3CCJL

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3ccjL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3ccjL01
1QVGN 3CC4O 2OTLO 3G4SL 1YIJL 1K73P 1VQ6L 3CC2O 3CCLO 3CXCN 1VQ9O 1VQ7L 3G6EO 1M1KM 3I56L 3CCUO 3OW2K 1Q81P 1Q86P 3CD6O 2OTJL 3CC7L 1VQLL 3CMEL 1YI2O 2QA4O 1W2BN 1JJ2K 1K8AP 2QEXO 3CCRL 1Q7YP 1VQPO 1S72L 1Q82P 3I55L 1VQKL 3CMAL 1YIJO 3CCVO 1VQOL 1QVFN 1K73M 1VQ8O 3CPWN 3I56O 1VQML 1KQSK 1Q81M 1Q86M 1YHQL 1VQ4O 2OTJO 1VQ5L 1QVGK 1YITO 1VQNL 1NJIP 1YJ9L 3CXCK 3CCRO 1YJNL 1K8AM 3CCSO 3CMAO 2OTLL 3CCML 1Q82M 3CCEL 3CCQL 3G4SO 3CCLL 3CC2L 1VQOO 1VQ9L 1VQ6O 3G71L 3G6EL 1W2BK 3CCUL 1VQ7O 1VQMO 3CD6L 1YHQO 1YJWL 1N8RP 1K9MP 3CC7O 1KD1P 1VQLO 3CMEO 1KC8P 1YI2L 2QA4L 1M90P 1QVFK 1NJIM 3OW2N 2QEXL 1YJNO 1VQPL 3CPWK 3CCJL 3CC4L 1S72O 1Q7YM 3CCMO 3I55O 1VQKO 3CCEO 3CCQO 3CCVL 1JJ2N 1VQ8L 3G71O 1M1KP 1VQ4L 1YJWO 1YITL 1VQ5O 1N8RM 1K9MM 1KD1M 1VQNO 1KC8M 1M90M 1YJ9O 1KQSN 3CCJO 3CCSL
chains in the Genus database with same CATH superfamily
1QVGN 3CC4O 2OTLO 3G4SL 4W8KA 1YIJL 5DQTA 1K73P 1VQ6L 3CC2O 3CCLO 3CXCN 5DS6A 1VQ9O 1VQ7L 3G6EO 1M1KM 3I56L 3CCUO 3OW2K 1Q81P 1Q86P 3CD6O 2OTJL 3CC7L 2YZSA 1VQLL 3CMEL 1YI2O 2QA4O 1W2BN 1JJ2K 1K8AP 2QEXO 3CCRL 1Q7YP 1VQPO 1S72L 1Q82P 3I55L 1VQKL 3CMAL 1YIJO 3CCVO 1VQOL 1QVFN 1K73M 1VQ8O 3CPWN 3I56O 5DQZA 5DLJA 1VQML 1KQSK 1Q81M 1Q86M 1YHQL 1VQ4O 2OTJO 1VQ5L 1QVGK 5FCLA 1YITO 1VQNL 4QDLA 5DS4A 1NJIP 1YJ9L 3CXCK 3CCRO 1YJNL 1K8AM 3CCSO 3CMAO 2OTLL 3CCML 1Q82M 3GODA 3CCEL 3CCQL 3G4SO 3CCLL 3CC2L 1VQOO 1VQ9L 1VQ6O 3G71L 3G6EL 4WJ0A 1W2BK 3CCUL 1VQ7O 1VQMO 3CD6L 1YHQO 1YJWL 1N8RP 3NKDA 1K9MP 3CC7O 1KD1P 1VQLO 3CMEO 1KC8P 1YI2L 2QA4L 1M90P 1QVFK 1NJIM 3OW2N 2QEXL 1YJNO 1VQPL 3CPWK 4XTKA 3CCJL 3CC4L 1S72O 1Q7YM 3CCMO 3I55O 1VQKO 4P6IC 3CCEO 3CCQO 3CCVL 1JJ2N 1VQ8L 3G71O 1M1KP 1VQ4L 5DS5A 1YITL 1YJWO 1VQ5O 1N8RM 1K9MM 1KD1M 1VQNO 1KC8M 1M90M 1YJ9O 1KQSN 3CCJO 4N06A 3CCSL
chains in the Genus database with same CATH topology
1QVGN 3CC4O 2OTLO 3G4SL 4W8KA 1YIJL 5DQTA 1K73P 1VQ6L 3CC2O 3CCLO 3CXCN 5DS6A 1VQ9O 1VQ7L 3G6EO 1M1KM 3I56L 3CCUO 3OW2K 1Q81P 1Q86P 3CD6O 2OTJL 3CC7L 2YZSA 1VQLL 3CMEL 1YI2O 2QA4O 1W2BN 1JJ2K 1K8AP 2QEXO 3CCRL 1Q7YP 1VQPO 1S72L 1Q82P 3I55L 1VQKL 3CMAL 1YIJO 3CCVO 1VQOL 1QVFN 1K73M 1VQ8O 3CPWN 3I56O 5DQZA 5DLJA 1VQML 1KQSK 1Q81M 1Q86M 1YHQL 1VQ4O 2OTJO 1VQ5L 1QVGK 5FCLA 1YITO 1VQNL 4QDLA 5DS4A 1NJIP 1YJ9L 3CXCK 3CCRO 1YJNL 1K8AM 3CCSO 3CMAO 2OTLL 3CCML 1Q82M 3GODA 3CCEL 3CCQL 3G4SO 3CCLL 3CC2L 1VQOO 1VQ9L 1VQ6O 3G71L 3G6EL 4WJ0A 1W2BK 3CCUL 1VQ7O 1VQMO 3CD6L 1YHQO 1YJWL 1N8RP 3NKDA 1K9MP 3CC7O 1KD1P 1VQLO 3CMEO 1KC8P 1YI2L 2QA4L 1M90P 1QVFK 1NJIM 3OW2N 2QEXL 1YJNO 1VQPL 3CPWK 4XTKA 3CCJL 3CC4L 1S72O 1Q7YM 3CCMO 3I55O 1VQKO 4P6IC 3CCEO 3CCQO 3CCVL 1JJ2N 1VQ8L 3G71O 1M1KP 1VQ4L 5DS5A 1YITL 1YJWO 1VQ5O 1N8RM 1K9MM 1KD1M 1VQNO 1KC8M 1M90M 1YJ9O 1KQSN 3CCJO 4N06A 3CCSL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG N;  3CC4 O;  2OTL O;  3G4S L;  1YIJ L;  1K73 P;  1VQ6 L;  3CC2 O;  3CCL O;  3CXC N;  1VQ9 O;  1VQ7 L;  3G6E O;  1M1K M;  3I56 L;  3CCU O;  3OW2 K;  1Q81 P;  1Q86 P;  3CD6 O;  2OTJ L;  3CC7 L;  1VQL L;  3CME L;  1YI2 O;  2QA4 O;  1W2B N;  1JJ2 K;  1K8A P;  2QEX O;  3CCR L;  1Q7Y P;  1VQP O;  1S72 L;  1Q82 P;  3I55 L;  1VQK L;  3CMA L;  1YIJ O;  3CCV O;  1VQO L;  1QVF N;  1K73 M;  1VQ8 O;  3CPW N;  3I56 O;  1VQM L;  1KQS K;  1Q81 M;  1Q86 M;  1YHQ L;  1VQ4 O;  2OTJ O;  1VQ5 L;  1QVG K;  1YIT O;  1VQN L;  1NJI P;  1YJ9 L;  3CXC K;  3CCR O;  1YJN L;  1K8A M;  3CCS O;  3CMA O;  2OTL L;  3CCM L;  1Q82 M;  3CCE L;  3CCQ L;  3G4S O;  3CCL L;  3CC2 L;  1VQO O;  1VQ9 L;  1VQ6 O;  3G71 L;  3G6E L;  1W2B K;  3CCU L;  1VQ7 O;  1VQM O;  3CD6 L;  1YHQ O;  1YJW L;  1N8R P;  1K9M P;  3CC7 O;  1KD1 P;  1VQL O;  3CME O;  1KC8 P;  1YI2 L;  2QA4 L;  1M90 P;  1QVF K;  1NJI M;  3OW2 N;  2QEX L;  1YJN O;  1VQP L;  3CPW K;  3CCJ L;  3CC4 L;  1S72 O;  1Q7Y M;  3CCM O;  3I55 O;  1VQK O;  3CCE O;  3CCQ O;  3CCV L;  1JJ2 N;  1VQ8 L;  3G71 O;  1M1K P;  1VQ4 L;  1YJW O;  1YIT L;  1VQ5 O;  1N8R M;  1K9M M;  1KD1 M;  1VQN O;  1KC8 M;  1M90 M;  1YJ9 O;  1KQS N;  3CCJ O;  3CCS L; 
#chains in the Genus database with same CATH topology
 1QVG N;  3CC4 O;  2OTL O;  3G4S L;  4W8K A;  1YIJ L;  5DQT A;  1K73 P;  1VQ6 L;  3CC2 O;  3CCL O;  3CXC N;  5DS6 A;  1VQ9 O;  1VQ7 L;  3G6E O;  1M1K M;  3I56 L;  3CCU O;  3OW2 K;  1Q81 P;  1Q86 P;  3CD6 O;  2OTJ L;  3CC7 L;  2YZS A;  1VQL L;  3CME L;  1YI2 O;  2QA4 O;  1W2B N;  1JJ2 K;  1K8A P;  2QEX O;  3CCR L;  1Q7Y P;  1VQP O;  1S72 L;  1Q82 P;  3I55 L;  1VQK L;  3CMA L;  1YIJ O;  3CCV O;  1VQO L;  1QVF N;  1K73 M;  1VQ8 O;  3CPW N;  3I56 O;  5DQZ A;  5DLJ A;  1VQM L;  1KQS K;  1Q81 M;  1Q86 M;  1YHQ L;  1VQ4 O;  2OTJ O;  1VQ5 L;  1QVG K;  5FCL A;  1YIT O;  1VQN L;  4QDL A;  5DS4 A;  1NJI P;  1YJ9 L;  3CXC K;  3CCR O;  1YJN L;  1K8A M;  3CCS O;  3CMA O;  2OTL L;  3CCM L;  1Q82 M;  3GOD A;  3CCE L;  3CCQ L;  3G4S O;  3CCL L;  3CC2 L;  1VQO O;  1VQ9 L;  1VQ6 O;  3G71 L;  3G6E L;  4WJ0 A;  1W2B K;  3CCU L;  1VQ7 O;  1VQM O;  3CD6 L;  1YHQ O;  1YJW L;  1N8R P;  3NKD A;  1K9M P;  3CC7 O;  1KD1 P;  1VQL O;  3CME O;  1KC8 P;  1YI2 L;  2QA4 L;  1M90 P;  1QVF K;  1NJI M;  3OW2 N;  2QEX L;  1YJN O;  1VQP L;  3CPW K;  4XTK A;  3CCJ L;  3CC4 L;  1S72 O;  1Q7Y M;  3CCM O;  3I55 O;  1VQK O;  4P6I C;  3CCE O;  3CCQ O;  3CCV L;  1JJ2 N;  1VQ8 L;  3G71 O;  1M1K P;  1VQ4 L;  5DS5 A;  1YIT L;  1YJW O;  1VQ5 O;  1N8R M;  1K9M M;  1KD1 M;  1VQN O;  1KC8 M;  1M90 M;  1YJ9 O;  1KQS N;  3CCJ O;  4N06 A;  3CCS L; 
#chains in the Genus database with same CATH homology
 1QVG N;  3CC4 O;  2OTL O;  3G4S L;  4W8K A;  1YIJ L;  5DQT A;  1K73 P;  1VQ6 L;  3CC2 O;  3CCL O;  3CXC N;  5DS6 A;  1VQ9 O;  1VQ7 L;  3G6E O;  1M1K M;  3I56 L;  3CCU O;  3OW2 K;  1Q81 P;  1Q86 P;  3CD6 O;  2OTJ L;  3CC7 L;  2YZS A;  1VQL L;  3CME L;  1YI2 O;  2QA4 O;  1W2B N;  1JJ2 K;  1K8A P;  2QEX O;  3CCR L;  1Q7Y P;  1VQP O;  1S72 L;  1Q82 P;  3I55 L;  1VQK L;  3CMA L;  1YIJ O;  3CCV O;  1VQO L;  1QVF N;  1K73 M;  1VQ8 O;  3CPW N;  3I56 O;  5DQZ A;  5DLJ A;  1VQM L;  1KQS K;  1Q81 M;  1Q86 M;  1YHQ L;  1VQ4 O;  2OTJ O;  1VQ5 L;  1QVG K;  5FCL A;  1YIT O;  1VQN L;  4QDL A;  5DS4 A;  1NJI P;  1YJ9 L;  3CXC K;  3CCR O;  1YJN L;  1K8A M;  3CCS O;  3CMA O;  2OTL L;  3CCM L;  1Q82 M;  3GOD A;  3CCE L;  3CCQ L;  3G4S O;  3CCL L;  3CC2 L;  1VQO O;  1VQ9 L;  1VQ6 O;  3G71 L;  3G6E L;  4WJ0 A;  1W2B K;  3CCU L;  1VQ7 O;  1VQM O;  3CD6 L;  1YHQ O;  1YJW L;  1N8R P;  3NKD A;  1K9M P;  3CC7 O;  1KD1 P;  1VQL O;  3CME O;  1KC8 P;  1YI2 L;  2QA4 L;  1M90 P;  1QVF K;  1NJI M;  3OW2 N;  2QEX L;  1YJN O;  1VQP L;  3CPW K;  4XTK A;  3CCJ L;  3CC4 L;  1S72 O;  1Q7Y M;  3CCM O;  3I55 O;  1VQK O;  4P6I C;  3CCE O;  3CCQ O;  3CCV L;  1JJ2 N;  1VQ8 L;  3G71 O;  1M1K P;  1VQ4 L;  5DS5 A;  1YIT L;  1YJW O;  1VQ5 O;  1N8R M;  1K9M M;  1KD1 M;  1VQN O;  1KC8 M;  1M90 M;  1YJ9 O;  1KQS N;  3CCJ O;  4N06 A;  3CCS L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...