1KQSN

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1kqsN00
1S72L 3I55L 3I56O 1KQSN 1QVGK 3CXCK 2QA4O 3CCVL 1VQ4O 1Q7YP 1K8AM 1YITL 1VQPL 1M1KM 1YIJL 3CC7O 3CC4O 3CCSO 2OTLL 1S72O 3I55O 1QVFN 3CCVO 1Q86P 1VQLL 1Q7YM 1K73P 1VQOO 1JJ2N 3CCEL 1VQ7L 1VQKL 3OW2K 1VQPO 1YIJO 3CCRL 3CPWN 1N8RP 3CCMO 1W2BN 2OTLO 1VQOL 1VQ8L 1YI2L 1YHQL 1Q86M 1VQLO 3G71L 3CCEO 1K73M 3CCML 1VQ7O 1VQKO 3G6EL 1YJWL 3CCRO 1M90P 3CC2L 1QVFK 3CCLL 1N8RM 1Q81P 1NJIP 3CCJL 1VQ5L 2QEXO 1QVGN 1VQ8O 1YI2O 1YJNO 1YHQO 3G71O 3CCUL 3CMEL 3CPWK 1VQ6L 3G6EO 1YJWO 1KQSK 2QEXL 1W2BK 1M90M 3CC2O 1Q82P 3CCLO 3CCQL 1Q81M 1NJIM 3CCJO 1KD1P 1VQ5O 1YJNL 1KC8P 1VQNL 1VQ9L 3CCUO 3CMEO 3OW2N 1VQ6O 3CD6L 2OTJO 3G4SL 1VQML 3CXCN 1Q82M 1JJ2K 3CCQO 1KD1M 1K9MP 1YJ9L 1KC8M 3CMAL 1VQNO 3I56L 1VQ9O 2OTJL 2QA4L 1VQ4L 3CD6O 3G4SO 1VQMO 1K8AP 1K9MM 1M1KP 3CC7L 1YJ9O 3CC4L 3CMAO 3CCSL 1YITO
chains in the Genus database with same CATH superfamily
1S72L 3I55L 3I56O 5DS4A 1KQSN 1QVGK 3CXCK 2QA4O 3CCVL 1VQ4O 1Q7YP 1K8AM 1YITL 1VQPL 1M1KM 1YIJL 3CC7O 3CC4O 3CCSO 2OTLL 1S72O 3I55O 4WJ0A 1QVFN 3CCVO 1Q86P 1VQLL 1Q7YM 1K73P 1VQOO 1JJ2N 3CCEL 1VQ7L 1VQKL 3OW2K 1VQPO 1YIJO 3CCRL 3CPWN 1N8RP 3CCMO 1W2BN 2OTLO 1VQOL 1VQ8L 5DQZA 1YI2L 1YHQL 1Q86M 1VQLO 3G71L 3CCEO 1K73M 5DS6A 3CCML 1VQ7O 1VQKO 3G6EL 1YJWL 2YZSA 3CCRO 1M90P 3CC2L 1QVFK 3CCLL 1N8RM 1Q81P 1NJIP 3CCJL 1VQ5L 2QEXO 5FCLA 1QVGN 1VQ8O 1YI2O 1YJNO 1YHQO 3G71O 3CCUL 3CMEL 4P6IC 3CPWK 1VQ6L 3G6EO 1YJWO 1KQSK 2QEXL 1W2BK 1M90M 3CC2O 5DLJA 1Q82P 3CCLO 4N06A 4XTKA 3CCQL 1Q81M 3CCJO 1NJIM 1KD1P 1YJNL 1VQ5O 1KC8P 1VQNL 1VQ9L 3GODA 3CCUO 3CMEO 4QDLA 3OW2N 1VQ6O 3CD6L 2OTJO 3G4SL 1VQML 3CXCN 1Q82M 4W8KA 5DS5A 1JJ2K 3CCQO 1KD1M 1K9MP 1YJ9L 1KC8M 3CMAL 1VQNO 3I56L 1VQ9O 2OTJL 5DQTA 2QA4L 3NKDA 1VQ4L 3CD6O 3G4SO 1VQMO 1K8AP 1K9MM 1M1KP 3CC7L 1YJ9O 3CC4L 3CMAO 3CCSL 1YITO
chains in the Genus database with same CATH topology
1S72L 3I55L 3I56O 5DS4A 1KQSN 1QVGK 3CXCK 2QA4O 3CCVL 1VQ4O 1Q7YP 1K8AM 1YITL 1VQPL 1M1KM 1YIJL 3CC7O 3CC4O 3CCSO 2OTLL 1S72O 3I55O 4WJ0A 1QVFN 3CCVO 1Q86P 1VQLL 1Q7YM 1K73P 1VQOO 1JJ2N 3CCEL 1VQ7L 1VQKL 3OW2K 1VQPO 1YIJO 3CCRL 3CPWN 1N8RP 3CCMO 1W2BN 2OTLO 1VQOL 1VQ8L 5DQZA 1YI2L 1YHQL 1Q86M 1VQLO 3G71L 3CCEO 1K73M 5DS6A 3CCML 1VQ7O 1VQKO 3G6EL 1YJWL 2YZSA 3CCRO 1M90P 3CC2L 1QVFK 3CCLL 1N8RM 1Q81P 1NJIP 3CCJL 1VQ5L 2QEXO 5FCLA 1QVGN 1VQ8O 1YI2O 1YJNO 1YHQO 3G71O 3CCUL 3CMEL 4P6IC 3CPWK 1VQ6L 3G6EO 1YJWO 1KQSK 2QEXL 1W2BK 1M90M 3CC2O 5DLJA 1Q82P 3CCLO 4N06A 4XTKA 3CCQL 1Q81M 3CCJO 1NJIM 1KD1P 1YJNL 1VQ5O 1KC8P 1VQNL 1VQ9L 3GODA 3CCUO 3CMEO 4QDLA 3OW2N 1VQ6O 3CD6L 2OTJO 3G4SL 1VQML 3CXCN 1Q82M 4W8KA 5DS5A 1JJ2K 3CCQO 1KD1M 1K9MP 1YJ9L 1KC8M 3CMAL 1VQNO 3I56L 1VQ9O 2OTJL 5DQTA 2QA4L 3NKDA 1VQ4L 3CD6O 3G4SO 1VQMO 1K8AP 1K9MM 1M1KP 3CC7L 1YJ9O 3CC4L 3CMAO 3CCSL 1YITO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 L;  3I55 L;  3I56 O;  1KQS N;  1QVG K;  3CXC K;  2QA4 O;  3CCV L;  1VQ4 O;  1Q7Y P;  1K8A M;  1YIT L;  1VQP L;  1M1K M;  1YIJ L;  3CC7 O;  3CC4 O;  3CCS O;  2OTL L;  1S72 O;  3I55 O;  1QVF N;  3CCV O;  1Q86 P;  1VQL L;  1Q7Y M;  1K73 P;  1VQO O;  1JJ2 N;  3CCE L;  1VQ7 L;  1VQK L;  3OW2 K;  1VQP O;  1YIJ O;  3CCR L;  3CPW N;  1N8R P;  3CCM O;  1W2B N;  2OTL O;  1VQO L;  1VQ8 L;  1YI2 L;  1YHQ L;  1Q86 M;  1VQL O;  3G71 L;  3CCE O;  1K73 M;  3CCM L;  1VQ7 O;  1VQK O;  3G6E L;  1YJW L;  3CCR O;  1M90 P;  3CC2 L;  1QVF K;  3CCL L;  1N8R M;  1Q81 P;  1NJI P;  3CCJ L;  1VQ5 L;  2QEX O;  1QVG N;  1VQ8 O;  1YI2 O;  1YJN O;  1YHQ O;  3G71 O;  3CCU L;  3CME L;  3CPW K;  1VQ6 L;  3G6E O;  1YJW O;  1KQS K;  2QEX L;  1W2B K;  1M90 M;  3CC2 O;  1Q82 P;  3CCL O;  3CCQ L;  1Q81 M;  1NJI M;  3CCJ O;  1KD1 P;  1VQ5 O;  1YJN L;  1KC8 P;  1VQN L;  1VQ9 L;  3CCU O;  3CME O;  3OW2 N;  1VQ6 O;  3CD6 L;  2OTJ O;  3G4S L;  1VQM L;  3CXC N;  1Q82 M;  1JJ2 K;  3CCQ O;  1KD1 M;  1K9M P;  1YJ9 L;  1KC8 M;  3CMA L;  1VQN O;  3I56 L;  1VQ9 O;  2OTJ L;  2QA4 L;  1VQ4 L;  3CD6 O;  3G4S O;  1VQM O;  1K8A P;  1K9M M;  1M1K P;  3CC7 L;  1YJ9 O;  3CC4 L;  3CMA O;  3CCS L;  1YIT O; 
#chains in the Genus database with same CATH topology
 1S72 L;  3I55 L;  3I56 O;  5DS4 A;  1KQS N;  1QVG K;  3CXC K;  2QA4 O;  3CCV L;  1VQ4 O;  1Q7Y P;  1K8A M;  1YIT L;  1VQP L;  1M1K M;  1YIJ L;  3CC7 O;  3CC4 O;  3CCS O;  2OTL L;  1S72 O;  3I55 O;  4WJ0 A;  1QVF N;  3CCV O;  1Q86 P;  1VQL L;  1Q7Y M;  1K73 P;  1VQO O;  1JJ2 N;  3CCE L;  1VQ7 L;  1VQK L;  3OW2 K;  1VQP O;  1YIJ O;  3CCR L;  3CPW N;  1N8R P;  3CCM O;  1W2B N;  2OTL O;  1VQO L;  1VQ8 L;  5DQZ A;  1YI2 L;  1YHQ L;  1Q86 M;  1VQL O;  3G71 L;  3CCE O;  1K73 M;  5DS6 A;  3CCM L;  1VQ7 O;  1VQK O;  3G6E L;  1YJW L;  2YZS A;  3CCR O;  1M90 P;  3CC2 L;  1QVF K;  3CCL L;  1N8R M;  1Q81 P;  1NJI P;  3CCJ L;  1VQ5 L;  2QEX O;  5FCL A;  1QVG N;  1VQ8 O;  1YI2 O;  1YJN O;  1YHQ O;  3G71 O;  3CCU L;  3CME L;  4P6I C;  3CPW K;  1VQ6 L;  3G6E O;  1YJW O;  1KQS K;  2QEX L;  1W2B K;  1M90 M;  3CC2 O;  5DLJ A;  1Q82 P;  3CCL O;  4N06 A;  4XTK A;  3CCQ L;  1Q81 M;  3CCJ O;  1NJI M;  1KD1 P;  1YJN L;  1VQ5 O;  1KC8 P;  1VQN L;  1VQ9 L;  3GOD A;  3CCU O;  3CME O;  4QDL A;  3OW2 N;  1VQ6 O;  3CD6 L;  2OTJ O;  3G4S L;  1VQM L;  3CXC N;  1Q82 M;  4W8K A;  5DS5 A;  1JJ2 K;  3CCQ O;  1KD1 M;  1K9M P;  1YJ9 L;  1KC8 M;  3CMA L;  1VQN O;  3I56 L;  1VQ9 O;  2OTJ L;  5DQT A;  2QA4 L;  3NKD A;  1VQ4 L;  3CD6 O;  3G4S O;  1VQM O;  1K8A P;  1K9M M;  1M1K P;  3CC7 L;  1YJ9 O;  3CC4 L;  3CMA O;  3CCS L;  1YIT O; 
#chains in the Genus database with same CATH homology
 1S72 L;  3I55 L;  3I56 O;  5DS4 A;  1KQS N;  1QVG K;  3CXC K;  2QA4 O;  3CCV L;  1VQ4 O;  1Q7Y P;  1K8A M;  1YIT L;  1VQP L;  1M1K M;  1YIJ L;  3CC7 O;  3CC4 O;  3CCS O;  2OTL L;  1S72 O;  3I55 O;  4WJ0 A;  1QVF N;  3CCV O;  1Q86 P;  1VQL L;  1Q7Y M;  1K73 P;  1VQO O;  1JJ2 N;  3CCE L;  1VQ7 L;  1VQK L;  3OW2 K;  1VQP O;  1YIJ O;  3CCR L;  3CPW N;  1N8R P;  3CCM O;  1W2B N;  2OTL O;  1VQO L;  1VQ8 L;  5DQZ A;  1YI2 L;  1YHQ L;  1Q86 M;  1VQL O;  3G71 L;  3CCE O;  1K73 M;  5DS6 A;  3CCM L;  1VQ7 O;  1VQK O;  3G6E L;  1YJW L;  2YZS A;  3CCR O;  1M90 P;  3CC2 L;  1QVF K;  3CCL L;  1N8R M;  1Q81 P;  1NJI P;  3CCJ L;  1VQ5 L;  2QEX O;  5FCL A;  1QVG N;  1VQ8 O;  1YI2 O;  1YJN O;  1YHQ O;  3G71 O;  3CCU L;  3CME L;  4P6I C;  3CPW K;  1VQ6 L;  3G6E O;  1YJW O;  1KQS K;  2QEX L;  1W2B K;  1M90 M;  3CC2 O;  5DLJ A;  1Q82 P;  3CCL O;  4N06 A;  4XTK A;  3CCQ L;  1Q81 M;  3CCJ O;  1NJI M;  1KD1 P;  1YJN L;  1VQ5 O;  1KC8 P;  1VQN L;  1VQ9 L;  3GOD A;  3CCU O;  3CME O;  4QDL A;  3OW2 N;  1VQ6 O;  3CD6 L;  2OTJ O;  3G4S L;  1VQM L;  3CXC N;  1Q82 M;  4W8K A;  5DS5 A;  1JJ2 K;  3CCQ O;  1KD1 M;  1K9M P;  1YJ9 L;  1KC8 M;  3CMA L;  1VQN O;  3I56 L;  1VQ9 O;  2OTJ L;  5DQT A;  2QA4 L;  3NKD A;  1VQ4 L;  3CD6 O;  3G4S O;  1VQM O;  1K8A P;  1K9M M;  1M1K P;  3CC7 L;  1YJ9 O;  3CC4 L;  3CMA O;  3CCS L;  1YIT O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...