1VQ5L

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq5L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vq5L01
3CCML 1K9MP 1NJIM 3CC4O 3CCJL 1M1KP 1K8AP 3G71O 3G4SL 3CCQO 1QVGN 1YIJO 1JJ2K 1YJ9O 1YI2L 1KD1M 1VQ6O 1KQSK 3I55O 1VQML 3OW2N 1VQ9O 3OW2K 3CCLO 3CCEL 1W2BK 3CCSL 1VQOO 3CXCK 3CC7L 1VQNL 1Q82P 3CD6L 1N8RM 3CCVL 3CMAL 1VQ4L 1QVFK 1Q81M 3CCUO 1YJNL 1VQ7L 2QEXO 1VQKO 1K73M 1JJ2N 2QA4O 3CPWK 1YJWL 1K9MM 3I56O 1S72L 1KQSN 3CMEO 3CCMO 1VQ8O 1M1KM 3CC4L 3CCJO 1K8AM 1M90P 3G6EL 1YIJL 1W2BN 1YJ9L 3CCRL 1YHQL 3CXCN 1Q7YP 1QVFN 2OTLO 1VQ9L 1KC8P 3CCLL 1VQLO 3CCSO 3CPWN 1Q82M 1YITO 1VQNO 1VQOL 1Q7YM 2OTJO 1VQ5O 3CC2L 3CCVO 1Q86P 1VQPL 1YJNO 1VQ7O 1NJIP 2QEXL 1VQKL 3G4SO 3G71L 3CCQL 1YI2O 1YJWO 3I56L 1M90M 1VQ8L 1VQ6L 1VQMO 3I55L 1KD1P 3G6EO 1QVGK 3CCRO 1YHQO 3CCEO 3CC7O 3CD6O 2OTLL 3CMAO 1KC8M 1VQ4O 1N8RP 3CCUL 1Q81P 1VQLL 2OTJL 1YITL 2QA4L 1Q86M 1K73P 1VQ5L 3CC2O 1S72O 1VQPO 3CMEL
chains in the Genus database with same CATH superfamily
3CCML 1K9MP 1NJIM 3CC4O 3CCJL 1M1KP 1K8AP 3G71O 3G4SL 3CCQO 1QVGN 1YIJO 1JJ2K 1YJ9O 1YI2L 2YZSA 1KD1M 1VQ6O 1KQSK 3I55O 3GODA 1VQML 4N06A 3OW2N 1VQ9O 3OW2K 5DQZA 3CCLO 3CCEL 1W2BK 3CCSL 5DQTA 1VQOO 3CXCK 3CC7L 1VQNL 1Q82P 3CD6L 1N8RM 3CCVL 3CMAL 1VQ4L 1QVFK 1Q81M 4WJ0A 3CCUO 1YJNL 1VQ7L 2QEXO 1VQKO 1K73M 1JJ2N 2QA4O 3CPWK 1YJWL 1K9MM 3I56O 1S72L 1KQSN 3CMEO 3CCMO 1VQ8O 5DS5A 1M1KM 3CC4L 3CCJO 1K8AM 1M90P 3G6EL 1YIJL 1W2BN 1YJ9L 3CCRL 1YHQL 3CXCN 1Q7YP 1QVFN 2OTLO 1VQ9L 1KC8P 5FCLA 3CCLL 1VQLO 3CCSO 3CPWN 1Q82M 1YITO 1VQNO 1VQOL 1Q7YM 2OTJO 1VQ5O 3CC2L 3CCVO 1Q86P 1VQPL 1YJNO 1VQ7O 1NJIP 3NKDA 2QEXL 1VQKL 3G4SO 3G71L 3CCQL 4W8KA 5DS6A 1YI2O 1YJWO 3I56L 1M90M 1VQ8L 1VQ6L 1VQMO 3I55L 1KD1P 3G6EO 5DLJA 5DS4A 1QVGK 3CCRO 1YHQO 3CCEO 4XTKA 3CC7O 3CD6O 2OTLL 3CMAO 1KC8M 1VQ4O 1N8RP 4P6IC 3CCUL 1Q81P 4QDLA 1VQLL 2OTJL 1YITL 2QA4L 1Q86M 1K73P 1VQ5L 3CC2O 1S72O 1VQPO 3CMEL
chains in the Genus database with same CATH topology
3CCML 1K9MP 1NJIM 3CC4O 3CCJL 1M1KP 1K8AP 3G71O 3G4SL 3CCQO 1QVGN 1YIJO 1JJ2K 1YJ9O 1YI2L 2YZSA 1KD1M 1VQ6O 1KQSK 3I55O 3GODA 1VQML 4N06A 3OW2N 1VQ9O 3OW2K 5DQZA 3CCLO 3CCEL 1W2BK 3CCSL 5DQTA 1VQOO 3CXCK 3CC7L 1VQNL 1Q82P 3CD6L 1N8RM 3CCVL 3CMAL 1VQ4L 1QVFK 1Q81M 4WJ0A 3CCUO 1YJNL 1VQ7L 2QEXO 1VQKO 1K73M 1JJ2N 2QA4O 3CPWK 1YJWL 1K9MM 3I56O 1S72L 1KQSN 3CMEO 3CCMO 1VQ8O 5DS5A 1M1KM 3CC4L 3CCJO 1K8AM 1M90P 3G6EL 1YIJL 1W2BN 1YJ9L 3CCRL 1YHQL 3CXCN 1Q7YP 1QVFN 2OTLO 1VQ9L 1KC8P 5FCLA 3CCLL 1VQLO 3CCSO 3CPWN 1Q82M 1YITO 1VQNO 1VQOL 1Q7YM 2OTJO 1VQ5O 3CC2L 3CCVO 1Q86P 1VQPL 1YJNO 1VQ7O 1NJIP 3NKDA 2QEXL 1VQKL 3G4SO 3G71L 3CCQL 4W8KA 5DS6A 1YI2O 1YJWO 3I56L 1M90M 1VQ8L 1VQ6L 1VQMO 3I55L 1KD1P 3G6EO 5DLJA 5DS4A 1QVGK 3CCRO 1YHQO 3CCEO 4XTKA 3CC7O 3CD6O 2OTLL 3CMAO 1KC8M 1VQ4O 1N8RP 4P6IC 3CCUL 1Q81P 4QDLA 1VQLL 2OTJL 1YITL 2QA4L 1Q86M 1K73P 1VQ5L 3CC2O 1S72O 1VQPO 3CMEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM L;  1K9M P;  1NJI M;  3CC4 O;  3CCJ L;  1M1K P;  1K8A P;  3G71 O;  3G4S L;  3CCQ O;  1QVG N;  1YIJ O;  1JJ2 K;  1YJ9 O;  1YI2 L;  1KD1 M;  1VQ6 O;  1KQS K;  3I55 O;  1VQM L;  3OW2 N;  1VQ9 O;  3OW2 K;  3CCL O;  3CCE L;  1W2B K;  3CCS L;  1VQO O;  3CXC K;  3CC7 L;  1VQN L;  1Q82 P;  3CD6 L;  1N8R M;  3CCV L;  3CMA L;  1VQ4 L;  1QVF K;  1Q81 M;  3CCU O;  1YJN L;  1VQ7 L;  2QEX O;  1VQK O;  1K73 M;  1JJ2 N;  2QA4 O;  3CPW K;  1YJW L;  1K9M M;  3I56 O;  1S72 L;  1KQS N;  3CME O;  3CCM O;  1VQ8 O;  1M1K M;  3CC4 L;  3CCJ O;  1K8A M;  1M90 P;  3G6E L;  1YIJ L;  1W2B N;  1YJ9 L;  3CCR L;  1YHQ L;  3CXC N;  1Q7Y P;  1QVF N;  2OTL O;  1VQ9 L;  1KC8 P;  3CCL L;  1VQL O;  3CCS O;  3CPW N;  1Q82 M;  1YIT O;  1VQN O;  1VQO L;  1Q7Y M;  2OTJ O;  1VQ5 O;  3CC2 L;  3CCV O;  1Q86 P;  1VQP L;  1YJN O;  1VQ7 O;  1NJI P;  2QEX L;  1VQK L;  3G4S O;  3G71 L;  3CCQ L;  1YI2 O;  1YJW O;  3I56 L;  1M90 M;  1VQ8 L;  1VQ6 L;  1VQM O;  3I55 L;  1KD1 P;  3G6E O;  1QVG K;  3CCR O;  1YHQ O;  3CCE O;  3CC7 O;  3CD6 O;  2OTL L;  3CMA O;  1KC8 M;  1VQ4 O;  1N8R P;  3CCU L;  1Q81 P;  1VQL L;  2OTJ L;  1YIT L;  2QA4 L;  1Q86 M;  1K73 P;  1VQ5 L;  3CC2 O;  1S72 O;  1VQP O;  3CME L; 
#chains in the Genus database with same CATH topology
 3CCM L;  1K9M P;  1NJI M;  3CC4 O;  3CCJ L;  1M1K P;  1K8A P;  3G71 O;  3G4S L;  3CCQ O;  1QVG N;  1YIJ O;  1JJ2 K;  1YJ9 O;  1YI2 L;  2YZS A;  1KD1 M;  1VQ6 O;  1KQS K;  3I55 O;  3GOD A;  1VQM L;  4N06 A;  3OW2 N;  1VQ9 O;  3OW2 K;  5DQZ A;  3CCL O;  3CCE L;  1W2B K;  3CCS L;  5DQT A;  1VQO O;  3CXC K;  3CC7 L;  1VQN L;  1Q82 P;  3CD6 L;  1N8R M;  3CCV L;  3CMA L;  1VQ4 L;  1QVF K;  1Q81 M;  4WJ0 A;  3CCU O;  1YJN L;  1VQ7 L;  2QEX O;  1VQK O;  1K73 M;  1JJ2 N;  2QA4 O;  3CPW K;  1YJW L;  1K9M M;  3I56 O;  1S72 L;  1KQS N;  3CME O;  3CCM O;  1VQ8 O;  5DS5 A;  1M1K M;  3CC4 L;  3CCJ O;  1K8A M;  1M90 P;  3G6E L;  1YIJ L;  1W2B N;  1YJ9 L;  3CCR L;  1YHQ L;  3CXC N;  1Q7Y P;  1QVF N;  2OTL O;  1VQ9 L;  1KC8 P;  5FCL A;  3CCL L;  1VQL O;  3CCS O;  3CPW N;  1Q82 M;  1YIT O;  1VQN O;  1VQO L;  1Q7Y M;  2OTJ O;  1VQ5 O;  3CC2 L;  3CCV O;  1Q86 P;  1VQP L;  1YJN O;  1VQ7 O;  1NJI P;  3NKD A;  2QEX L;  1VQK L;  3G4S O;  3G71 L;  3CCQ L;  4W8K A;  5DS6 A;  1YI2 O;  1YJW O;  3I56 L;  1M90 M;  1VQ8 L;  1VQ6 L;  1VQM O;  3I55 L;  1KD1 P;  3G6E O;  5DLJ A;  5DS4 A;  1QVG K;  3CCR O;  1YHQ O;  3CCE O;  4XTK A;  3CC7 O;  3CD6 O;  2OTL L;  3CMA O;  1KC8 M;  1VQ4 O;  1N8R P;  4P6I C;  3CCU L;  1Q81 P;  4QDL A;  1VQL L;  2OTJ L;  1YIT L;  2QA4 L;  1Q86 M;  1K73 P;  1VQ5 L;  3CC2 O;  1S72 O;  1VQP O;  3CME L; 
#chains in the Genus database with same CATH homology
 3CCM L;  1K9M P;  1NJI M;  3CC4 O;  3CCJ L;  1M1K P;  1K8A P;  3G71 O;  3G4S L;  3CCQ O;  1QVG N;  1YIJ O;  1JJ2 K;  1YJ9 O;  1YI2 L;  2YZS A;  1KD1 M;  1VQ6 O;  1KQS K;  3I55 O;  3GOD A;  1VQM L;  4N06 A;  3OW2 N;  1VQ9 O;  3OW2 K;  5DQZ A;  3CCL O;  3CCE L;  1W2B K;  3CCS L;  5DQT A;  1VQO O;  3CXC K;  3CC7 L;  1VQN L;  1Q82 P;  3CD6 L;  1N8R M;  3CCV L;  3CMA L;  1VQ4 L;  1QVF K;  1Q81 M;  4WJ0 A;  3CCU O;  1YJN L;  1VQ7 L;  2QEX O;  1VQK O;  1K73 M;  1JJ2 N;  2QA4 O;  3CPW K;  1YJW L;  1K9M M;  3I56 O;  1S72 L;  1KQS N;  3CME O;  3CCM O;  1VQ8 O;  5DS5 A;  1M1K M;  3CC4 L;  3CCJ O;  1K8A M;  1M90 P;  3G6E L;  1YIJ L;  1W2B N;  1YJ9 L;  3CCR L;  1YHQ L;  3CXC N;  1Q7Y P;  1QVF N;  2OTL O;  1VQ9 L;  1KC8 P;  5FCL A;  3CCL L;  1VQL O;  3CCS O;  3CPW N;  1Q82 M;  1YIT O;  1VQN O;  1VQO L;  1Q7Y M;  2OTJ O;  1VQ5 O;  3CC2 L;  3CCV O;  1Q86 P;  1VQP L;  1YJN O;  1VQ7 O;  1NJI P;  3NKD A;  2QEX L;  1VQK L;  3G4S O;  3G71 L;  3CCQ L;  4W8K A;  5DS6 A;  1YI2 O;  1YJW O;  3I56 L;  1M90 M;  1VQ8 L;  1VQ6 L;  1VQM O;  3I55 L;  1KD1 P;  3G6E O;  5DLJ A;  5DS4 A;  1QVG K;  3CCR O;  1YHQ O;  3CCE O;  4XTK A;  3CC7 O;  3CD6 O;  2OTL L;  3CMA O;  1KC8 M;  1VQ4 O;  1N8R P;  4P6I C;  3CCU L;  1Q81 P;  4QDL A;  1VQL L;  2OTJ L;  1YIT L;  2QA4 L;  1Q86 M;  1K73 P;  1VQ5 L;  3CC2 O;  1S72 O;  1VQP O;  3CME L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...