1M1KP

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1m1kP00
3G4SO 3CCMO 1YIJO 3CMAO 3CC4L 1Q7YM 1VQML 3CC7L 3CCSL 1W2BK 1Q81P 1YI2L 1M90P 1YJWL 1S72O 3CCUO 3I56O 3CCJO 1VQ5O 3CCEO 1K9MM 1YJ9L 1Q86M 3OW2N 1Q82P 1M1KP 3CPWN 3CMEO 3CPWK 1VQPO 1YJNL 1K8AP 1VQ8L 3G71O 1VQ4O 1Q81M 3CD6O 1K73P 1W2BN 1YITO 1VQ9O 1VQKL 1M90M 1YHQO 1VQOL 2QA4O 3CCLL 2QEXO 3CCQO 1S72L 1NJIP 2OTLO 1JJ2N 3CCRL 1JJ2K 3I55L 3CXCK 3I56L 3CCUL 3CCVO 1KD1P 1VQ5L 3CCEL 1VQ7O 1VQ6L 1Q82M 3G6EL 1M1KM 3CC2O 1VQNO 2OTJO 1VQPL 1K8AM 3G4SL 3CCML 1YIJL 1VQMO 3CMAL 1VQLO 1VQ4L 1K73M 3CD6L 1YI2O 1KQSK 1KC8P 1NJIM 2QEXL 3CCQL 1KD1M 3CCVL 1N8RP 3CXCN 3CCJL 1VQ7L 1Q86P 1QVGK 1VQNL 1QVFN 1QVFK 1YJNO 3CMEL 1VQ8O 3CC4O 3CC7O 3CCSO 1VQLL 1Q7YP 3G71L 1VQKO 1VQOO 1KC8M 1YITL 1VQ9L 3CCLO 1KQSN 1YHQL 1YJWO 2QA4L 3CCRO 3I55O 1N8RM 2OTLL 1VQ6O 3G6EO 1YJ9O 3OW2K 1K9MP 1QVGN 3CC2L 2OTJL
chains in the Genus database with same CATH superfamily
4N06A 3G4SO 3CCMO 1YIJO 3CMAO 5DS4A 3CC4L 1Q7YM 1VQML 3CC7L 3CCSL 1W2BK 1Q81P 1YI2L 2YZSA 1M90P 1YJWL 1S72O 3CCUO 3I56O 3CCJO 1VQ5O 3CCEO 4QDLA 1K9MM 1YJ9L 1Q86M 3OW2N 3NKDA 1Q82P 1M1KP 3CPWN 3CMEO 3CPWK 1VQPO 4WJ0A 1YJNL 1K8AP 1VQ8L 3G71O 1VQ4O 1Q81M 3CD6O 1K73P 1W2BN 1YITO 5DQTA 1VQ9O 1VQKL 1M90M 1YHQO 1VQOL 2QA4O 3CCLL 2QEXO 3CCQO 1S72L 1NJIP 2OTLO 5DS5A 3CCRL 1JJ2N 1JJ2K 3I55L 3CXCK 3I56L 3CCUL 3CCVO 1KD1P 1VQ5L 3CCEL 1VQ7O 1VQ6L 1Q82M 3G6EL 1M1KM 3CC2O 1VQNO 2OTJO 1VQPL 1K8AM 3G4SL 3CCML 1YIJL 1VQMO 3CMAL 1VQLO 1VQ4L 1K73M 3CD6L 1YI2O 5DS6A 1KQSK 1KC8P 1NJIM 2QEXL 3CCQL 1KD1M 3CCVL 1N8RP 3CXCN 3CCJL 1VQ7L 5FCLA 1Q86P 1QVGK 1VQNL 1QVFN 1QVFK 1YJNO 3CMEL 1VQ8O 3CC4O 5DQZA 3CC7O 3CCSO 1VQLL 1Q7YP 3G71L 1VQKO 5DLJA 1VQOO 1KC8M 1YITL 1VQ9L 4P6IC 3CCLO 1KQSN 1YHQL 1YJWO 2QA4L 3CCRO 3I55O 4XTKA 1N8RM 2OTLL 4W8KA 1VQ6O 3G6EO 1YJ9O 3OW2K 1K9MP 3GODA 1QVGN 3CC2L 2OTJL
chains in the Genus database with same CATH topology
4N06A 3G4SO 3CCMO 1YIJO 3CMAO 5DS4A 3CC4L 1Q7YM 1VQML 3CC7L 3CCSL 1W2BK 1Q81P 1YI2L 2YZSA 1M90P 1YJWL 1S72O 3CCUO 3I56O 3CCJO 1VQ5O 3CCEO 4QDLA 1K9MM 1YJ9L 1Q86M 3OW2N 3NKDA 1Q82P 1M1KP 3CPWN 3CMEO 3CPWK 1VQPO 4WJ0A 1YJNL 1K8AP 1VQ8L 3G71O 1VQ4O 1Q81M 3CD6O 1K73P 1W2BN 1YITO 5DQTA 1VQ9O 1VQKL 1M90M 1YHQO 1VQOL 2QA4O 3CCLL 2QEXO 3CCQO 1S72L 1NJIP 2OTLO 5DS5A 3CCRL 1JJ2N 1JJ2K 3I55L 3CXCK 3I56L 3CCUL 3CCVO 1KD1P 1VQ5L 3CCEL 1VQ7O 1VQ6L 1Q82M 3G6EL 1M1KM 3CC2O 1VQNO 2OTJO 1VQPL 1K8AM 3G4SL 3CCML 1YIJL 1VQMO 3CMAL 1VQLO 1VQ4L 1K73M 3CD6L 1YI2O 5DS6A 1KQSK 1KC8P 1NJIM 2QEXL 3CCQL 1KD1M 3CCVL 1N8RP 3CXCN 3CCJL 1VQ7L 5FCLA 1Q86P 1QVGK 1VQNL 1QVFN 1QVFK 1YJNO 3CMEL 1VQ8O 3CC4O 5DQZA 3CC7O 3CCSO 1VQLL 1Q7YP 3G71L 1VQKO 5DLJA 1VQOO 1KC8M 1YITL 1VQ9L 4P6IC 3CCLO 1KQSN 1YHQL 1YJWO 2QA4L 3CCRO 3I55O 4XTKA 1N8RM 2OTLL 4W8KA 1VQ6O 3G6EO 1YJ9O 3OW2K 1K9MP 3GODA 1QVGN 3CC2L 2OTJL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S O;  3CCM O;  1YIJ O;  3CMA O;  3CC4 L;  1Q7Y M;  1VQM L;  3CC7 L;  3CCS L;  1W2B K;  1Q81 P;  1YI2 L;  1M90 P;  1YJW L;  1S72 O;  3CCU O;  3I56 O;  3CCJ O;  1VQ5 O;  3CCE O;  1K9M M;  1YJ9 L;  1Q86 M;  3OW2 N;  1Q82 P;  1M1K P;  3CPW N;  3CME O;  3CPW K;  1VQP O;  1YJN L;  1K8A P;  1VQ8 L;  3G71 O;  1VQ4 O;  1Q81 M;  3CD6 O;  1K73 P;  1W2B N;  1YIT O;  1VQ9 O;  1VQK L;  1M90 M;  1YHQ O;  1VQO L;  2QA4 O;  3CCL L;  2QEX O;  3CCQ O;  1S72 L;  1NJI P;  2OTL O;  1JJ2 N;  3CCR L;  1JJ2 K;  3I55 L;  3CXC K;  3I56 L;  3CCU L;  3CCV O;  1KD1 P;  1VQ5 L;  3CCE L;  1VQ7 O;  1VQ6 L;  1Q82 M;  3G6E L;  1M1K M;  3CC2 O;  1VQN O;  2OTJ O;  1VQP L;  1K8A M;  3G4S L;  3CCM L;  1YIJ L;  1VQM O;  3CMA L;  1VQL O;  1VQ4 L;  1K73 M;  3CD6 L;  1YI2 O;  1KQS K;  1KC8 P;  1NJI M;  2QEX L;  3CCQ L;  1KD1 M;  3CCV L;  1N8R P;  3CXC N;  3CCJ L;  1VQ7 L;  1Q86 P;  1QVG K;  1VQN L;  1QVF N;  1QVF K;  1YJN O;  3CME L;  1VQ8 O;  3CC4 O;  3CC7 O;  3CCS O;  1VQL L;  1Q7Y P;  3G71 L;  1VQK O;  1VQO O;  1KC8 M;  1YIT L;  1VQ9 L;  3CCL O;  1KQS N;  1YHQ L;  1YJW O;  2QA4 L;  3CCR O;  3I55 O;  1N8R M;  2OTL L;  1VQ6 O;  3G6E O;  1YJ9 O;  3OW2 K;  1K9M P;  1QVG N;  3CC2 L;  2OTJ L; 
#chains in the Genus database with same CATH topology
 4N06 A;  3G4S O;  3CCM O;  1YIJ O;  3CMA O;  5DS4 A;  3CC4 L;  1Q7Y M;  1VQM L;  3CC7 L;  3CCS L;  1W2B K;  1Q81 P;  1YI2 L;  2YZS A;  1M90 P;  1YJW L;  1S72 O;  3CCU O;  3I56 O;  3CCJ O;  1VQ5 O;  3CCE O;  4QDL A;  1K9M M;  1YJ9 L;  1Q86 M;  3OW2 N;  3NKD A;  1Q82 P;  1M1K P;  3CPW N;  3CME O;  3CPW K;  1VQP O;  4WJ0 A;  1YJN L;  1K8A P;  1VQ8 L;  3G71 O;  1VQ4 O;  1Q81 M;  3CD6 O;  1K73 P;  1W2B N;  1YIT O;  5DQT A;  1VQ9 O;  1VQK L;  1M90 M;  1YHQ O;  1VQO L;  2QA4 O;  3CCL L;  2QEX O;  3CCQ O;  1S72 L;  1NJI P;  2OTL O;  5DS5 A;  3CCR L;  1JJ2 N;  1JJ2 K;  3I55 L;  3CXC K;  3I56 L;  3CCU L;  3CCV O;  1KD1 P;  1VQ5 L;  3CCE L;  1VQ7 O;  1VQ6 L;  1Q82 M;  3G6E L;  1M1K M;  3CC2 O;  1VQN O;  2OTJ O;  1VQP L;  1K8A M;  3G4S L;  3CCM L;  1YIJ L;  1VQM O;  3CMA L;  1VQL O;  1VQ4 L;  1K73 M;  3CD6 L;  1YI2 O;  5DS6 A;  1KQS K;  1KC8 P;  1NJI M;  2QEX L;  3CCQ L;  1KD1 M;  3CCV L;  1N8R P;  3CXC N;  3CCJ L;  1VQ7 L;  5FCL A;  1Q86 P;  1QVG K;  1VQN L;  1QVF N;  1QVF K;  1YJN O;  3CME L;  1VQ8 O;  3CC4 O;  5DQZ A;  3CC7 O;  3CCS O;  1VQL L;  1Q7Y P;  3G71 L;  1VQK O;  5DLJ A;  1VQO O;  1KC8 M;  1YIT L;  1VQ9 L;  4P6I C;  3CCL O;  1KQS N;  1YHQ L;  1YJW O;  2QA4 L;  3CCR O;  3I55 O;  4XTK A;  1N8R M;  2OTL L;  4W8K A;  1VQ6 O;  3G6E O;  1YJ9 O;  3OW2 K;  1K9M P;  3GOD A;  1QVG N;  3CC2 L;  2OTJ L; 
#chains in the Genus database with same CATH homology
 4N06 A;  3G4S O;  3CCM O;  1YIJ O;  3CMA O;  5DS4 A;  3CC4 L;  1Q7Y M;  1VQM L;  3CC7 L;  3CCS L;  1W2B K;  1Q81 P;  1YI2 L;  2YZS A;  1M90 P;  1YJW L;  1S72 O;  3CCU O;  3I56 O;  3CCJ O;  1VQ5 O;  3CCE O;  4QDL A;  1K9M M;  1YJ9 L;  1Q86 M;  3OW2 N;  3NKD A;  1Q82 P;  1M1K P;  3CPW N;  3CME O;  3CPW K;  1VQP O;  4WJ0 A;  1YJN L;  1K8A P;  1VQ8 L;  3G71 O;  1VQ4 O;  1Q81 M;  3CD6 O;  1K73 P;  1W2B N;  1YIT O;  5DQT A;  1VQ9 O;  1VQK L;  1M90 M;  1YHQ O;  1VQO L;  2QA4 O;  3CCL L;  2QEX O;  3CCQ O;  1S72 L;  1NJI P;  2OTL O;  5DS5 A;  3CCR L;  1JJ2 N;  1JJ2 K;  3I55 L;  3CXC K;  3I56 L;  3CCU L;  3CCV O;  1KD1 P;  1VQ5 L;  3CCE L;  1VQ7 O;  1VQ6 L;  1Q82 M;  3G6E L;  1M1K M;  3CC2 O;  1VQN O;  2OTJ O;  1VQP L;  1K8A M;  3G4S L;  3CCM L;  1YIJ L;  1VQM O;  3CMA L;  1VQL O;  1VQ4 L;  1K73 M;  3CD6 L;  1YI2 O;  5DS6 A;  1KQS K;  1KC8 P;  1NJI M;  2QEX L;  3CCQ L;  1KD1 M;  3CCV L;  1N8R P;  3CXC N;  3CCJ L;  1VQ7 L;  5FCL A;  1Q86 P;  1QVG K;  1VQN L;  1QVF N;  1QVF K;  1YJN O;  3CME L;  1VQ8 O;  3CC4 O;  5DQZ A;  3CC7 O;  3CCS O;  1VQL L;  1Q7Y P;  3G71 L;  1VQK O;  5DLJ A;  1VQO O;  1KC8 M;  1YIT L;  1VQ9 L;  4P6I C;  3CCL O;  1KQS N;  1YHQ L;  1YJW O;  2QA4 L;  3CCR O;  3I55 O;  4XTK A;  1N8R M;  2OTL L;  4W8K A;  1VQ6 O;  3G6E O;  1YJ9 O;  3OW2 K;  1K9M P;  3GOD A;  1QVG N;  3CC2 L;  2OTJ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...