1M90P

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule keywords 23S RRNA
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1m90P00
1N8RP 1NJIM 1K73P 1Q86P 1VQ4L 1VQLL 3I56O 3CCLO 3CCRO 1K9MM 1VQ8O 1VQ4O 1VQLO 1VQOL 1YI2L 3CCSL 3CCVO 1KD1P 1VQOO 3CCSO 1M90M 2OTLL 1YHQL 1YIJL 3CCUL 3CMAL 3CCML 1VQ9L 1Q7YM 1YIJO 3CMAO 3CCMO 2QA4L 1YITO 1VQ9O 3CPWN 1QVGN 2QA4O 3I56L 3CCLL 3CCRL 1VQ8L 2OTJL 1VQPL 3CPWK 3CCVL 3CMEO 1KC8P 3CC2L 2OTJO 1VQPO 1M1KM 3CXCN 1Q81M 1YJ9L 3CC2O 3CCJO 1YJ9O 3CC4L 1NJIP 3CXCK 3CD6O 1VQML 1YITL 3CC4O 3CC7O 1K9MP 3OW2N 2QEXL 1K8AM 1S72O 1Q82M 3I55L 1VQMO 1VQNO 2QEXO 3I55O 3CCQL 1W2BN 1VQ6O 1VQ5L 1M90P 1VQKO 3G71O 3CMEL 3CCQO 1QVFN 1VQ5O 1N8RM 1VQ7L 1QVGK 3G6EO 1W2BK 1Q7YP 1VQ7O 3CCJL 1Q82P 3CD6L 3CC7L 1S72L 1KD1M 1VQNL 1VQ6L 1M1KP 1Q81P 1VQKL 1YJNL 3G71L 3OW2K 1JJ2N 1YJNO 3G6EL 1K73M 1YI2O 1Q86M 1K8AP 1JJ2K 3CCEL 1KQSN 1QVFK 3G4SL 2OTLO 1YHQO 1KC8M 1KQSK 3CCEO 3CCUO 1YJWL 3G4SO 1YJWO
chains in the Genus database with same CATH superfamily
1N8RP 1NJIM 1K73P 1Q86P 1VQ4L 1VQLL 3I56O 3CCLO 3CCRO 1K9MM 1VQ8O 1VQ4O 1VQLO 5DQZA 1VQOL 1YI2L 3CCSL 3CCVO 4XTKA 1KD1P 1VQOO 3CCSO 1M90M 2OTLL 1YHQL 1YIJL 3CCUL 3CMAL 3CCML 1VQ9L 1Q7YM 1YIJO 3CMAO 3CCMO 2QA4L 1YITO 1VQ9O 3CPWN 1QVGN 2QA4O 3I56L 3CCLL 3CCRL 1VQ8L 2OTJL 1VQPL 3CPWK 3CCVL 3CMEO 1KC8P 3CC2L 2OTJO 1VQPO 1M1KM 3CXCN 1Q81M 1YJ9L 3CC2O 5DLJA 4P6IC 5DQTA 3CCJO 1YJ9O 3CC4L 1NJIP 3CXCK 3CD6O 1VQML 1YITL 3CC4O 3CC7O 5DS6A 1K9MP 3OW2N 2QEXL 1K8AM 1S72O 3I55L 1Q82M 1VQMO 1VQNO 2QEXO 3I55O 3CCQL 1W2BN 1VQ6O 1VQ5L 1M90P 1VQKO 3G71O 3CMEL 3CCQO 1QVFN 1VQ5O 1N8RM 1VQ7L 1QVGK 3G6EO 1W2BK 1Q7YP 4QDLA 1VQ7O 3CCJL 1Q82P 5DS4A 4WJ0A 3CD6L 5FCLA 3CC7L 4N06A 1S72L 1KD1M 1VQNL 1VQ6L 1M1KP 3NKDA 1Q81P 4W8KA 1VQKL 1YJNL 3G71L 3OW2K 1JJ2N 1YJNO 3G6EL 1K73M 5DS5A 1YI2O 1Q86M 1K8AP 1JJ2K 3GODA 3CCEL 1KQSN 1QVFK 3G4SL 2OTLO 2YZSA 1YHQO 1KC8M 1KQSK 3CCEO 3CCUO 1YJWL 3G4SO 1YJWO
chains in the Genus database with same CATH topology
1N8RP 1NJIM 1K73P 1Q86P 1VQ4L 1VQLL 3I56O 3CCLO 3CCRO 1K9MM 1VQ8O 1VQ4O 1VQLO 5DQZA 1VQOL 1YI2L 3CCSL 3CCVO 4XTKA 1KD1P 1VQOO 3CCSO 1M90M 2OTLL 1YHQL 1YIJL 3CCUL 3CMAL 3CCML 1VQ9L 1Q7YM 1YIJO 3CMAO 3CCMO 2QA4L 1YITO 1VQ9O 3CPWN 1QVGN 2QA4O 3I56L 3CCLL 3CCRL 1VQ8L 2OTJL 1VQPL 3CPWK 3CCVL 3CMEO 1KC8P 3CC2L 2OTJO 1VQPO 1M1KM 3CXCN 1Q81M 1YJ9L 3CC2O 5DLJA 4P6IC 5DQTA 3CCJO 1YJ9O 3CC4L 1NJIP 3CXCK 3CD6O 1VQML 1YITL 3CC4O 3CC7O 5DS6A 1K9MP 3OW2N 2QEXL 1K8AM 1S72O 3I55L 1Q82M 1VQMO 1VQNO 2QEXO 3I55O 3CCQL 1W2BN 1VQ6O 1VQ5L 1M90P 1VQKO 3G71O 3CMEL 3CCQO 1QVFN 1VQ5O 1N8RM 1VQ7L 1QVGK 3G6EO 1W2BK 1Q7YP 4QDLA 1VQ7O 3CCJL 1Q82P 5DS4A 4WJ0A 3CD6L 5FCLA 3CC7L 4N06A 1S72L 1KD1M 1VQNL 1VQ6L 1M1KP 3NKDA 1Q81P 4W8KA 1VQKL 1YJNL 3G71L 3OW2K 1JJ2N 1YJNO 3G6EL 1K73M 5DS5A 1YI2O 1Q86M 1K8AP 1JJ2K 3GODA 3CCEL 1KQSN 1QVFK 3G4SL 2OTLO 2YZSA 1YHQO 1KC8M 1KQSK 3CCEO 3CCUO 1YJWL 3G4SO 1YJWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R P;  1NJI M;  1K73 P;  1Q86 P;  1VQ4 L;  1VQL L;  3I56 O;  3CCL O;  3CCR O;  1K9M M;  1VQ8 O;  1VQ4 O;  1VQL O;  1VQO L;  1YI2 L;  3CCS L;  3CCV O;  1KD1 P;  1VQO O;  3CCS O;  1M90 M;  2OTL L;  1YHQ L;  1YIJ L;  3CCU L;  3CMA L;  3CCM L;  1VQ9 L;  1Q7Y M;  1YIJ O;  3CMA O;  3CCM O;  2QA4 L;  1YIT O;  1VQ9 O;  3CPW N;  1QVG N;  2QA4 O;  3I56 L;  3CCL L;  3CCR L;  1VQ8 L;  2OTJ L;  1VQP L;  3CPW K;  3CCV L;  3CME O;  1KC8 P;  3CC2 L;  2OTJ O;  1VQP O;  1M1K M;  3CXC N;  1Q81 M;  1YJ9 L;  3CC2 O;  3CCJ O;  1YJ9 O;  3CC4 L;  1NJI P;  3CXC K;  3CD6 O;  1VQM L;  1YIT L;  3CC4 O;  3CC7 O;  1K9M P;  3OW2 N;  2QEX L;  1K8A M;  1S72 O;  1Q82 M;  3I55 L;  1VQM O;  1VQN O;  2QEX O;  3I55 O;  3CCQ L;  1W2B N;  1VQ6 O;  1VQ5 L;  1M90 P;  1VQK O;  3G71 O;  3CME L;  3CCQ O;  1QVF N;  1VQ5 O;  1N8R M;  1VQ7 L;  1QVG K;  3G6E O;  1W2B K;  1Q7Y P;  1VQ7 O;  3CCJ L;  1Q82 P;  3CD6 L;  3CC7 L;  1S72 L;  1KD1 M;  1VQN L;  1VQ6 L;  1M1K P;  1Q81 P;  1VQK L;  1YJN L;  3G71 L;  3OW2 K;  1JJ2 N;  1YJN O;  3G6E L;  1K73 M;  1YI2 O;  1Q86 M;  1K8A P;  1JJ2 K;  3CCE L;  1KQS N;  1QVF K;  3G4S L;  2OTL O;  1YHQ O;  1KC8 M;  1KQS K;  3CCE O;  3CCU O;  1YJW L;  3G4S O;  1YJW O; 
#chains in the Genus database with same CATH topology
 1N8R P;  1NJI M;  1K73 P;  1Q86 P;  1VQ4 L;  1VQL L;  3I56 O;  3CCL O;  3CCR O;  1K9M M;  1VQ8 O;  1VQ4 O;  1VQL O;  5DQZ A;  1VQO L;  1YI2 L;  3CCS L;  3CCV O;  4XTK A;  1KD1 P;  1VQO O;  3CCS O;  1M90 M;  2OTL L;  1YHQ L;  1YIJ L;  3CCU L;  3CMA L;  3CCM L;  1VQ9 L;  1Q7Y M;  1YIJ O;  3CMA O;  3CCM O;  2QA4 L;  1YIT O;  1VQ9 O;  3CPW N;  1QVG N;  2QA4 O;  3I56 L;  3CCL L;  3CCR L;  1VQ8 L;  2OTJ L;  1VQP L;  3CPW K;  3CCV L;  3CME O;  1KC8 P;  3CC2 L;  2OTJ O;  1VQP O;  1M1K M;  3CXC N;  1Q81 M;  1YJ9 L;  3CC2 O;  5DLJ A;  4P6I C;  5DQT A;  3CCJ O;  1YJ9 O;  3CC4 L;  1NJI P;  3CXC K;  3CD6 O;  1VQM L;  1YIT L;  3CC4 O;  3CC7 O;  5DS6 A;  1K9M P;  3OW2 N;  2QEX L;  1K8A M;  1S72 O;  3I55 L;  1Q82 M;  1VQM O;  1VQN O;  2QEX O;  3I55 O;  3CCQ L;  1W2B N;  1VQ6 O;  1VQ5 L;  1M90 P;  1VQK O;  3G71 O;  3CME L;  3CCQ O;  1QVF N;  1VQ5 O;  1N8R M;  1VQ7 L;  1QVG K;  3G6E O;  1W2B K;  1Q7Y P;  4QDL A;  1VQ7 O;  3CCJ L;  1Q82 P;  5DS4 A;  4WJ0 A;  3CD6 L;  5FCL A;  3CC7 L;  4N06 A;  1S72 L;  1KD1 M;  1VQN L;  1VQ6 L;  1M1K P;  3NKD A;  1Q81 P;  4W8K A;  1VQK L;  1YJN L;  3G71 L;  3OW2 K;  1JJ2 N;  1YJN O;  3G6E L;  1K73 M;  5DS5 A;  1YI2 O;  1Q86 M;  1K8A P;  1JJ2 K;  3GOD A;  3CCE L;  1KQS N;  1QVF K;  3G4S L;  2OTL O;  2YZS A;  1YHQ O;  1KC8 M;  1KQS K;  3CCE O;  3CCU O;  1YJW L;  3G4S O;  1YJW O; 
#chains in the Genus database with same CATH homology
 1N8R P;  1NJI M;  1K73 P;  1Q86 P;  1VQ4 L;  1VQL L;  3I56 O;  3CCL O;  3CCR O;  1K9M M;  1VQ8 O;  1VQ4 O;  1VQL O;  5DQZ A;  1VQO L;  1YI2 L;  3CCS L;  3CCV O;  4XTK A;  1KD1 P;  1VQO O;  3CCS O;  1M90 M;  2OTL L;  1YHQ L;  1YIJ L;  3CCU L;  3CMA L;  3CCM L;  1VQ9 L;  1Q7Y M;  1YIJ O;  3CMA O;  3CCM O;  2QA4 L;  1YIT O;  1VQ9 O;  3CPW N;  1QVG N;  2QA4 O;  3I56 L;  3CCL L;  3CCR L;  1VQ8 L;  2OTJ L;  1VQP L;  3CPW K;  3CCV L;  3CME O;  1KC8 P;  3CC2 L;  2OTJ O;  1VQP O;  1M1K M;  3CXC N;  1Q81 M;  1YJ9 L;  3CC2 O;  5DLJ A;  4P6I C;  5DQT A;  3CCJ O;  1YJ9 O;  3CC4 L;  1NJI P;  3CXC K;  3CD6 O;  1VQM L;  1YIT L;  3CC4 O;  3CC7 O;  5DS6 A;  1K9M P;  3OW2 N;  2QEX L;  1K8A M;  1S72 O;  3I55 L;  1Q82 M;  1VQM O;  1VQN O;  2QEX O;  3I55 O;  3CCQ L;  1W2B N;  1VQ6 O;  1VQ5 L;  1M90 P;  1VQK O;  3G71 O;  3CME L;  3CCQ O;  1QVF N;  1VQ5 O;  1N8R M;  1VQ7 L;  1QVG K;  3G6E O;  1W2B K;  1Q7Y P;  4QDL A;  1VQ7 O;  3CCJ L;  1Q82 P;  5DS4 A;  4WJ0 A;  3CD6 L;  5FCL A;  3CC7 L;  4N06 A;  1S72 L;  1KD1 M;  1VQN L;  1VQ6 L;  1M1K P;  3NKD A;  1Q81 P;  4W8K A;  1VQK L;  1YJN L;  3G71 L;  3OW2 K;  1JJ2 N;  1YJN O;  3G6E L;  1K73 M;  5DS5 A;  1YI2 O;  1Q86 M;  1K8A P;  1JJ2 K;  3GOD A;  3CCE L;  1KQS N;  1QVF K;  3G4S L;  2OTL O;  2YZS A;  1YHQ O;  1KC8 M;  1KQS K;  3CCE O;  3CCU O;  1YJW L;  3G4S O;  1YJW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...