1VQKL

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 28
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vqkL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vqkL01
3G6EO 1W2BK 2QA4L 3CCRL 1VQ7L 1VQLO 3CC4O 1VQ5L 1Q82P 1KQSK 2QEXO 1M90M 3CCEL 2OTLO 3CPWN 1S72O 1Q7YP 1VQ4O 3CCML 1VQ9L 3CMEO 1W2BN 3CCQL 1VQNL 1YITO 1VQPL 3OW2K 1VQ8L 1KQSN 1M1KM 3G6EL 3I55O 1KD1M 1Q86M 1K9MM 1VQ6O 1VQLL 1KC8P 1Q81M 2QEXL 1K73P 3OW2N 1YHQO 1YJWO 3CD6O 2OTLL 3CC2O 1NJIP 1S72L 1QVFK 1N8RP 1VQ4L 3CC7O 3CCVO 3CMEL 3CCLL 1K8AP 1Q7YM 3G71O 1YIJL 1VQOL 1YITL 1VQKO 3CCUO 3CCSO 1QVGK 3I55L 1QVFN 2OTJO 1YJ9O 1YJNO 1JJ2K 1VQ6L 3CXCK 1M90P 3CMAO 1YHQL 1VQ7O 3CC2L 3CC4L 1YI2O 3CCEO 3CC7L 3G4SO 1QVGN 3CCVL 1Q82M 1VQMO 3G71L 1JJ2N 3CCUL 3I56O 3CXCN 1M1KP 1VQ8O 2OTJL 1YJ9L 3CCJO 1KD1P 1Q86P 1K9MP 1YJNL 1Q81P 3CMAL 2QA4O 1YJWL 3CCRO 1YI2L 3CD6L 3G4SL 1KC8M 1VQ5O 1K73M 1VQML 1NJIM 3I56L 1N8RM 3CCMO 3CCLO 1VQKL 1YIJO 1VQOO 1VQ9O 1K8AM 3CCQO 1VQNO 3CCSL 1VQPO 3CCJL 3CPWK
chains in the Genus database with same CATH superfamily
4W8KA 3G6EO 1W2BK 2QA4L 3CCRL 1VQ7L 1VQLO 3CC4O 1VQ5L 1Q82P 1KQSK 2QEXO 1M90M 3CCEL 2OTLO 3CPWN 1S72O 1Q7YP 1VQ4O 3CCML 1VQ9L 3CMEO 1W2BN 3CCQL 1VQNL 4WJ0A 1VQPL 3OW2K 1YITO 1VQ8L 1KQSN 1M1KM 5DS5A 3G6EL 3I55O 1KD1M 1Q86M 1K9MM 1VQ6O 1VQLL 1KC8P 1Q81M 2QEXL 1K73P 3OW2N 1YHQO 1YJWO 3CD6O 2OTLL 4QDLA 3CC2O 1NJIP 1S72L 1QVFK 1N8RP 1VQ4L 3CC7O 2YZSA 3CCVO 3CMEL 3CCLL 1K8AP 1Q7YM 3G71O 1YIJL 1VQOL 1YITL 1VQKO 3CCUO 3CCSO 5DS4A 1QVGK 3I55L 1QVFN 2OTJO 1YJ9O 3NKDA 5DS6A 1YJNO 1JJ2K 1VQ6L 3CXCK 1M90P 3CMAO 1YHQL 1VQ7O 3CC2L 3CC4L 1YI2O 3CCEO 3CC7L 3G4SO 1QVGN 3CCVL 1Q82M 5DQTA 1VQMO 4P6IC 3G71L 1JJ2N 3CCUL 3I56O 3CXCN 1M1KP 1VQ8O 2OTJL 1YJ9L 3CCJO 1KD1P 1Q86P 1K9MP 1YJNL 1Q81P 4XTKA 5DLJA 3CMAL 2QA4O 1YJWL 3CCRO 1YI2L 3CD6L 5DQZA 3G4SL 1KC8M 1VQ5O 1K73M 1VQML 1NJIM 3I56L 1N8RM 3CCMO 3CCLO 4N06A 1VQKL 1YIJO 1VQOO 1VQ9O 5FCLA 3GODA 1K8AM 3CCQO 1VQNO 3CCSL 1VQPO 3CCJL 3CPWK
chains in the Genus database with same CATH topology
4W8KA 3G6EO 1W2BK 2QA4L 3CCRL 1VQ7L 1VQLO 3CC4O 1VQ5L 1Q82P 1KQSK 2QEXO 1M90M 3CCEL 2OTLO 3CPWN 1S72O 1Q7YP 1VQ4O 3CCML 1VQ9L 3CMEO 1W2BN 3CCQL 1VQNL 4WJ0A 1VQPL 3OW2K 1YITO 1VQ8L 1KQSN 1M1KM 5DS5A 3G6EL 3I55O 1KD1M 1Q86M 1K9MM 1VQ6O 1VQLL 1KC8P 1Q81M 2QEXL 1K73P 3OW2N 1YHQO 1YJWO 3CD6O 2OTLL 4QDLA 3CC2O 1NJIP 1S72L 1QVFK 1N8RP 1VQ4L 3CC7O 2YZSA 3CCVO 3CMEL 3CCLL 1K8AP 1Q7YM 3G71O 1YIJL 1VQOL 1YITL 1VQKO 3CCUO 3CCSO 5DS4A 1QVGK 3I55L 1QVFN 2OTJO 1YJ9O 3NKDA 5DS6A 1YJNO 1JJ2K 1VQ6L 3CXCK 1M90P 3CMAO 1YHQL 1VQ7O 3CC2L 3CC4L 1YI2O 3CCEO 3CC7L 3G4SO 1QVGN 3CCVL 1Q82M 5DQTA 1VQMO 4P6IC 3G71L 1JJ2N 3CCUL 3I56O 3CXCN 1M1KP 1VQ8O 2OTJL 1YJ9L 3CCJO 1KD1P 1Q86P 1K9MP 1YJNL 1Q81P 4XTKA 5DLJA 3CMAL 2QA4O 1YJWL 3CCRO 1YI2L 3CD6L 5DQZA 3G4SL 1KC8M 1VQ5O 1K73M 1VQML 1NJIM 3I56L 1N8RM 3CCMO 3CCLO 4N06A 1VQKL 1YIJO 1VQOO 1VQ9O 5FCLA 3GODA 1K8AM 3CCQO 1VQNO 3CCSL 1VQPO 3CCJL 3CPWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E O;  1W2B K;  2QA4 L;  3CCR L;  1VQ7 L;  1VQL O;  3CC4 O;  1VQ5 L;  1Q82 P;  1KQS K;  2QEX O;  1M90 M;  3CCE L;  2OTL O;  3CPW N;  1S72 O;  1Q7Y P;  1VQ4 O;  3CCM L;  1VQ9 L;  3CME O;  1W2B N;  3CCQ L;  1VQN L;  1YIT O;  1VQP L;  3OW2 K;  1VQ8 L;  1KQS N;  1M1K M;  3G6E L;  3I55 O;  1KD1 M;  1Q86 M;  1K9M M;  1VQ6 O;  1VQL L;  1KC8 P;  1Q81 M;  2QEX L;  1K73 P;  3OW2 N;  1YHQ O;  1YJW O;  3CD6 O;  2OTL L;  3CC2 O;  1NJI P;  1S72 L;  1QVF K;  1N8R P;  1VQ4 L;  3CC7 O;  3CCV O;  3CME L;  3CCL L;  1K8A P;  1Q7Y M;  3G71 O;  1YIJ L;  1VQO L;  1YIT L;  1VQK O;  3CCU O;  3CCS O;  1QVG K;  3I55 L;  1QVF N;  2OTJ O;  1YJ9 O;  1YJN O;  1JJ2 K;  1VQ6 L;  3CXC K;  1M90 P;  3CMA O;  1YHQ L;  1VQ7 O;  3CC2 L;  3CC4 L;  1YI2 O;  3CCE O;  3CC7 L;  3G4S O;  1QVG N;  3CCV L;  1Q82 M;  1VQM O;  3G71 L;  1JJ2 N;  3CCU L;  3I56 O;  3CXC N;  1M1K P;  1VQ8 O;  2OTJ L;  1YJ9 L;  3CCJ O;  1KD1 P;  1Q86 P;  1K9M P;  1YJN L;  1Q81 P;  3CMA L;  2QA4 O;  1YJW L;  3CCR O;  1YI2 L;  3CD6 L;  3G4S L;  1KC8 M;  1VQ5 O;  1K73 M;  1VQM L;  1NJI M;  3I56 L;  1N8R M;  3CCM O;  3CCL O;  1VQK L;  1YIJ O;  1VQO O;  1VQ9 O;  1K8A M;  3CCQ O;  1VQN O;  3CCS L;  1VQP O;  3CCJ L;  3CPW K; 
#chains in the Genus database with same CATH topology
 4W8K A;  3G6E O;  1W2B K;  2QA4 L;  3CCR L;  1VQ7 L;  1VQL O;  3CC4 O;  1VQ5 L;  1Q82 P;  1KQS K;  2QEX O;  1M90 M;  3CCE L;  2OTL O;  3CPW N;  1S72 O;  1Q7Y P;  1VQ4 O;  3CCM L;  1VQ9 L;  3CME O;  1W2B N;  3CCQ L;  1VQN L;  4WJ0 A;  1VQP L;  3OW2 K;  1YIT O;  1VQ8 L;  1KQS N;  1M1K M;  5DS5 A;  3G6E L;  3I55 O;  1KD1 M;  1Q86 M;  1K9M M;  1VQ6 O;  1VQL L;  1KC8 P;  1Q81 M;  2QEX L;  1K73 P;  3OW2 N;  1YHQ O;  1YJW O;  3CD6 O;  2OTL L;  4QDL A;  3CC2 O;  1NJI P;  1S72 L;  1QVF K;  1N8R P;  1VQ4 L;  3CC7 O;  2YZS A;  3CCV O;  3CME L;  3CCL L;  1K8A P;  1Q7Y M;  3G71 O;  1YIJ L;  1VQO L;  1YIT L;  1VQK O;  3CCU O;  3CCS O;  5DS4 A;  1QVG K;  3I55 L;  1QVF N;  2OTJ O;  1YJ9 O;  3NKD A;  5DS6 A;  1YJN O;  1JJ2 K;  1VQ6 L;  3CXC K;  1M90 P;  3CMA O;  1YHQ L;  1VQ7 O;  3CC2 L;  3CC4 L;  1YI2 O;  3CCE O;  3CC7 L;  3G4S O;  1QVG N;  3CCV L;  1Q82 M;  5DQT A;  1VQM O;  4P6I C;  3G71 L;  1JJ2 N;  3CCU L;  3I56 O;  3CXC N;  1M1K P;  1VQ8 O;  2OTJ L;  1YJ9 L;  3CCJ O;  1KD1 P;  1Q86 P;  1K9M P;  1YJN L;  1Q81 P;  4XTK A;  5DLJ A;  3CMA L;  2QA4 O;  1YJW L;  3CCR O;  1YI2 L;  3CD6 L;  5DQZ A;  3G4S L;  1KC8 M;  1VQ5 O;  1K73 M;  1VQM L;  1NJI M;  3I56 L;  1N8R M;  3CCM O;  3CCL O;  4N06 A;  1VQK L;  1YIJ O;  1VQO O;  1VQ9 O;  5FCL A;  3GOD A;  1K8A M;  3CCQ O;  1VQN O;  3CCS L;  1VQP O;  3CCJ L;  3CPW K; 
#chains in the Genus database with same CATH homology
 4W8K A;  3G6E O;  1W2B K;  2QA4 L;  3CCR L;  1VQ7 L;  1VQL O;  3CC4 O;  1VQ5 L;  1Q82 P;  1KQS K;  2QEX O;  1M90 M;  3CCE L;  2OTL O;  3CPW N;  1S72 O;  1Q7Y P;  1VQ4 O;  3CCM L;  1VQ9 L;  3CME O;  1W2B N;  3CCQ L;  1VQN L;  4WJ0 A;  1VQP L;  3OW2 K;  1YIT O;  1VQ8 L;  1KQS N;  1M1K M;  5DS5 A;  3G6E L;  3I55 O;  1KD1 M;  1Q86 M;  1K9M M;  1VQ6 O;  1VQL L;  1KC8 P;  1Q81 M;  2QEX L;  1K73 P;  3OW2 N;  1YHQ O;  1YJW O;  3CD6 O;  2OTL L;  4QDL A;  3CC2 O;  1NJI P;  1S72 L;  1QVF K;  1N8R P;  1VQ4 L;  3CC7 O;  2YZS A;  3CCV O;  3CME L;  3CCL L;  1K8A P;  1Q7Y M;  3G71 O;  1YIJ L;  1VQO L;  1YIT L;  1VQK O;  3CCU O;  3CCS O;  5DS4 A;  1QVG K;  3I55 L;  1QVF N;  2OTJ O;  1YJ9 O;  3NKD A;  5DS6 A;  1YJN O;  1JJ2 K;  1VQ6 L;  3CXC K;  1M90 P;  3CMA O;  1YHQ L;  1VQ7 O;  3CC2 L;  3CC4 L;  1YI2 O;  3CCE O;  3CC7 L;  3G4S O;  1QVG N;  3CCV L;  1Q82 M;  5DQT A;  1VQM O;  4P6I C;  3G71 L;  1JJ2 N;  3CCU L;  3I56 O;  3CXC N;  1M1K P;  1VQ8 O;  2OTJ L;  1YJ9 L;  3CCJ O;  1KD1 P;  1Q86 P;  1K9M P;  1YJN L;  1Q81 P;  4XTK A;  5DLJ A;  3CMA L;  2QA4 O;  1YJW L;  3CCR O;  1YI2 L;  3CD6 L;  5DQZ A;  3G4S L;  1KC8 M;  1VQ5 O;  1K73 M;  1VQM L;  1NJI M;  3I56 L;  1N8R M;  3CCM O;  3CCL O;  4N06 A;  1VQK L;  1YIJ O;  1VQO O;  1VQ9 O;  5FCL A;  3GOD A;  1K8A M;  3CCQ O;  1VQN O;  3CCS L;  1VQP O;  3CCJ L;  3CPW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...