1VQ4L

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq4L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vq4L01
1VQ7L 3CCEO 3CCSL 1YITL 3CCUL 1YI2O 3CC2L 3CCMO 1YJ9O 1N8RP 1VQML 1VQ6O 1VQNO 1NJIP 1VQ4L 3CC4O 3CCJL 1Q82M 1N8RM 1VQ9L 1S72L 1YJWL 1KQSK 1NJIM 3CCQO 3CC7L 1Q7YP 1VQLO 3CD6L 1M1KP 1K8AP 3G4SL 2QA4L 2QEXL 1K73P 1Q7YM 1KC8P 3CXCN 1VQOO 1YJNL 1VQ5L 3G6EL 1KD1P 3CCRO 1K8AM 3G71L 1K73M 1YIJL 1KC8M 1M90P 1JJ2K 3CMEO 3CCEL 3CC2O 1YI2L 3CCML 1YJ9L 1VQ8O 3CPWN 1VQ6L 1QVFK 1VQNL 3CCVO 1M90M 1VQKO 3OW2N 2OTLO 3CC4L 1Q81P 1QVGN 3CCLO 3I55O 1K9MP 1YHQO 1Q86P 3CCQL 1VQPO 2OTJO 1M1KM 1Q81M 1VQLL 3I56O 1K9MM 3CMAO 1Q86M 1VQ7O 3CCSO 1YITO 3CCUO 1W2BK 1KD1M 1VQOL 1VQMO 3CCRL 1KQSN 1VQ4O 3CCJO 1VQ9O 3CMEL 1S72O 1Q82P 1YJWO 3CC7O 1VQ8L 3CCVL 3CD6O 1VQKL 2OTLL 3G4SO 2QA4O 3CCLL 3I55L 3CPWK 2QEXO 1YHQL 1YJNO 1VQ5O 1VQPL 3G6EO 3OW2K 1JJ2N 2OTJL 1W2BN 1QVGK 3I56L 3G71O 1YIJO 1QVFN 3CMAL 3CXCK
chains in the Genus database with same CATH superfamily
1VQ7L 5DS5A 3CCEO 3CCSL 1YITL 3CCUL 1YI2O 3CC2L 3CCMO 1YJ9O 1N8RP 1VQML 1VQ6O 1VQNO 1NJIP 1VQ4L 3CC4O 3CCJL 1Q82M 1N8RM 1VQ9L 4N06A 1S72L 1YJWL 1KQSK 1NJIM 3CCQO 3CC7L 1Q7YP 1VQLO 3CD6L 1M1KP 1K8AP 3G4SL 2QA4L 2QEXL 1K73P 5FCLA 1Q7YM 1KC8P 3CXCN 1VQOO 1YJNL 1VQ5L 3G6EL 1KD1P 3CCRO 1K8AM 4W8KA 3G71L 1K73M 1YIJL 1KC8M 1M90P 1JJ2K 3CMEO 3CCEL 3CC2O 4WJ0A 4XTKA 1YI2L 3CCML 1YJ9L 1VQ8O 3CPWN 5DS4A 1VQ6L 1QVFK 1VQNL 3CCVO 1M90M 1VQKO 3OW2N 2OTLO 3CC4L 1Q81P 1QVGN 3CCLO 3I55O 1K9MP 4P6IC 1YHQO 1Q86P 3CCQL 1VQPO 2OTJO 1M1KM 5DS6A 1Q81M 1VQLL 3I56O 1K9MM 3CMAO 1Q86M 1VQ7O 3CCSO 1YITO 3GODA 3CCUO 1W2BK 1KD1M 1VQOL 1VQMO 3CCRL 1KQSN 1VQ4O 5DQTA 2YZSA 3CCJO 1VQ9O 3CMEL 1S72O 1Q82P 1YJWO 3CC7O 1VQ8L 3CCVL 3CD6O 1VQKL 5DQZA 2OTLL 3NKDA 3G4SO 2QA4O 3CCLL 3I55L 3CPWK 2QEXO 4QDLA 1YHQL 1YJNO 1VQ5O 1VQPL 3G6EO 3OW2K 1JJ2N 2OTJL 1W2BN 1QVGK 3I56L 3G71O 1YIJO 1QVFN 3CMAL 5DLJA 3CXCK
chains in the Genus database with same CATH topology
1VQ7L 5DS5A 3CCEO 3CCSL 1YITL 3CCUL 1YI2O 3CC2L 3CCMO 1YJ9O 1N8RP 1VQML 1VQ6O 1VQNO 1NJIP 1VQ4L 3CC4O 3CCJL 1Q82M 1N8RM 1VQ9L 4N06A 1S72L 1YJWL 1KQSK 1NJIM 3CCQO 3CC7L 1Q7YP 1VQLO 3CD6L 1M1KP 1K8AP 3G4SL 2QA4L 2QEXL 1K73P 5FCLA 1Q7YM 1KC8P 3CXCN 1VQOO 1YJNL 1VQ5L 3G6EL 1KD1P 3CCRO 1K8AM 4W8KA 3G71L 1K73M 1YIJL 1KC8M 1M90P 1JJ2K 3CMEO 3CCEL 3CC2O 4WJ0A 4XTKA 1YI2L 3CCML 1YJ9L 1VQ8O 3CPWN 5DS4A 1VQ6L 1QVFK 1VQNL 3CCVO 1M90M 1VQKO 3OW2N 2OTLO 3CC4L 1Q81P 1QVGN 3CCLO 3I55O 1K9MP 4P6IC 1YHQO 1Q86P 3CCQL 1VQPO 2OTJO 1M1KM 5DS6A 1Q81M 1VQLL 3I56O 1K9MM 3CMAO 1Q86M 1VQ7O 3CCSO 1YITO 3GODA 3CCUO 1W2BK 1KD1M 1VQOL 1VQMO 3CCRL 1KQSN 1VQ4O 5DQTA 2YZSA 3CCJO 1VQ9O 3CMEL 1S72O 1Q82P 1YJWO 3CC7O 1VQ8L 3CCVL 3CD6O 1VQKL 5DQZA 2OTLL 3NKDA 3G4SO 2QA4O 3CCLL 3I55L 3CPWK 2QEXO 4QDLA 1YHQL 1YJNO 1VQ5O 1VQPL 3G6EO 3OW2K 1JJ2N 2OTJL 1W2BN 1QVGK 3I56L 3G71O 1YIJO 1QVFN 3CMAL 5DLJA 3CXCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 L;  3CCE O;  3CCS L;  1YIT L;  3CCU L;  1YI2 O;  3CC2 L;  3CCM O;  1YJ9 O;  1N8R P;  1VQM L;  1VQ6 O;  1VQN O;  1NJI P;  1VQ4 L;  3CC4 O;  3CCJ L;  1Q82 M;  1N8R M;  1VQ9 L;  1S72 L;  1YJW L;  1KQS K;  1NJI M;  3CCQ O;  3CC7 L;  1Q7Y P;  1VQL O;  3CD6 L;  1M1K P;  1K8A P;  3G4S L;  2QA4 L;  2QEX L;  1K73 P;  1Q7Y M;  1KC8 P;  3CXC N;  1VQO O;  1YJN L;  1VQ5 L;  3G6E L;  1KD1 P;  3CCR O;  1K8A M;  3G71 L;  1K73 M;  1YIJ L;  1KC8 M;  1M90 P;  1JJ2 K;  3CME O;  3CCE L;  3CC2 O;  1YI2 L;  3CCM L;  1YJ9 L;  1VQ8 O;  3CPW N;  1VQ6 L;  1QVF K;  1VQN L;  3CCV O;  1M90 M;  1VQK O;  3OW2 N;  2OTL O;  3CC4 L;  1Q81 P;  1QVG N;  3CCL O;  3I55 O;  1K9M P;  1YHQ O;  1Q86 P;  3CCQ L;  1VQP O;  2OTJ O;  1M1K M;  1Q81 M;  1VQL L;  3I56 O;  1K9M M;  3CMA O;  1Q86 M;  1VQ7 O;  3CCS O;  1YIT O;  3CCU O;  1W2B K;  1KD1 M;  1VQO L;  1VQM O;  3CCR L;  1KQS N;  1VQ4 O;  3CCJ O;  1VQ9 O;  3CME L;  1S72 O;  1Q82 P;  1YJW O;  3CC7 O;  1VQ8 L;  3CCV L;  3CD6 O;  1VQK L;  2OTL L;  3G4S O;  2QA4 O;  3CCL L;  3I55 L;  3CPW K;  2QEX O;  1YHQ L;  1YJN O;  1VQ5 O;  1VQP L;  3G6E O;  3OW2 K;  1JJ2 N;  2OTJ L;  1W2B N;  1QVG K;  3I56 L;  3G71 O;  1YIJ O;  1QVF N;  3CMA L;  3CXC K; 
#chains in the Genus database with same CATH topology
 1VQ7 L;  5DS5 A;  3CCE O;  3CCS L;  1YIT L;  3CCU L;  1YI2 O;  3CC2 L;  3CCM O;  1YJ9 O;  1N8R P;  1VQM L;  1VQ6 O;  1VQN O;  1NJI P;  1VQ4 L;  3CC4 O;  3CCJ L;  1Q82 M;  1N8R M;  1VQ9 L;  4N06 A;  1S72 L;  1YJW L;  1KQS K;  1NJI M;  3CCQ O;  3CC7 L;  1Q7Y P;  1VQL O;  3CD6 L;  1M1K P;  1K8A P;  3G4S L;  2QA4 L;  2QEX L;  1K73 P;  5FCL A;  1Q7Y M;  1KC8 P;  3CXC N;  1VQO O;  1YJN L;  1VQ5 L;  3G6E L;  1KD1 P;  3CCR O;  1K8A M;  4W8K A;  3G71 L;  1K73 M;  1YIJ L;  1KC8 M;  1M90 P;  1JJ2 K;  3CME O;  3CCE L;  3CC2 O;  4WJ0 A;  4XTK A;  1YI2 L;  3CCM L;  1YJ9 L;  1VQ8 O;  3CPW N;  5DS4 A;  1VQ6 L;  1QVF K;  1VQN L;  3CCV O;  1M90 M;  1VQK O;  3OW2 N;  2OTL O;  3CC4 L;  1Q81 P;  1QVG N;  3CCL O;  3I55 O;  1K9M P;  4P6I C;  1YHQ O;  1Q86 P;  3CCQ L;  1VQP O;  2OTJ O;  1M1K M;  5DS6 A;  1Q81 M;  1VQL L;  3I56 O;  1K9M M;  3CMA O;  1Q86 M;  1VQ7 O;  3CCS O;  1YIT O;  3GOD A;  3CCU O;  1W2B K;  1KD1 M;  1VQO L;  1VQM O;  3CCR L;  1KQS N;  1VQ4 O;  5DQT A;  2YZS A;  3CCJ O;  1VQ9 O;  3CME L;  1S72 O;  1Q82 P;  1YJW O;  3CC7 O;  1VQ8 L;  3CCV L;  3CD6 O;  1VQK L;  5DQZ A;  2OTL L;  3NKD A;  3G4S O;  2QA4 O;  3CCL L;  3I55 L;  3CPW K;  2QEX O;  4QDL A;  1YHQ L;  1YJN O;  1VQ5 O;  1VQP L;  3G6E O;  3OW2 K;  1JJ2 N;  2OTJ L;  1W2B N;  1QVG K;  3I56 L;  3G71 O;  1YIJ O;  1QVF N;  3CMA L;  5DLJ A;  3CXC K; 
#chains in the Genus database with same CATH homology
 1VQ7 L;  5DS5 A;  3CCE O;  3CCS L;  1YIT L;  3CCU L;  1YI2 O;  3CC2 L;  3CCM O;  1YJ9 O;  1N8R P;  1VQM L;  1VQ6 O;  1VQN O;  1NJI P;  1VQ4 L;  3CC4 O;  3CCJ L;  1Q82 M;  1N8R M;  1VQ9 L;  4N06 A;  1S72 L;  1YJW L;  1KQS K;  1NJI M;  3CCQ O;  3CC7 L;  1Q7Y P;  1VQL O;  3CD6 L;  1M1K P;  1K8A P;  3G4S L;  2QA4 L;  2QEX L;  1K73 P;  5FCL A;  1Q7Y M;  1KC8 P;  3CXC N;  1VQO O;  1YJN L;  1VQ5 L;  3G6E L;  1KD1 P;  3CCR O;  1K8A M;  4W8K A;  3G71 L;  1K73 M;  1YIJ L;  1KC8 M;  1M90 P;  1JJ2 K;  3CME O;  3CCE L;  3CC2 O;  4WJ0 A;  4XTK A;  1YI2 L;  3CCM L;  1YJ9 L;  1VQ8 O;  3CPW N;  5DS4 A;  1VQ6 L;  1QVF K;  1VQN L;  3CCV O;  1M90 M;  1VQK O;  3OW2 N;  2OTL O;  3CC4 L;  1Q81 P;  1QVG N;  3CCL O;  3I55 O;  1K9M P;  4P6I C;  1YHQ O;  1Q86 P;  3CCQ L;  1VQP O;  2OTJ O;  1M1K M;  5DS6 A;  1Q81 M;  1VQL L;  3I56 O;  1K9M M;  3CMA O;  1Q86 M;  1VQ7 O;  3CCS O;  1YIT O;  3GOD A;  3CCU O;  1W2B K;  1KD1 M;  1VQO L;  1VQM O;  3CCR L;  1KQS N;  1VQ4 O;  5DQT A;  2YZS A;  3CCJ O;  1VQ9 O;  3CME L;  1S72 O;  1Q82 P;  1YJW O;  3CC7 O;  1VQ8 L;  3CCV L;  3CD6 O;  1VQK L;  5DQZ A;  2OTL L;  3NKD A;  3G4S O;  2QA4 O;  3CCL L;  3I55 L;  3CPW K;  2QEX O;  4QDL A;  1YHQ L;  1YJN O;  1VQ5 O;  1VQP L;  3G6E O;  3OW2 K;  1JJ2 N;  2OTJ L;  1W2B N;  1QVG K;  3I56 L;  3G71 O;  1YIJ O;  1QVF N;  3CMA L;  5DLJ A;  3CXC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...