0A 1KTMA 3HNLA 3KYJA 2PX3A 3EGDA 3I5QA 1KC8M 1EI7A 5AGFA 1ORYA 2CDQA 3CCUO 3AQCA 3GODA 2YL0A 4BJ1A 4NTAA 1Q86P 3QVYA 3DD7A 5AC5A 1NZEA 2ZD9A 2CGEA 3GEIA 3KH2A 3I4UA 3CCUL 1VQ5O 3O55A 1NG1A 4QI0A 4IAQA 2XLVA 2WZGA 2RSEB 1VQ5L 1OXBA 4MVRA 3HNKA 2AP3A 4U5CE 3W2WA 1VQPO 5KYNA 3DZAA 5EGYA 3QW1A 4MQ9F 4C7OA 4NY3A 5DQZA 4OD4A 1VQPL 4EIYA 2OTLO 2V3CC 4MVUA 2J46A 3NKEA 4A4AA 1K05A 2OEVA 2OTLL 2CYDA 2XRHA 3CQZA 4K7BA 3JTLO 1YJ9O 2R9RB 1BR2A 1OCOC 5JVEA 4JC7A 1APCA 4DVZA 1CPQA 3UMIA 3DI5A 4BEJA 1J8YF 4CS8A 3U2MA 1YJ9L 4GQHA 4IRUA 4NCQA 3S90A 4AE4A 3DMDA 1OR3A 3C8GB 2PX0A 2YWAA 4BJ5C 1CGME 3PMRA 2HV7A 4KBLA 1VTMP 3CCMO 3OEOA 1M90P 5CI9A 1LI7A 4CIPA 2ZXOA 3MFNA 3CCML 1L7CA 5EHHA 1A7VA 4I44A 4DRJB 5B1BC 4DBRA 2HSQA 1J8MF 1Z6AA 2RD9A 4WJ0A 2YKZA 4N06A 3MBGA 1RKEA 1WGWA 1Z3IX 4NC3A 3CCSO 3LAYA 4AL0A 2WL8A 1LI5A 1VQOO 1WN0A 5E2QA 1PCXA 2Y3HA 4MNDA 1PV3A 1VYKA 3R7CA 4K1OA 3CCSL 3IQTA 2Q9BA 3NMIA 1Q7YM 1VQOL 5DS4A 3WODF 1M2OA 2HSBA 1NBBA 4CS9A 2OJED 1VYIA 2ZXRA 3U2LA 2PF4E 5KYYB 3UNGC 4OIOF 4KI2A 4MTOA 4RDAA 1SR2A 1LE2A 1VQ4O 4ZLCA 2XL6A 3KMIA 1O87A 5B3IA 3C18A 3OW2N 4E17A 3CC7O 1MNEA 3ABKC 2HMZA 2QY9A 4HEAJ 2QE9A 2P7VA 1TKNA 2FAPB 3L34A 1T6UA 3CC7L 5KYWB 5K0IA 2HUJA 4H4KC 2OEXA 4XTKA 1NJIM 5L0IA 2B0JA 3I55O 3F46A 2LCHA 5L3QA 2GA0A 4XLPF 4JE9A 1PD0A 3MYIA 1YLMA 3CCLO 1EQ1A 4PACA 2J7PA 3I55L 4MVQA 2I8BA 1OKKD 3LNMB 3CCLL 4Q4ZF 1RJ9B 4PR9A 4E18A 2D5RB 3CCVO 4O6YA 1KD1P 2HJMA 4CX9A 3JSEO 3S84A 3ATPA 4MVMA 4R32A 1G8XA 4QDLA 1OXKA 3C63A 1XWJA 1RMVA 1WASA 4CDAA 4IARA 2L6GA 2MHRA 5L3VA 3C8GA 5JS5A 3JCUQ 1Z23A 2Q9AA 4IJJA 1A7EA 4EBKA 1TFKB 2D4UA 3CCEO 3I5PA 1NU7D 3Q6MA 1S72L 1ORJA 3K66A 2H7BA 1F1MA 4IGGA 1M57C 4E7SA 3CCEL 2XXAA 1H9TA 1B68A 4XPYA 4YK5A 3TOLA 3EGDB 1VLSA 1UG7A 3JRMO 4Z9IA 1LKXA 1Y4CA 4JJFA 2G62A 4YL1A 3K6BA 1H7IA 4PK4A 4L6RA 3T6BA 1TWAA 2X0CA 3PDMP 1O3UA 4PFOA 1N1CA 3VAYA 3W4YA 3FAJA 4CS8C 2ICWG 1T9KA 2R7WA 1Q86M 2H8AA 2MYSA 3GEHA 4N6CA 4BJ6C 2KK1A 3DJUB 5F28E 1GS9A 3GEEA 2KNHA 1IZMA 1YYJA 4W8PA 5L0FA 4MTFA 5KYYA 4XWJA 4OINF 1M2VA 1BR4A 3ZQYA 1Q81M 3DKAA 1Z63A 4J7TA 4ANJA 4E0HA 4HFKB 3GM3A 3LEOA 2IXMA 3CC4O 1FMWA 3DM9B 2XLHA 4IAOA 4DBQA 5FZTA 1EKYA 1T6QA 4G78A 2MWQA 4LERA 2DB4A 1M1KP 1BR1A 1LE4A 4RD9A 2Y39A 2AVKA 3CC4L 3VYWA 1TWHA 3EH1A 3SXYA 3ZQVA 2R7RA 3MYFA 3G4SO 2GFHA 5HSWA 3AG2C 3VRCA 1FFTC 1K40A 2R03A 1OCRC 4AE4B 1YYXA 3IQCA 1JAFA 3V5ZA 1QVGK 1OCZC 1FTSA 3L0IA 1T6IA 4I1MA 2GAQA 2Y3BA 3UGPA 1O5HA 4C3EA 4CS9C 4XPXA 1VQ6O 2W45A 1A41A 5L0HA 3QVZA 3B0PA 3GORA 4UDVA 2NUTA 2EIKC 4JEBA 1R5ID 3CMEO 1V4AA 1ZHTA 2IYLD 1VQ6L 2P0NA 1M90M 1WWPA 4WGYA 2IBFA 1KQSN 3CMEL 3CXCN 1I4YA 2LFFA 2JPUA 2YVKA 4U5FE 4P9FA 3AJMA 3GWLA 2A6EF 3RVZA 2QLAA 1VQNO 3ZWIA 1Z5ZA 5A69A 3T9OA 5GPGB 1QVFK 1Q82M 3C8ZA 2LD6A 1SMYF 3W8HA 3EQLF 3EZIA 4XQ1A 3IQ5A 3SZRA 5HV9A 3DAGA 3V7OA 1JJ2N 2UUIA 1OW6A 3ZDLA 2XL8A 2J9WA 1ORSC 3K1HA 4W8KA 1HW2A 3JRTA 2J7PD 1W2BN 1GGQA 4GYTA 5DS5A 3A9CA 5BQGA 4K0DA 2EPNA 2CNWA 3SEOA 1RXQA 2YL1A 3TJ5A 3KL4A 4JIOA 1LM3B 3KYIA 3NKDA 4YN0B 3O6XA 1TWGA 1BDJB 1U6HA 2B0HA 2OKUA 4DXWA 2NPUA 2O9XA 1K9MM 5L0JA 1VQ7O 1AUEA 3EJNA 3ZVRA 4NQFA 3C8GD 1C03A 1VQ7L 1K8AP 4DRHB 3G4ZA 3CEXA 1G4US 3AG1C 2P1AA 5L0CA 2ETSA 1K73M 2WB7A 5A6BA 2Q00A 2J9BA 3BEHA 1QSPA 2EPLX 1G5ZA 1YIJO 1IW7F 4J7YA 5B1AC 4EKWA 1HY5A 4G7HF 5B3SC 1YIJL 1U89A 1TWCA 2P61A 1YJGA 1D0ZA 1KD1M 1EA8A 4FESA 3G4XA 1HE9A 4MVSA 4M63A 2QEXO 3CCJO 1MMGA 3NRHA 2I15A 3CC2O 1ZHXA 3L1MA 2R7SA 3CCJL 3A11A 3WAQA 2XS1A 3CC2L 3S0XA 1DOVA 2XXAB 3AGUA 1N8RM 3O10A 3CAXA 4AK9A 3SYNA 3CPWN 4LACB 2XM4A 4OIRF 4EWCA 3CSKA 3UGOA 5BQIA 4E0IA 1GM5A 3LJBA 1WATA 4WGZA 2EIJC 3NDBB 2R7XA 3QTHA 3HKKA 4JTDB 3GM1A 2R7OA 1D1AA 3ECSA
chains in the Genus database with same CATH topology
1S7ZA 1MMAA 4FX5A 3O39A 4CBEA 1VOMA 3LESA 3JCUQ 4B6IA 4U5HA 1Z23A 2Q9AA 2PP4A 3IEEA 3NYLA 4IJJA 5DQTA 1YJWO 2DGJA 1QLEC 5DS6A 1Q81P 3CCEO 2QA4O 3I5PA 1QZXA 1ZHYA 1NU7D 3Q6MA 1MNDA 1S72L 2C03A 3K66A 2H7BA 3POVA 1YJWL 3CPWK 4YT4A 1M2VB 2ZXPA 4HE8D 1M57C 4E7SA 1VQMO 3CCEL 4G0HA 2XXAA 2M4EA 3JSZA 5F5HA 2OTJO 1ZYRF 3UR3C 3EGDB 2CW0F 1TR2A 1RJ9A 1LKXA 5E33A 4F4BA 2JD3A 4YWQA 1VQML 4JJFA 2G62A 1VQ4L 2OTJL 2LSEA 3K6BA 3LLKA 1YJNO 3EG9A 4CSAC 4PK4A 3K33A 3Q6NA 3T6BA 1TWAA 4C3BA 1JPNA 4QI2A 2Y3DA 2W4BA 3RIPA 4PFOA 2FGYA 2XSEA 4DOZA 1N1CA 3VAYA 3FAJA 4CS8C 3FVYA 1YJNL 2R7WA 3CZ6A 1Q86M 3CCRO 4JJGA 3RFYA 4BJTA 3SP1A 5KYUA 2A68F 2MYSA 4A2NB 4BJ6C 4CS7A 3DJUB 4OIQF 2YEVA 2KNHA 4BJ6A 2QEXL 1IZMA 3CCRL 4Q5SF 3UMHA 5DLJA 4PJJA 5IY5C 5KYYA 3TD7A 1OKKA 3W2VA 2V26A 4XWJA 4OINF 2J9UA 4O79A 1M2VA 1BR4A 1ST6A 3NG1A 4XLNF 1Q81M 1ZU5A 1LVKA 1QVGN 3HTKC 2ZXWC 4I3MA 1Z63A 4ANJA 2PX3A 3EGDA 2NUTB 3I5QA 4HFKB 3EPVA 1KC8M 2WVOA 3CCQO 3X2QC 1VMAA 2IXMA 3CC4O 1FMWA 2CDQA 3DM9B 4DBQA 4IAOA 3CCUO 3AQCA 5CI8A 4KNVA 2J0XA 2QTVA 3GODA 4BJ1A 4JVSA 3N0TA 1Q86P 1VQLO 2MWQA 3DD7A 4GEHA 4LERA 3RYLA 3WG7C 3CCVL 1BR1A 1NZEA 1M1KP 3CCQL 4RD9A 3DJNB 2CGEA 2Y39A 4O6NA 1YHQO 2Y3GA 3KH2A 2NG1A 4O6MA 3CC4L 3VYWA 3I4UA 2C04A 3EFOB 3CCUL 1VQ5O 4DVYP 2EILC 3LNRA 4P6IC 1TWHA 2WZLA 3EH1A 3S28A 3OWTA 2R7RA 3QMKA 1Q82P 1VQLL 2CNWD 1NG1A 3GANA 4QI0A 4U5EE 3ZIBA 3I56O 2GFHA 5HSWA 3G4SO 3AG2C 1FFTC 1YHQL 4ULWA 4PJNA 2WZGA 2R7QA 1VQ5L 3EZHA 1OCRC 2R7TA 3SNHA 4AE4B 1D1CA 4U5CE 2L9JA 2EIMC 3W2WA 2DYRC 3JT1A 3I56L 3CMAO 1D1BA 5D92A 1VQPO 1QVGK 1OCZC 5T3TA 1FTSA 1KC8P 3L0IA 1VQ9O 5KYNA 3DZAA 3EHNA 5EGYA 4LLCA 2Y69C 4I1MA 2Y3BA 4CIHA 3UGPA 1O5HA 4C3EA 2NUPB 4Q7CA 2R7UA 1QVFN 4CS9C 4MQ9F 4C7OA 2QA4L 4NY3A 1VQ6O 2W45A 5DQZA 3CMAL 4OD4A 5BUOA 3B0PA 1VQPL 3MX3A 3S29A 3B0UX 2OTLO 1VQ9L 5DVWA 2NUTA 2EIKC 2V3CC 2J46A 3QZCA 3CMEO 1VQ8O 4PJMA 1ZHTA 4YT8A 3B9QA 2IYLD 3NKEA 2BE5F 1VQ6L 3AG4C 3N24A 1M90M 2OTLL 4ZLDA 4C3DA 1KQSN 2XRHA 4U5DE 3CMEL 3CQZA 4K7BA 3CXCN 1VQ8L 2W4MA 1YJ9O 4CSAA 1KU2A 1BR2A 1OCOC 4U5FE 2L81A 1FFHA 1K9MP 4DVZA 2FFHA 3FDQA 3UMIA 4KC9A 2G3KA 2A6EF 3DAFA 3G6EO 3ZG1A 1J8YF 2IXNA 3MLGA 4BEJA 4CS8A 1M1KM 1YJ9L 4JCHA 1VQNO 4IRUA 3LS0A 1Z5ZA 4YJWA 1Q7YP 4YT5A 4AE4A 1D0XA 4JW1A 1QVFK 3EGXB 2IOQA 3DMDA 1Q82M 2WZFA 2YZSA 1SMYF 3ITFA 4U5GA 3EHMA 2PX0A 4BJ5C 3W8HA 3EQLF 3PMRA 2HV7A 4KBLA 4EBBA 3EZIA 3ABMC 3OA1A 3CCMO 1K73P 3UMKA 1MMNA 3OEOA 3KKBA 1M90P 2H7VC 3SZRA 5CI9A 3DAGA 3V7OA 4YT2A 1FMVA 1JJ2N 3ASNC 3RKOF 2ZXOA 1KQSK 2EINC 1YITO 3CXCK 2E87A 3CCML 2A6HF 3X1OA 2J9WA 5EHHA 3ASOC 2G3VA 4OD5A 3K1HA 4JZAA 4W8KA 5T1DB 3JRTA 2J7PD 4I44A 1W2BN 5B1BC 4GYTA 1K8AM 5DS5A 3HJCA 2PFDA 2OCCC 4DBRA 3JYHA 4K0DA 3G71O 1YITL 2HV6A 2CNWA 2IXPA 3SEOA 1J8MF 1VK5A 3ZC4A 1Z6AA 2VB6A 2J0WA 3N2ZB 3KL4A 4WJ0A 1D0YA 1VQKO 2J45A 3AG3C 4N06A 4BG0A 4YN0B 3NKDA 3O6XA 1TWGA 4AX2A 3G71L 3FHDA 1WGWA 1Z3IX 3E70C 3CCSO 4KNWA 1ZU4A 3LAYA 2WVQA 4O7GA 2WL8A 1VQKL 1VQOO 2O9XA 1MMDA 1K9MM 5E2QA 1PCXA 3PHF2 2Y3HA 4MNDA 3G4SL 1VYKA 1VQ7O 3Q7LA 3CCSL 3EJNA 3ZVRA 1JJ2K 2Q9BA 5KYUB 1Q7YM 1S72O 1ZHWA 1LS1A 1VQOL 5DS4A 3WODF 1M2OA 4PFPA 1VQ7L 1W2WA 1K8AP 1N8RP 1W2BK 4CS9A 4J30B 1VYIA 2ZXRA 3T4RA 2VH3A 2A69F 1OCCC 2PF4E 5KYYB 3CD6O 3UNGC 3NYJA 3AG1C 4OIOF 4KI2A 5D91A 4RDAA 1K73M 1M56C 2IXOA 2WB7A 2A1DD 3NYMA 3M1CB 3B0VC 1VQ4O 4ZLCA 2DYSC 1YIJO 5T3WA 3CD6L 1IW7F 2KW3C 3LEVA 3KMIA 3EFOA 1O87A 5B1AC 1ZHZA 2WVNA 3OW2N 2W9YA 5FCLA 4G7HF 3CC7O 4G7OF 1NU9C 3DXJF 5B3SC 3LS1A 1YIJL 1MNEA 3ABKC 4LLEA 2QY9A 4HEAJ 2P6VA 1TWCA 2P7VA 3S27A 3ABLC 1TKNA 2H7OA 2KQ9A 3L34A 3T6JA 1D0ZA 2Z15A 4IWBA 1KD1M 3CC7L 5KYXB 4FESA 4OIPF 5KYWB 2ZPAA 2Q9CA 1V54C 3G6EL 1YI2O 4H4KC 4U5BE 4J32B 4M63A 1VQNL 2QEXO 4XTKA 4PJLA 3CCJO 1NJIM 1V55C 1SZIA 4I1OB 1MMGA 3NRHA 2NUPA 2B0JA 3I55O 3CC2O 1ZHXA 3F46A 4BJ5A 5L3QA 2OG2A 1YI2L 4XLPF 2R7SA 1JPJA 1PD0A 4JURI 2R7VA 3DM5A 2YHSA 3CCJL 3CCLO 4RBNA 3RH3A 3E9VA 5E3CA 2J7PA 4FWVA 3I55L 3CC2L 3S0XA 5F5FA 3OW2K 2I8BA 4C7OB 2X51A 4HFFB 1OKKD 4E7ZA 2XXAB 4G7ZF 1N8RM 3AQBA 3CCLL 3F47A 4X0RA 4AK9A 3SYNA 5E3AA 4Q4ZF 1RJ9B 3CPWN 4LACB 2D5RB 3CCVO 4O6YA 1KD1P 3LLIA 4OIRF 4EWCA 3W8IA 3CSKA 3UGOA 3K1IC 2VASA 3EH2A 2KJGA 3HLZA 2J9VA 3ZSUA 3H65A 1G8XA 3EG9B 3LJBA 1NJIP 1PD1A 2EIJC 3NDBB 4QDLA 2R7XA 2KGOA 3Q7GA 3K7DA 3EGXA 5KYXA 2R7OA 2XL4A 1D1AA 1SF8A 2Q3TA 5KYWA 3ECSA 5L3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKD A;  5DQZ A;  4WJ0 A;  5DLJ A;  3NKE A;  4QDL A;  4XTK A;  5DS4 A;  5DQT A;  2YZS A;  5FCL A;  5DS5 A;  3GOD A;  4P6I C;  4N06 A;  4W8K A;  5DS6 A; 
#chains in the Genus database with same CATH topology
 3ZTM A;  4CBE A;  4B6I A;  3NYL A;  3IEE A;  4FAP B;  5DQT A;  1YJW O;  2YLI A;  2QA4 O;  1QZX A;  1ZHY A;  3TQO A;  1WOL A;  2YQY A;  1KNY A;  1YJW L;  4YT4 A;  1M2V B;  4HE8 D;  1VQM O;  5F5H A;  4XEK A;  1E2X A;  4JKV A;  3UR3 C;  3V5Y A;  2CW0 F;  2AWY A;  1TR2 A;  1YA9 A;  5JRA A;  2LIG A;  1VQM L;  2HFI A;  1VQ4 L;  2NSF A;  1BBH A;  3LLK A;  1YJN O;  2PNO A;  1JPN A;  2Y3D A;  4DOZ A;  2UUH A;  1YJN L;  2AWC A;  3CZ6 A;  3RFY A;  4BJT A;  4P9T A;  4LDK A;  4PJJ A;  3TD7 A;  3W2V A;  5COM A;  3NG1 A;  3HTK C;  1I4Z A;  4IB4 A;  2ZXW C;  1E84 A;  2NUT B;  3EPV A;  2WVO A;  3V5X A;  3CCQ O;  3X2Q C;  3JYY A;  5CI8 A;  2J0X A;  2LFD A;  3N0T A;  2L6H A;  1VQL O;  1XZQ A;  3K1I A;  3RYL A;  3CCV L;  3CCQ L;  3RF3 A;  3DJN B;  4O6N A;  1YHQ O;  2IM8 A;  1C17 M;  1DOW A;  4DVY P;  2EPM X;  3OWT A;  1VQL L;  2CNW D;  1HMO A;  4U5E E;  3ZIB A;  1Q0M A;  3KPH A;  1YHQ L;  4MTG A;  1QKR A;  3SNH A;  3RQF A;  3C62 A;  1XZP A;  1D1C A;  2YL7 A;  4JTC B;  3ZTZ A;  3JT1 A;  3CMA O;  1T5O A;  4MW8 A;  5D92 A;  5T3T A;  2QUP A;  3U8V A;  3US6 A;  1VQ9 O;  2HMQ A;  2XLW A;  4LLC A;  2Y69 C;  3DE9 A;  4CIH A;  3L8J A;  2NUP B;  3CMA L;  5BUO A;  3S29 A;  3B0U X;  1VQ9 L;  5DVW A;  4PJM A;  2EPK X;  3B9Q A;  1OR2 A;  5A6B D;  4ULV A;  2ASR A;  2L6F A;  1KU2 A;  2L7A A;  4CSA A;  2L81 A;  1FFH A;  2FFH A;  4U9D A;  3FDQ A;  3G6E O;  3ZG1 A;  2OU6 A;  3MLG A;  1Q7Y P;  4YT5 A;  1D0X A;  4JW1 A;  3EGX B;  2IOQ A;  1Q0G A;  2EPO A;  2YZS A;  3ITF A;  2CCY A;  1M6T A;  2HZ8 A;  3OA1 A;  4EBJ A;  4YT2 A;  3RQE A;  1FMV A;  3RKO F;  2OOC A;  5JP7 A;  2E87 A;  2A6H F;  3VF0 A;  4JZA A;  3FOP A;  5T1D B;  1K8A M;  1V74 B;  3HJC A;  2PFD A;  3WHN A;  2HV6 A;  2IXP A;  1VK5 A;  2VB6 A;  2J0W A;  1QQ3 A;  3N2Z B;  3E70 C;  4KNW A;  2WVQ A;  2PBE A;  3U3F A;  3DE8 A;  1MMD A;  3PHF 2;  3G4S L;  1AEP A;  3GM2 A;  4BEM J;  4AL1 A;  1ZHW A;  3S9O A;  2LK4 A;  4Z9J A;  1H9G A;  4PFP A;  4J30 B;  3T4R A;  2VH3 A;  3CD6 O;  3FOO A;  1TQG A;  4CJO A;  3M79 A;  5D91 A;  1YA7 O;  1CPR A;  2IXO A;  3M4B A;  3NYM A;  3M1C B;  3B0V C;  5T3W A;  3RW0 A;  3CD6 L;  1A7D A;  2A0U A;  4EUK B;  4MVO A;  5A6J A;  4G7O F;  1Q0K A;  4LLE A;  2P6V A;  3S27 A;  1E86 A;  3G50 A;  2ZPA A;  2Q9C A;  4U5B E;  4J32 B;  1VQN L;  4N6H A;  2AU5 A;  1V55 C;  4I1O B;  2NUP A;  1E85 A;  1HW1 A;  1ZVZ A;  1JPJ A;  1NLX A;  2R7V A;  3DM5 A;  4RBN A;  3E9V A;  5E3C A;  4FWV A;  2GDC A;  5F5F A;  1Y6D A;  3OW2 K;  4HFF B;  3AOU A;  5E3A A;  1FNT c;  1YDI A;  3K1I C;  3VM6 A;  2KJG A;  3HLZ A;  1L3P A;  3ZSU A;  2JX0 A;  3H65 A;  1Z7Q c;  1JOG A;  3Q7G A;  1Q0F A;  2OJQ A;  2VCA A;  3K7D A;  4DJ9 A;  3EGX A;  5KYX A;  3FAP B;  4ER9 A;  2XL4 A;  2Q3T A;  4JRZ A;  3U9M A;  1MMA A;  4FX5 A;  3LES A;  3QW0 A;  1QPU A;  4U5H A;  2PP4 A;  2DGJ A;  1QLE C;  5DS6 A;  4LDQ A;  1Q81 P;  3TK0 A;  2KC3 A;  4MVZ A;  2C03 A;  3DWW A;  5JSL A;  2Q4F A;  2ZXP A;  1RKC A;  3JSZ A;  5BQH A;  4ONS A;  2OTJ O;  4NTB A;  1R4T A;  1JRA A;  4F4B A;  2JD3 A;  4YWQ A;  1YZC A;  1QVX A;  2OTJ L;  2LSE A;  3C7J A;  3EG9 A;  4CSA C;  3K33 A;  4DRI B;  4C3B A;  2F22 A;  1T01 A;  4QI2 A;  3RIP A;  2YLG A;  2FGY A;  3FVY A;  5COG A;  3CCR O;  2A68 F;  5A6A A;  4CS7 A;  4OIQ F;  2R25 A;  2YEV A;  1FR0 A;  4BJ6 A;  2QEX L;  3CCR L;  4CDY A;  4Q5S F;  4D4X A;  1YAR O;  5CIV A;  4BPM A;  2J9U A;  4O79 A;  1ST6 A;  4XLN F;  3PCV A;  1ZU5 A;  1LVK A;  1QVG N;  4I3M A;  3B71 A;  1VMA A;  1ZW2 A;  2VCB A;  2YLD A;  4KNV A;  2QTV A;  4JVS A;  3U9J A;  1LPE A;  4GEH A;  3WG7 C;  2Y3G A;  2NG1 A;  4O6M A;  2C04 A;  3EFO B;  2EIL C;  1CGO A;  3LNR A;  4P6I C;  2WZL A;  3S28 A;  3QMK A;  1Q82 P;  3U8P A;  3GAN A;  5JT4 A;  3I56 O;  4ULW A;  4PJN A;  2R7Q A;  1JMW A;  3EZH A;  4WAB A;  2R7T A;  3U3B A;  1NFN A;  2L9J A;  2EIM C;  5JLI A;  5JUA A;  2DYR C;  3I56 L;  2BC5 A;  1D1B A;  1KC8 P;  3NMK A;  3EHN A;  1ZZP A;  4MS2 A;  4Q7C A;  2R7U A;  4EHP A;  1QVF N;  2QA4 L;  2DI3 A;  2YRF A;  3MX3 A;  4JEA A;  4U9E A;  3AGT A;  3QZC A;  2TMV P;  5L0D A;  4XEF A;  1VQ8 O;  4YT8 A;  2BE5 F;  3AG4 C;  3N24 A;  1OW7 A;  1K04 A;  4ZLD A;  1CGN A;  5COF A;  4C3D A;  3HNJ A;  4U5D E;  1VQ8 L;  1S05 A;  2W4M A;  2YL3 A;  3J06 A;  1K9M P;  2M64 A;  3B29 A;  4KC9 A;  4LDR A;  2G3K A;  3DAF A;  1M1K M;  2IXN A;  1MQV A;  4JCH A;  4YJW A;  3LS0 A;  3U0C A;  3SXK A;  2WZF A;  4Z9H A;  4U5G A;  3EHM A;  3U5S A;  4EBB A;  1K73 P;  3ABM C;  4CJG A;  2XS8 A;  3UMK A;  1MMN A;  3KKB A;  2H7V C;  1WTY A;  2OQM A;  3ASN C;  3L8I A;  1KQS K;  2EIN C;  2XLE A;  1YIT O;  3CXC K;  3IQ6 A;  3X1O A;  3TJ6 A;  3ASO C;  4XPW A;  2G3V A;  4OD5 A;  3H2V A;  4YL0 A;  4XEV A;  2OCC C;  3JYH A;  3G71 O;  1YIT L;  3ZC4 A;  3IPM O;  3IHU A;  2VCC A;  1D0Y A;  1VQK O;  2J45 A;  3AG3 C;  4BG0 A;  4MW3 A;  4AX2 A;  3RVY A;  3G71 L;  4JTA B;  3FHD A;  4CDV A;  4N4W A;  1ZU4 A;  4O7G A;  1VQK L;  1HE1 A;  3Q7L A;  3TUL A;  2KYH A;  2XLM A;  1JJ2 K;  3SXM A;  5KYU B;  2KSF A;  1S72 O;  1LS1 A;  1G4W R;  2J8W A;  3BRJ A;  1ZW3 A;  1W2W A;  1N8R P;  1HMD A;  1W2B K;  2A69 F;  1OCC C;  1OW8 A;  3NYJ A;  1M56 C;  2A1D D;  2GWW A;  3NMJ A;  1OQC A;  4D4N A;  2DYS C;  2KW3 C;  3LEV A;  2XLD A;  3EFO A;  1ZHZ A;  2WVN A;  2W9Y A;  3M4C A;  5FCL A;  1NU9 C;  2LP4 A;  3DXJ F;  1LIH A;  3LS1 A;  5A6K A;  3ABL C;  2H7O A;  2Q7R A;  2BL2 A;  2KQ9 A;  3T6J A;  2Z15 A;  1I5N A;  4IWB A;  5KYX B;  4OIP F;  3G6E L;  1V54 C;  1YI2 O;  4H54 A;  4PJL A;  5L0G A;  1SZI A;  2QNL A;  3LUT B;  4BJ5 A;  2OG2 A;  1YI2 L;  4JUR I;  2YHS A;  3M15 A;  3RH3 A;  1SYQ A;  4C7O B;  2X51 A;  4E7Z A;  2R02 A;  4G7Z F;  3HNI A;  3AQB A;  3F47 A;  4X0R A;  3TOM A;  3FMS A;  3GWN A;  4NTF A;  3LLI A;  3R2P A;  3W8I A;  4YL3 A;  2VAS A;  3EH2 A;  1TFO B;  2J9V A;  3EG9 B;  3RQG A;  1NJI P;  1PD1 A;  1H6G A;  2KGO A;  1YAU O;  1SF8 A;  5KYW A;  1S7Z A;  3O39 A;  1VOM A;  2A0B A;  1AVO B;  1VB5 A;  1MND A;  2R05 A;  3POV A;  1YVI A;  3CPW K;  5EK0 A;  2XLO A;  4G0H A;  3JZ0 A;  1NSG B;  2M4E A;  1ZYR F;  1NFO A;  1UFB A;  1U0B B;  1RJ9 A;  5E33 A;  5TJ5 E;  1Q0D A;  1BZ4 A;  5AC4 A;  2HS5 A;  1A0B A;  3SXZ A;  3H2U A;  1LS4 A;  3Q6N A;  4JCZ A;  2W4B A;  2HKV A;  256B A;  2XSE A;  2VC9 A;  1JR8 A;  1RCP A;  1GQA A;  1E83 A;  4JJG A;  1C02 A;  3SP1 A;  3T6G B;  5KYU A;  1RKE B;  4A2N B;  2LQG A;  2NSG A;  1FAP B;  1YZA A;  2HJ3 A;  3UMH A;  1VLT A;  5DLJ A;  5IY5 C;  1OKK A;  3FXH A;  2V26 A;  2XM0 A;  1KTM A;  3HNL A;  3KYJ A;  2PX3 A;  3EGD A;  3I5Q A;  1KC8 M;  1EI7 A;  5AGF A;  1ORY A;  2CDQ A;  3CCU O;  3AQC A;  3GOD A;  2YL0 A;  4BJ1 A;  4NTA A;  1Q86 P;  3QVY A;  3DD7 A;  5AC5 A;  1NZE A;  2ZD9 A;  2CGE A;  3GEI A;  3KH2 A;  3I4U A;  3CCU L;  1VQ5 O;  3O55 A;  1NG1 A;  4QI0 A;  4IAQ A;  2XLV A;  2WZG A;  2RSE B;  1VQ5 L;  1OXB A;  4MVR A;  3HNK A;  2AP3 A;  4U5C E;  3W2W A;  1VQP O;  5KYN A;  3DZA A;  5EGY A;  3QW1 A;  4MQ9 F;  4C7O A;  4NY3 A;  5DQZ A;  4OD4 A;  1VQP L;  4EIY A;  2OTL O;  2V3C C;  4MVU A;  2J46 A;  3NKE A;  4A4A A;  1K05 A;  2OEV A;  2OTL L;  2CYD A;  2XRH A;  3CQZ A;  4K7B A;  3JTL O;  1YJ9 O;  2R9R B;  1BR2 A;  1OCO C;  5JVE A;  4JC7 A;  1APC A;  4DVZ A;  1CPQ A;  3UMI A;  3DI5 A;  4BEJ A;  1J8Y F;  4CS8 A;  3U2M A;  1YJ9 L;  4GQH A;  4IRU A;  4NCQ A;  3S90 A;  4AE4 A;  3DMD A;  1OR3 A;  3C8G B;  2PX0 A;  2YWA A;  4BJ5 C;  1CGM E;  3PMR A;  2HV7 A;  4KBL A;  1VTM P;  3CCM O;  3OEO A;  1M90 P;  5CI9 A;  1LI7 A;  4CIP A;  2ZXO A;  3MFN A;  3CCM L;  1L7C A;  5EHH A;  1A7V A;  4I44 A;  4DRJ B;  5B1B C;  4DBR A;  2HSQ A;  1J8M F;  1Z6A A;  2RD9 A;  4WJ0 A;  2YKZ A;  4N06 A;  3MBG A;  1RKE A;  1WGW A;  1Z3I X;  4NC3 A;  3CCS O;  3LAY A;  4AL0 A;  2WL8 A;  1LI5 A;  1VQO O;  1WN0 A;  5E2Q A;  1PCX A;  2Y3H A;  4MND A;  1PV3 A;  1VYK A;  3R7C A;  4K1O A;  3CCS L;  3IQT A;  2Q9B A;  3NMI A;  1Q7Y M;  1VQO L;  5DS4 A;  3WOD F;  1M2O A;  2HSB A;  1NBB A;  4CS9 A;  2OJE D;  1VYI A;  2ZXR A;  3U2L A;  2PF4 E;  5KYY B;  3UNG C;  4OIO F;  4KI2 A;  4MTO A;  4RDA A;  1SR2 A;  1LE2 A;  1VQ4 O;  4ZLC A;  2XL6 A;  3KMI A;  1O87 A;  5B3I A;  3C18 A;  3OW2 N;  4E17 A;  3CC7 O;  1MNE A;  3ABK C;  2HMZ A;  2QY9 A;  4HEA J;  2QE9 A;  2P7V A;  1TKN A;  2FAP B;  3L34 A;  1T6U A;  3CC7 L;  5KYW B;  5K0I A;  2HUJ A;  4H4K C;  2OEX A;  4XTK A;  1NJI M;  5L0I A;  2B0J A;  3I55 O;  3F46 A;  2LCH A;  5L3Q A;  2GA0 A;  4XLP F;  4JE9 A;  1PD0 A;  3MYI A;  1YLM A;  3CCL O;  1EQ1 A;  4PAC A;  2J7P A;  3I55 L;  4MVQ A;  2I8B A;  1OKK D;  3LNM B;  3CCL L;  4Q4Z F;  1RJ9 B;  4PR9 A;  4E18 A;  2D5R B;  3CCV O;  4O6Y A;  1KD1 P;  2HJM A;  4CX9 A;  3JSE O;  3S84 A;  3ATP A;  4MVM A;  4R32 A;  1G8X A;  4QDL A;  1OXK A;  3C63 A;  1XWJ A;  1RMV A;  1WAS A;  4CDA A;  4IAR A;  2L6G A;  2MHR A;  5L3V A;  3C8G A;  5JS5 A;  3JCU Q;  1Z23 A;  2Q9A A;  4IJJ A;  1A7E A;  4EBK A;  1TFK B;  2D4U A;  3CCE O;  3I5P A;  1NU7 D;  3Q6M A;  1S72 L;  1ORJ A;  3K66 A;  2H7B A;  1F1M A;  4IGG A;  1M57 C;  4E7S A;  3CCE L;  2XXA A;  1H9T A;  1B68 A;  4XPY A;  4YK5 A;  3TOL A;  3EGD B;  1VLS A;  1UG7 A;  3JRM O;  4Z9I A;  1LKX A;  1Y4C A;  4JJF A;  2G62 A;  4YL1 A;  3K6B A;  1H7I A;  4PK4 A;  4L6R A;  3T6B A;  1TWA A;  2X0C A;  3PDM P;  1O3U A;  4PFO A;  1N1C A;  3VAY A;  3W4Y A;  3FAJ A;  4CS8 C;  2ICW G;  1T9K A;  2R7W A;  1Q86 M;  2H8A A;  2MYS A;  3GEH A;  4N6C A;  4BJ6 C;  2KK1 A;  3DJU B;  5F28 E;  1GS9 A;  3GEE A;  2KNH A;  1IZM A;  1YYJ A;  4W8P A;  5L0F A;  4MTF A;  5KYY A;  4XWJ A;  4OIN F;  1M2V A;  1BR4 A;  3ZQY A;  1Q81 M;  3DKA A;  1Z63 A;  4J7T A;  4ANJ A;  4E0H A;  4HFK B;  3GM3 A;  3LEO A;  2IXM A;  3CC4 O;  1FMW A;  3DM9 B;  2XLH A;  4IAO A;  4DBQ A;  5FZT A;  1EKY A;  1T6Q A;  4G78 A;  2MWQ A;  4LER A;  2DB4 A;  1M1K P;  1BR1 A;  1LE4 A;  4RD9 A;  2Y39 A;  2AVK A;  3CC4 L;  3VYW A;  1TWH A;  3EH1 A;  3SXY A;  3ZQV A;  2R7R A;  3MYF A;  3G4S O;  2GFH A;  5HSW A;  3AG2 C;  3VRC A;  1FFT C;  1K40 A;  2R03 A;  1OCR C;  4AE4 B;  1YYX A;  3IQC A;  1JAF A;  3V5Z A;  1QVG K;  1OCZ C;  1FTS A;  3L0I A;  1T6I A;  4I1M A;  2GAQ A;  2Y3B A;  3UGP A;  1O5H A;  4C3E A;  4CS9 C;  4XPX A;  1VQ6 O;  2W45 A;  1A41 A;  5L0H A;  3QVZ A;  3B0P A;  3GOR A;  4UDV A;  2NUT A;  2EIK C;  4JEB A;  1R5I D;  3CME O;  1V4A A;  1ZHT A;  2IYL D;  1VQ6 L;  2P0N A;  1M90 M;  1WWP A;  4WGY A;  2IBF A;  1KQS N;  3CME L;  3CXC N;  1I4Y A;  2LFF A;  2JPU A;  2YVK A;  4U5F E;  4P9F A;  3AJM A;  3GWL A;  2A6E F;  3RVZ A;  2QLA A;  1VQN O;  3ZWI A;  1Z5Z A;  5A69 A;  3T9O A;  5GPG B;  1QVF K;  1Q82 M;  3C8Z A;  2LD6 A;  1SMY F;  3W8H A;  3EQL F;  3EZI A;  4XQ1 A;  3IQ5 A;  3SZR A;  5HV9 A;  3DAG A;  3V7O A;  1JJ2 N;  2UUI A;  1OW6 A;  3ZDL A;  2XL8 A;  2J9W A;  1ORS C;  3K1H A;  4W8K A;  1HW2 A;  3JRT A;  2J7P D;  1W2B N;  1GGQ A;  4GYT A;  5DS5 A;  3A9C A;  5BQG A;  4K0D A;  2EPN A;  2CNW A;  3SEO A;  1RXQ A;  2YL1 A;  3TJ5 A;  3KL4 A;  4JIO A;  1LM3 B;  3KYI A;  3NKD A;  4YN0 B;  3O6X A;  1TWG A;  1BDJ B;  1U6H A;  2B0H A;  2OKU A;  4DXW A;  2NPU A;  2O9X A;  1K9M M;  5L0J A;  1VQ7 O;  1AUE A;  3EJN A;  3ZVR A;  4NQF A;  3C8G D;  1C03 A;  1VQ7 L;  1K8A P;  4DRH B;  3G4Z A;  3CEX A;  1G4U S;  3AG1 C;  2P1A A;  5L0C A;  2ETS A;  1K73 M;  2WB7 A;  5A6B A;  2Q00 A;  2J9B A;  3BEH A;  1QSP A;  2EPL X;  1G5Z A;  1YIJ O;  1IW7 F;  4J7Y A;  5B1A C;  4EKW A;  1HY5 A;  4G7H F;  5B3S C;  1YIJ L;  1U89 A;  1TWC A;  2P61 A;  1YJG A;  1D0Z A;  1KD1 M;  1EA8 A;  4FES A;  3G4X A;  1HE9 A;  4MVS A;  4M63 A;  2QEX O;  3CCJ O;  1MMG A;  3NRH A;  2I15 A;  3CC2 O;  1ZHX A;  3L1M A;  2R7S A;  3CCJ L;  3A11 A;  3WAQ A;  2XS1 A;  3CC2 L;  3S0X A;  1DOV A;  2XXA B;  3AGU A;  1N8R M;  3O10 A;  3CAX A;  4AK9 A;  3SYN A;  3CPW N;  4LAC B;  2XM4 A;  4OIR F;  4EWC A;  3CSK A;  3UGO A;  5BQI A;  4E0I A;  1GM5 A;  3LJB A;  1WAT A;  4WGZ A;  2EIJ C;  3NDB B;  2R7X A;  3QTH A;  3HKK A;  4JTD B;  3GM1 A;  2R7O A;  1D1A A;  3ECS A; 
#chains in the Genus database with same CATH homology
 1S7Z A;  1MMA A;  4FX5 A;  3O39 A;  4CBE A;  1VOM A;  3LES A;  3JCU Q;  4B6I A;  4U5H A;  1Z23 A;  2Q9A A;  2PP4 A;  3IEE A;  3NYL A;  4IJJ A;  5DQT A;  1YJW O;  2DGJ A;  1QLE C;  5DS6 A;  1Q81 P;  3CCE O;  2QA4 O;  3I5P A;  1QZX A;  1ZHY A;  1NU7 D;  3Q6M A;  1MND A;  1S72 L;  2C03 A;  3K66 A;  2H7B A;  3POV A;  1YJW L;  3CPW K;  4YT4 A;  1M2V B;  2ZXP A;  4HE8 D;  1M57 C;  4E7S A;  1VQM O;  3CCE L;  4G0H A;  2XXA A;  2M4E A;  3JSZ A;  5F5H A;  2OTJ O;  1ZYR F;  3UR3 C;  3EGD B;  2CW0 F;  1TR2 A;  1RJ9 A;  1LKX A;  5E33 A;  4F4B A;  2JD3 A;  4YWQ A;  1VQM L;  4JJF A;  2G62 A;  1VQ4 L;  2OTJ L;  2LSE A;  3K6B A;  3LLK A;  1YJN O;  3EG9 A;  4CSA C;  4PK4 A;  3K33 A;  3Q6N A;  3T6B A;  1TWA A;  4C3B A;  1JPN A;  4QI2 A;  2Y3D A;  2W4B A;  3RIP A;  4PFO A;  2FGY A;  2XSE A;  4DOZ A;  1N1C A;  3VAY A;  3FAJ A;  4CS8 C;  3FVY A;  1YJN L;  2R7W A;  3CZ6 A;  1Q86 M;  3CCR O;  4JJG A;  3RFY A;  4BJT A;  3SP1 A;  5KYU A;  2A68 F;  2MYS A;  4A2N B;  4BJ6 C;  4CS7 A;  3DJU B;  4OIQ F;  2YEV A;  2KNH A;  4BJ6 A;  2QEX L;  1IZM A;  3CCR L;  4Q5S F;  3UMH A;  5DLJ A;  4PJJ A;  5IY5 C;  5KYY A;  3TD7 A;  1OKK A;  3W2V A;  2V26 A;  4XWJ A;  4OIN F;  2J9U A;  4O79 A;  1M2V A;  1BR4 A;  1ST6 A;  3NG1 A;  4XLN F;  1Q81 M;  1ZU5 A;  1LVK A;  1QVG N;  3HTK C;  2ZXW C;  4I3M A;  1Z63 A;  4ANJ A;  2PX3 A;  3EGD A;  2NUT B;  3I5Q A;  4HFK B;  3EPV A;  1KC8 M;  2WVO A;  3CCQ O;  3X2Q C;  1VMA A;  2IXM A;  3CC4 O;  1FMW A;  2CDQ A;  3DM9 B;  4DBQ A;  4IAO A;  3CCU O;  3AQC A;  5CI8 A;  4KNV A;  2J0X A;  2QTV A;  3GOD A;  4BJ1 A;  4JVS A;  3N0T A;  1Q86 P;  1VQL O;  2MWQ A;  3DD7 A;  4GEH A;  4LER A;  3RYL A;  3WG7 C;  3CCV L;  1BR1 A;  1NZE A;  1M1K P;  3CCQ L;  4RD9 A;  3DJN B;  2CGE A;  2Y39 A;  4O6N A;  1YHQ O;  2Y3G A;  3KH2 A;  2NG1 A;  4O6M A;  3CC4 L;  3VYW A;  3I4U A;  2C04 A;  3EFO B;  3CCU L;  1VQ5 O;  4DVY P;  2EIL C;  3LNR A;  4P6I C;  1TWH A;  2WZL A;  3EH1 A;  3S28 A;  3OWT A;  2R7R A;  3QMK A;  1Q82 P;  1VQL L;  2CNW D;  1NG1 A;  3GAN A;  4QI0 A;  4U5E E;  3ZIB A;  3I56 O;  2GFH A;  5HSW A;  3G4S O;  3AG2 C;  1FFT C;  1YHQ L;  4ULW A;  4PJN A;  2WZG A;  2R7Q A;  1VQ5 L;  3EZH A;  1OCR C;  2R7T A;  3SNH A;  4AE4 B;  1D1C A;  4U5C E;  2L9J A;  2EIM C;  3W2W A;  2DYR C;  3JT1 A;  3I56 L;  3CMA O;  1D1B A;  5D92 A;  1VQP O;  1QVG K;  1OCZ C;  5T3T A;  1FTS A;  1KC8 P;  3L0I A;  1VQ9 O;  5KYN A;  3DZA A;  3EHN A;  5EGY A;  4LLC A;  2Y69 C;  4I1M A;  2Y3B A;  4CIH A;  3UGP A;  1O5H A;  4C3E A;  2NUP B;  4Q7C A;  2R7U A;  1QVF N;  4CS9 C;  4MQ9 F;  4C7O A;  2QA4 L;  4NY3 A;  1VQ6 O;  2W45 A;  5DQZ A;  3CMA L;  4OD4 A;  5BUO A;  3B0P A;  1VQP L;  3MX3 A;  3S29 A;  3B0U X;  2OTL O;  1VQ9 L;  5DVW A;  2NUT A;  2EIK C;  2V3C C;  2J46 A;  3QZC A;  3CME O;  1VQ8 O;  4PJM A;  1ZHT A;  4YT8 A;  3B9Q A;  2IYL D;  3NKE A;  2BE5 F;  1VQ6 L;  3AG4 C;  3N24 A;  1M90 M;  2OTL L;  4ZLD A;  4C3D A;  1KQS N;  2XRH A;  4U5D E;  3CME L;  3CQZ A;  4K7B A;  3CXC N;  1VQ8 L;  2W4M A;  1YJ9 O;  4CSA A;  1KU2 A;  1BR2 A;  1OCO C;  4U5F E;  2L81 A;  1FFH A;  1K9M P;  4DVZ A;  2FFH A;  3FDQ A;  3UMI A;  4KC9 A;  2G3K A;  2A6E F;  3DAF A;  3G6E O;  3ZG1 A;  1J8Y F;  2IXN A;  3MLG A;  4BEJ A;  4CS8 A;  1M1K M;  1YJ9 L;  4JCH A;  1VQN O;  4IRU A;  3LS0 A;  1Z5Z A;  4YJW A;  1Q7Y P;  4YT5 A;  4AE4 A;  1D0X A;  4JW1 A;  1QVF K;  3EGX B;  2IOQ A;  3DMD A;  1Q82 M;  2WZF A;  2YZS A;  1SMY F;  3ITF A;  4U5G A;  3EHM A;  2PX0 A;  4BJ5 C;  3W8H A;  3EQL F;  3PMR A;  2HV7 A;  4KBL A;  4EBB A;  3EZI A;  3ABM C;  3OA1 A;  3CCM O;  1K73 P;  3UMK A;  1MMN A;  3OEO A;  3KKB A;  1M90 P;  2H7V C;  3SZR A;  5CI9 A;  3DAG A;  3V7O A;  4YT2 A;  1FMV A;  1JJ2 N;  3ASN C;  3RKO F;  2ZXO A;  1KQS K;  2EIN C;  1YIT O;  3CXC K;  2E87 A;  3CCM L;  2A6H F;  3X1O A;  2J9W A;  5EHH A;  3ASO C;  2G3V A;  4OD5 A;  3K1H A;  4JZA A;  4W8K A;  5T1D B;  3JRT A;  2J7P D;  4I44 A;  1W2B N;  5B1B C;  4GYT A;  1K8A M;  5DS5 A;  3HJC A;  2PFD A;  2OCC C;  4DBR A;  3JYH A;  4K0D A;  3G71 O;  1YIT L;  2HV6 A;  2CNW A;  2IXP A;  3SEO A;  1J8M F;  1VK5 A;  3ZC4 A;  1Z6A A;  2VB6 A;  2J0W A;  3N2Z B;  3KL4 A;  4WJ0 A;  1D0Y A;  1VQK O;  2J45 A;  3AG3 C;  4N06 A;  4BG0 A;  4YN0 B;  3NKD A;  3O6X A;  1TWG A;  4AX2 A;  3G71 L;  3FHD A;  1WGW A;  1Z3I X;  3E70 C;  3CCS O;  4KNW A;  1ZU4 A;  3LAY A;  2WVQ A;  4O7G A;  2WL8 A;  1VQK L;  1VQO O;  2O9X A;  1MMD A;  1K9M M;  5E2Q A;  1PCX A;  3PHF 2;  2Y3H A;  4MND A;  3G4S L;  1VYK A;  1VQ7 O;  3Q7L A;  3CCS L;  3EJN A;  3ZVR A;  1JJ2 K;  2Q9B A;  5KYU B;  1Q7Y M;  1S72 O;  1ZHW A;  1LS1 A;  1VQO L;  5DS4 A;  3WOD F;  1M2O A;  4PFP A;  1VQ7 L;  1W2W A;  1K8A P;  1N8R P;  1W2B K;  4CS9 A;  4J30 B;  1VYI A;  2ZXR A;  3T4R A;  2VH3 A;  2A69 F;  1OCC C;  2PF4 E;  5KYY B;  3CD6 O;  3UNG C;  3NYJ A;  3AG1 C;  4OIO F;  4KI2 A;  5D91 A;  4RDA A;  1K73 M;  1M56 C;  2IXO A;  2WB7 A;  2A1D D;  3NYM A;  3M1C B;  3B0V C;  1VQ4 O;  4ZLC A;  2DYS C;  1YIJ O;  5T3W A;  3CD6 L;  1IW7 F;  2KW3 C;  3LEV A;  3KMI A;  3EFO A;  1O87 A;  5B1A C;  1ZHZ A;  2WVN A;  3OW2 N;  2W9Y A;  5FCL A;  4G7H F;  3CC7 O;  4G7O F;  1NU9 C;  3DXJ F;  5B3S C;  3LS1 A;  1YIJ L;  1MNE A;  3ABK C;  4LLE A;  2QY9 A;  4HEA J;  2P6V A;  1TWC A;  2P7V A;  3S27 A;  3ABL C;  1TKN A;  2H7O A;  2KQ9 A;  3L34 A;  3T6J A;  1D0Z A;  2Z15 A;  4IWB A;  1KD1 M;  3CC7 L;  5KYX B;  4FES A;  4OIP F;  5KYW B;  2ZPA A;  2Q9C A;  1V54 C;  3G6E L;  1YI2 O;  4H4K C;  4U5B E;  4J32 B;  4M63 A;  1VQN L;  2QEX O;  4XTK A;  4PJL A;  3CCJ O;  1NJI M;  1V55 C;  1SZI A;  4I1O B;  1MMG A;  3NRH A;  2NUP A;  2B0J A;  3I55 O;  3CC2 O;  1ZHX A;  3F46 A;  4BJ5 A;  5L3Q A;  2OG2 A;  1YI2 L;  4XLP F;  2R7S A;  1JPJ A;  1PD0 A;  4JUR I;  2R7V A;  3DM5 A;  2YHS A;  3CCJ L;  3CCL O;  4RBN A;  3RH3 A;  3E9V A;  5E3C A;  2J7P A;  4FWV A;  3I55 L;  3CC2 L;  3S0X A;  5F5F A;  3OW2 K;  2I8B A;  4C7O B;  2X51 A;  4HFF B;  1OKK D;  4E7Z A;  2XXA B;  4G7Z F;  1N8R M;  3AQB A;  3CCL L;  3F47 A;  4X0R A;  4AK9 A;  3SYN A;  5E3A A;  4Q4Z F;  1RJ9 B;  3CPW N;  4LAC B;  2D5R B;  3CCV O;  4O6Y A;  1KD1 P;  3LLI A;  4OIR F;  4EWC A;  3W8I A;  3CSK A;  3UGO A;  3K1I C;  2VAS A;  3EH2 A;  2KJG A;  3HLZ A;  2J9V A;  3ZSU A;  3H65 A;  1G8X A;  3EG9 B;  3LJB A;  1NJI P;  1PD1 A;  2EIJ C;  3NDB B;  4QDL A;  2R7X A;  2KGO A;  3Q7G A;  3K7D A;  3EGX A;  5KYX A;  2R7O A;  2XL4 A;  1D1A A;  1SF8 A;  2Q3T A;  5KYW A;  3ECS A;  5L3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...