2OTJL

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2otjL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 2otjL01
1VQ4L 2QA4L 1YJWO 1VQML 3CC4L 3G6EO 2OTLO 1Q81M 1K8AP 3OW2K 1YITO 1YI2L 1KD1M 1QVGK 1K73M 3I55L 3CCRL 1VQOL 1VQ4O 2OTJL 2QA4O 1VQMO 3CC4O 1YHQL 1VQ8L 1K9MM 1KD1P 1K73P 1VQ6L 1KQSK 1Q82M 3CPWK 1VQ9L 1YI2O 1YJNL 3I56L 3I55O 3CCRO 1VQOO 1W2BK 3CC2L 1Q82P 3CPWN 3CCVL 2OTJO 1YHQO 1NJIM 1S72L 3CCUL 1VQ6O 1Q81P 1W2BN 3OW2N 1VQ9O 1Q86M 1QVGN 1YJNO 3G4SL 1NJIP 3CCML 3I56O 3G71L 1VQLL 3CC2O 3CMAL 3CCLL 1VQ5L 3CCVO 2QEXL 1VQNL 1VQKL 1K9MP 1S72O 3CCUO 1Q7YM 1M1KM 1KQSN 1K8AM 3CCEL 1VQ8O 3CC7L 1QVFK 3G4SO 3CCMO 3CD6L 3CCSL 3CCJL 1M1KP 3G71O 1VQLO 1JJ2K 3CMAO 3CCLO 1VQ5O 3CMEL 1YJ9L 2QEXO 1VQNO 1N8RM 1KC8M 1VQKO 1QVFN 3CXCK 1M90M 1VQPL 1VQ7L 1YIJL 3CCQL 1JJ2N 3CCEO 1YJWL 1Q86P 3CC7O 1KC8P 1N8RP 3CXCN 3G6EL 1M90P 2OTLL 3CD6O 3CCSO 3CCJO 3CMEO 1YJ9O 1YITL 1VQPO 1VQ7O 1YIJO 1Q7YP 3CCQO
chains in the Genus database with same CATH superfamily
1VQ4L 2QA4L 1YJWO 1VQML 3CC4L 3G6EO 2OTLO 1Q81M 1K8AP 3OW2K 1YITO 1YI2L 1KD1M 3GODA 5DLJA 1QVGK 1K73M 3I55L 3CCRL 1VQOL 1VQ4O 2OTJL 2QA4O 1VQMO 4N06A 3CC4O 1YHQL 1VQ8L 1K9MM 1KD1P 4P6IC 1K73P 1VQ6L 1KQSK 1Q82M 3CPWK 1VQ9L 1YI2O 1YJNL 5DS6A 3I56L 3I55O 3CCRO 4XTKA 1VQOO 1W2BK 3CC2L 1Q82P 5DS4A 3CPWN 3CCVL 2OTJO 1YHQO 1NJIM 1S72L 3CCUL 1VQ6O 1Q81P 1W2BN 3OW2N 1VQ9O 4WJ0A 1Q86M 1QVGN 1YJNO 3G4SL 1NJIP 3CCML 5FCLA 3I56O 3G71L 1VQLL 3CC2O 2YZSA 3CMAL 3CCLL 1VQ5L 3CCVO 2QEXL 1VQNL 1VQKL 1K9MP 1S72O 3CCUO 1Q7YM 1M1KM 1KQSN 1K8AM 3CCEL 1VQ8O 3CC7L 1QVFK 3G4SO 3CCMO 4QDLA 3CD6L 3CCSL 3CCJL 1M1KP 3G71O 1VQLO 1JJ2K 3CMAO 3CCLO 1VQ5O 3CMEL 1YJ9L 2QEXO 1VQNO 1N8RM 1KC8M 1VQKO 1QVFN 4W8KA 3CXCK 1M90M 1VQPL 1VQ7L 1YIJL 3CCQL 1JJ2N 5DQZA 3CCEO 1YJWL 1Q86P 3CC7O 5DS5A 1KC8P 1N8RP 3CXCN 3G6EL 1M90P 2OTLL 3CD6O 3CCSO 3CCJO 3CMEO 1YJ9O 1YITL 3NKDA 1VQPO 1VQ7O 1YIJO 5DQTA 1Q7YP 3CCQO
chains in the Genus database with same CATH topology
1VQ4L 2QA4L 1YJWO 1VQML 3CC4L 3G6EO 2OTLO 1Q81M 1K8AP 3OW2K 1YITO 1YI2L 1KD1M 3GODA 5DLJA 1QVGK 1K73M 3I55L 3CCRL 1VQOL 1VQ4O 2OTJL 2QA4O 1VQMO 4N06A 3CC4O 1YHQL 1VQ8L 1K9MM 1KD1P 4P6IC 1K73P 1VQ6L 1KQSK 1Q82M 3CPWK 1VQ9L 1YI2O 1YJNL 5DS6A 3I56L 3I55O 3CCRO 4XTKA 1VQOO 1W2BK 3CC2L 1Q82P 5DS4A 3CPWN 3CCVL 2OTJO 1YHQO 1NJIM 1S72L 3CCUL 1VQ6O 1Q81P 1W2BN 3OW2N 1VQ9O 4WJ0A 1Q86M 1QVGN 1YJNO 3G4SL 1NJIP 3CCML 5FCLA 3I56O 3G71L 1VQLL 3CC2O 2YZSA 3CMAL 3CCLL 1VQ5L 3CCVO 2QEXL 1VQNL 1VQKL 1K9MP 1S72O 3CCUO 1Q7YM 1M1KM 1KQSN 1K8AM 3CCEL 1VQ8O 3CC7L 1QVFK 3G4SO 3CCMO 4QDLA 3CD6L 3CCSL 3CCJL 1M1KP 3G71O 1VQLO 1JJ2K 3CMAO 3CCLO 1VQ5O 3CMEL 1YJ9L 2QEXO 1VQNO 1N8RM 1KC8M 1VQKO 1QVFN 4W8KA 3CXCK 1M90M 1VQPL 1VQ7L 1YIJL 3CCQL 1JJ2N 5DQZA 3CCEO 1YJWL 1Q86P 3CC7O 5DS5A 1KC8P 1N8RP 3CXCN 3G6EL 1M90P 2OTLL 3CD6O 3CCSO 3CCJO 3CMEO 1YJ9O 1YITL 3NKDA 1VQPO 1VQ7O 1YIJO 5DQTA 1Q7YP 3CCQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 L;  2QA4 L;  1YJW O;  1VQM L;  3CC4 L;  3G6E O;  2OTL O;  1Q81 M;  1K8A P;  3OW2 K;  1YIT O;  1YI2 L;  1KD1 M;  1QVG K;  1K73 M;  3I55 L;  3CCR L;  1VQO L;  1VQ4 O;  2OTJ L;  2QA4 O;  1VQM O;  3CC4 O;  1YHQ L;  1VQ8 L;  1K9M M;  1KD1 P;  1K73 P;  1VQ6 L;  1KQS K;  1Q82 M;  3CPW K;  1VQ9 L;  1YI2 O;  1YJN L;  3I56 L;  3I55 O;  3CCR O;  1VQO O;  1W2B K;  3CC2 L;  1Q82 P;  3CPW N;  3CCV L;  2OTJ O;  1YHQ O;  1NJI M;  1S72 L;  3CCU L;  1VQ6 O;  1Q81 P;  1W2B N;  3OW2 N;  1VQ9 O;  1Q86 M;  1QVG N;  1YJN O;  3G4S L;  1NJI P;  3CCM L;  3I56 O;  3G71 L;  1VQL L;  3CC2 O;  3CMA L;  3CCL L;  1VQ5 L;  3CCV O;  2QEX L;  1VQN L;  1VQK L;  1K9M P;  1S72 O;  3CCU O;  1Q7Y M;  1M1K M;  1KQS N;  1K8A M;  3CCE L;  1VQ8 O;  3CC7 L;  1QVF K;  3G4S O;  3CCM O;  3CD6 L;  3CCS L;  3CCJ L;  1M1K P;  3G71 O;  1VQL O;  1JJ2 K;  3CMA O;  3CCL O;  1VQ5 O;  3CME L;  1YJ9 L;  2QEX O;  1VQN O;  1N8R M;  1KC8 M;  1VQK O;  1QVF N;  3CXC K;  1M90 M;  1VQP L;  1VQ7 L;  1YIJ L;  3CCQ L;  1JJ2 N;  3CCE O;  1YJW L;  1Q86 P;  3CC7 O;  1KC8 P;  1N8R P;  3CXC N;  3G6E L;  1M90 P;  2OTL L;  3CD6 O;  3CCS O;  3CCJ O;  3CME O;  1YJ9 O;  1YIT L;  1VQP O;  1VQ7 O;  1YIJ O;  1Q7Y P;  3CCQ O; 
#chains in the Genus database with same CATH topology
 1VQ4 L;  2QA4 L;  1YJW O;  1VQM L;  3CC4 L;  3G6E O;  2OTL O;  1Q81 M;  1K8A P;  3OW2 K;  1YIT O;  1YI2 L;  1KD1 M;  3GOD A;  5DLJ A;  1QVG K;  1K73 M;  3I55 L;  3CCR L;  1VQO L;  1VQ4 O;  2OTJ L;  2QA4 O;  1VQM O;  4N06 A;  3CC4 O;  1YHQ L;  1VQ8 L;  1K9M M;  1KD1 P;  4P6I C;  1K73 P;  1VQ6 L;  1KQS K;  1Q82 M;  3CPW K;  1VQ9 L;  1YI2 O;  1YJN L;  5DS6 A;  3I56 L;  3I55 O;  3CCR O;  4XTK A;  1VQO O;  1W2B K;  3CC2 L;  1Q82 P;  5DS4 A;  3CPW N;  3CCV L;  2OTJ O;  1YHQ O;  1NJI M;  1S72 L;  3CCU L;  1VQ6 O;  1Q81 P;  1W2B N;  3OW2 N;  1VQ9 O;  4WJ0 A;  1Q86 M;  1QVG N;  1YJN O;  3G4S L;  1NJI P;  3CCM L;  5FCL A;  3I56 O;  3G71 L;  1VQL L;  3CC2 O;  2YZS A;  3CMA L;  3CCL L;  1VQ5 L;  3CCV O;  2QEX L;  1VQN L;  1VQK L;  1K9M P;  1S72 O;  3CCU O;  1Q7Y M;  1M1K M;  1KQS N;  1K8A M;  3CCE L;  1VQ8 O;  3CC7 L;  1QVF K;  3G4S O;  3CCM O;  4QDL A;  3CD6 L;  3CCS L;  3CCJ L;  1M1K P;  3G71 O;  1VQL O;  1JJ2 K;  3CMA O;  3CCL O;  1VQ5 O;  3CME L;  1YJ9 L;  2QEX O;  1VQN O;  1N8R M;  1KC8 M;  1VQK O;  1QVF N;  4W8K A;  3CXC K;  1M90 M;  1VQP L;  1VQ7 L;  1YIJ L;  3CCQ L;  1JJ2 N;  5DQZ A;  3CCE O;  1YJW L;  1Q86 P;  3CC7 O;  5DS5 A;  1KC8 P;  1N8R P;  3CXC N;  3G6E L;  1M90 P;  2OTL L;  3CD6 O;  3CCS O;  3CCJ O;  3CME O;  1YJ9 O;  1YIT L;  3NKD A;  1VQP O;  1VQ7 O;  1YIJ O;  5DQT A;  1Q7Y P;  3CCQ O; 
#chains in the Genus database with same CATH homology
 1VQ4 L;  2QA4 L;  1YJW O;  1VQM L;  3CC4 L;  3G6E O;  2OTL O;  1Q81 M;  1K8A P;  3OW2 K;  1YIT O;  1YI2 L;  1KD1 M;  3GOD A;  5DLJ A;  1QVG K;  1K73 M;  3I55 L;  3CCR L;  1VQO L;  1VQ4 O;  2OTJ L;  2QA4 O;  1VQM O;  4N06 A;  3CC4 O;  1YHQ L;  1VQ8 L;  1K9M M;  1KD1 P;  4P6I C;  1K73 P;  1VQ6 L;  1KQS K;  1Q82 M;  3CPW K;  1VQ9 L;  1YI2 O;  1YJN L;  5DS6 A;  3I56 L;  3I55 O;  3CCR O;  4XTK A;  1VQO O;  1W2B K;  3CC2 L;  1Q82 P;  5DS4 A;  3CPW N;  3CCV L;  2OTJ O;  1YHQ O;  1NJI M;  1S72 L;  3CCU L;  1VQ6 O;  1Q81 P;  1W2B N;  3OW2 N;  1VQ9 O;  4WJ0 A;  1Q86 M;  1QVG N;  1YJN O;  3G4S L;  1NJI P;  3CCM L;  5FCL A;  3I56 O;  3G71 L;  1VQL L;  3CC2 O;  2YZS A;  3CMA L;  3CCL L;  1VQ5 L;  3CCV O;  2QEX L;  1VQN L;  1VQK L;  1K9M P;  1S72 O;  3CCU O;  1Q7Y M;  1M1K M;  1KQS N;  1K8A M;  3CCE L;  1VQ8 O;  3CC7 L;  1QVF K;  3G4S O;  3CCM O;  4QDL A;  3CD6 L;  3CCS L;  3CCJ L;  1M1K P;  3G71 O;  1VQL O;  1JJ2 K;  3CMA O;  3CCL O;  1VQ5 O;  3CME L;  1YJ9 L;  2QEX O;  1VQN O;  1N8R M;  1KC8 M;  1VQK O;  1QVF N;  4W8K A;  3CXC K;  1M90 M;  1VQP L;  1VQ7 L;  1YIJ L;  3CCQ L;  1JJ2 N;  5DQZ A;  3CCE O;  1YJW L;  1Q86 P;  3CC7 O;  5DS5 A;  1KC8 P;  1N8R P;  3CXC N;  3G6E L;  1M90 P;  2OTL L;  3CD6 O;  3CCS O;  3CCJ O;  3CME O;  1YJ9 O;  1YIT L;  3NKD A;  1VQP O;  1VQ7 O;  1YIJ O;  5DQT A;  1Q7Y P;  3CCQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...