2QEXL

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 26
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2qexL02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 2qexL01
3CPWN 3CCSO 1VQLL 1VQNO 1Q82M 3I56O 1W2BK 3CXCK 3CCLL 2QA4L 3CCEL 1VQPO 1K73P 3CD6L 1YI2L 1KD1P 3CC4L 1YJWO 1Q86M 1YIJO 1YHQL 3CMAL 1QVFN 1Q82P 3CMEO 1KD1M 2QEXO 1VQ8O 3CCRL 1YJNL 1VQOO 1VQ9O 3G4SO 1Q7YM 2OTLL 1VQ5O 3CC2O 1K8AM 3OW2K 3CXCN 3I55L 1Q86P 1VQ6O 3CCML 3CCUL 3CCQL 1VQLO 1S72L 1JJ2N 3CCSL 1YITO 1NJIM 1VQNL 3CCVO 1Q7YP 3CCJO 3I56L 1K8AP 1VQ7O 1VQPL 1M1KM 1M90M 3CC7O 3G6EL 3CPWK 1VQKO 1QVGK 1YJWL 1VQ4O 1VQMO 1Q81P 1W2BN 1YIJL 1NJIP 1YJNO 2OTJO 3CMEL 2QEXL 1VQ8L 3G71O 1VQOL 1YJ9O 3G4SL 1VQ9L 1Q81M 1M1KP 1M90P 1KQSK 3CCLO 2QA4O 3CCEO 3CD6O 1YI2O 1KC8M 1VQ6L 3CC4O 1S72O 1QVGN 1YITL 3OW2N 3CMAO 1YHQO 3CCVL 3CCJL 3CCRO 1VQ7L 3G6EO 1K9MP 3CC7L 2OTLO 1KC8P 1N8RP 1JJ2K 1VQKL 1KQSN 1VQ5L 1K73M 3I55O 1VQML 1VQ4L 3CC2L 3CCMO 3CCUO 1QVFK 1K9MM 3CCQO 2OTJL 1N8RM 3G71L 1YJ9L
chains in the Genus database with same CATH superfamily
3CPWN 3CCSO 1VQLL 1VQNO 1Q82M 3I56O 5DQZA 1W2BK 3CXCK 3CCLL 2QA4L 3CCEL 4WJ0A 1VQPO 1K73P 3CD6L 1YI2L 1KD1P 3CC4L 4N06A 1YJWO 1Q86M 1YIJO 1YHQL 3CMAL 1QVFN 1Q82P 3CMEO 1KD1M 2QEXO 5DS6A 1VQ8O 3CCRL 1YJNL 1VQOO 1VQ9O 3G4SO 2YZSA 1Q7YM 2OTLL 1VQ5O 3CC2O 1K8AM 3OW2K 3CXCN 3I55L 1Q86P 1VQ6O 3CCML 3CCUL 3CCQL 1VQLO 5DS5A 1S72L 1JJ2N 3CCSL 1YITO 1NJIM 1VQNL 4W8KA 3CCVO 1Q7YP 3CCJO 3I56L 1K8AP 1VQ7O 1VQPL 1M1KM 1M90M 3CC7O 3G6EL 3CPWK 5DQTA 1VQKO 5DS4A 3NKDA 1QVGK 1YJWL 1VQ4O 1VQMO 1Q81P 1W2BN 1YIJL 1NJIP 1YJNO 2OTJO 3CMEL 2QEXL 4QDLA 1VQ8L 3G71O 1VQOL 1YJ9O 3G4SL 1VQ9L 1Q81M 1M1KP 1M90P 1KQSK 3CCLO 2QA4O 3CCEO 3CD6O 1YI2O 1KC8M 1VQ6L 4XTKA 4P6IC 3CC4O 1S72O 1QVGN 1YITL 3OW2N 3CMAO 1YHQO 3CCVL 3CCJL 3CCRO 1VQ7L 3G6EO 5DLJA 5FCLA 1K9MP 3CC7L 2OTLO 1KC8P 1N8RP 1JJ2K 1VQKL 1KQSN 1VQ5L 1K73M 3GODA 3I55O 1VQML 1VQ4L 3CC2L 3CCMO 3CCUO 1QVFK 1K9MM 3CCQO 2OTJL 1N8RM 3G71L 1YJ9L
chains in the Genus database with same CATH topology
3CPWN 3CCSO 1VQLL 1VQNO 1Q82M 3I56O 5DQZA 1W2BK 3CXCK 3CCLL 2QA4L 3CCEL 4WJ0A 1VQPO 1K73P 3CD6L 1YI2L 1KD1P 3CC4L 4N06A 1YJWO 1Q86M 1YIJO 1YHQL 3CMAL 1QVFN 1Q82P 3CMEO 1KD1M 2QEXO 5DS6A 1VQ8O 3CCRL 1YJNL 1VQOO 1VQ9O 3G4SO 2YZSA 1Q7YM 2OTLL 1VQ5O 3CC2O 1K8AM 3OW2K 3CXCN 3I55L 1Q86P 1VQ6O 3CCML 3CCUL 3CCQL 1VQLO 5DS5A 1S72L 1JJ2N 3CCSL 1YITO 1NJIM 1VQNL 4W8KA 3CCVO 1Q7YP 3CCJO 3I56L 1K8AP 1VQ7O 1VQPL 1M1KM 1M90M 3CC7O 3G6EL 3CPWK 5DQTA 1VQKO 5DS4A 3NKDA 1QVGK 1YJWL 1VQ4O 1VQMO 1Q81P 1W2BN 1YIJL 1NJIP 1YJNO 2OTJO 3CMEL 2QEXL 4QDLA 1VQ8L 3G71O 1VQOL 1YJ9O 3G4SL 1VQ9L 1Q81M 1M1KP 1M90P 1KQSK 3CCLO 2QA4O 3CCEO 3CD6O 1YI2O 1KC8M 1VQ6L 4XTKA 4P6IC 3CC4O 1S72O 1QVGN 1YITL 3OW2N 3CMAO 1YHQO 3CCVL 3CCJL 3CCRO 1VQ7L 3G6EO 5DLJA 5FCLA 1K9MP 3CC7L 2OTLO 1KC8P 1N8RP 1JJ2K 1VQKL 1KQSN 1VQ5L 1K73M 3GODA 3I55O 1VQML 1VQ4L 3CC2L 3CCMO 3CCUO 1QVFK 1K9MM 3CCQO 2OTJL 1N8RM 3G71L 1YJ9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW N;  3CCS O;  1VQL L;  1VQN O;  1Q82 M;  3I56 O;  1W2B K;  3CXC K;  3CCL L;  2QA4 L;  3CCE L;  1VQP O;  1K73 P;  3CD6 L;  1YI2 L;  1KD1 P;  3CC4 L;  1YJW O;  1Q86 M;  1YIJ O;  1YHQ L;  3CMA L;  1QVF N;  1Q82 P;  3CME O;  1KD1 M;  2QEX O;  1VQ8 O;  3CCR L;  1YJN L;  1VQO O;  1VQ9 O;  3G4S O;  1Q7Y M;  2OTL L;  1VQ5 O;  3CC2 O;  1K8A M;  3OW2 K;  3CXC N;  3I55 L;  1Q86 P;  1VQ6 O;  3CCM L;  3CCU L;  3CCQ L;  1VQL O;  1S72 L;  1JJ2 N;  3CCS L;  1YIT O;  1NJI M;  1VQN L;  3CCV O;  1Q7Y P;  3CCJ O;  3I56 L;  1K8A P;  1VQ7 O;  1VQP L;  1M1K M;  1M90 M;  3CC7 O;  3G6E L;  3CPW K;  1VQK O;  1QVG K;  1YJW L;  1VQ4 O;  1VQM O;  1Q81 P;  1W2B N;  1YIJ L;  1NJI P;  1YJN O;  2OTJ O;  3CME L;  2QEX L;  1VQ8 L;  3G71 O;  1VQO L;  1YJ9 O;  3G4S L;  1VQ9 L;  1Q81 M;  1M1K P;  1M90 P;  1KQS K;  3CCL O;  2QA4 O;  3CCE O;  3CD6 O;  1YI2 O;  1KC8 M;  1VQ6 L;  3CC4 O;  1S72 O;  1QVG N;  1YIT L;  3OW2 N;  3CMA O;  1YHQ O;  3CCV L;  3CCJ L;  3CCR O;  1VQ7 L;  3G6E O;  1K9M P;  3CC7 L;  2OTL O;  1KC8 P;  1N8R P;  1JJ2 K;  1VQK L;  1KQS N;  1VQ5 L;  1K73 M;  3I55 O;  1VQM L;  1VQ4 L;  3CC2 L;  3CCM O;  3CCU O;  1QVF K;  1K9M M;  3CCQ O;  2OTJ L;  1N8R M;  3G71 L;  1YJ9 L; 
#chains in the Genus database with same CATH topology
 3CPW N;  3CCS O;  1VQL L;  1VQN O;  1Q82 M;  3I56 O;  5DQZ A;  1W2B K;  3CXC K;  3CCL L;  2QA4 L;  3CCE L;  4WJ0 A;  1VQP O;  1K73 P;  3CD6 L;  1YI2 L;  1KD1 P;  3CC4 L;  4N06 A;  1YJW O;  1Q86 M;  1YIJ O;  1YHQ L;  3CMA L;  1QVF N;  1Q82 P;  3CME O;  1KD1 M;  2QEX O;  5DS6 A;  1VQ8 O;  3CCR L;  1YJN L;  1VQO O;  1VQ9 O;  3G4S O;  2YZS A;  1Q7Y M;  2OTL L;  1VQ5 O;  3CC2 O;  1K8A M;  3OW2 K;  3CXC N;  3I55 L;  1Q86 P;  1VQ6 O;  3CCM L;  3CCU L;  3CCQ L;  1VQL O;  5DS5 A;  1S72 L;  1JJ2 N;  3CCS L;  1YIT O;  1NJI M;  1VQN L;  4W8K A;  3CCV O;  1Q7Y P;  3CCJ O;  3I56 L;  1K8A P;  1VQ7 O;  1VQP L;  1M1K M;  1M90 M;  3CC7 O;  3G6E L;  3CPW K;  5DQT A;  1VQK O;  5DS4 A;  3NKD A;  1QVG K;  1YJW L;  1VQ4 O;  1VQM O;  1Q81 P;  1W2B N;  1YIJ L;  1NJI P;  1YJN O;  2OTJ O;  3CME L;  2QEX L;  4QDL A;  1VQ8 L;  3G71 O;  1VQO L;  1YJ9 O;  3G4S L;  1VQ9 L;  1Q81 M;  1M1K P;  1M90 P;  1KQS K;  3CCL O;  2QA4 O;  3CCE O;  3CD6 O;  1YI2 O;  1KC8 M;  1VQ6 L;  4XTK A;  4P6I C;  3CC4 O;  1S72 O;  1QVG N;  1YIT L;  3OW2 N;  3CMA O;  1YHQ O;  3CCV L;  3CCJ L;  3CCR O;  1VQ7 L;  3G6E O;  5DLJ A;  5FCL A;  1K9M P;  3CC7 L;  2OTL O;  1KC8 P;  1N8R P;  1JJ2 K;  1VQK L;  1KQS N;  1VQ5 L;  1K73 M;  3GOD A;  3I55 O;  1VQM L;  1VQ4 L;  3CC2 L;  3CCM O;  3CCU O;  1QVF K;  1K9M M;  3CCQ O;  2OTJ L;  1N8R M;  3G71 L;  1YJ9 L; 
#chains in the Genus database with same CATH homology
 3CPW N;  3CCS O;  1VQL L;  1VQN O;  1Q82 M;  3I56 O;  5DQZ A;  1W2B K;  3CXC K;  3CCL L;  2QA4 L;  3CCE L;  4WJ0 A;  1VQP O;  1K73 P;  3CD6 L;  1YI2 L;  1KD1 P;  3CC4 L;  4N06 A;  1YJW O;  1Q86 M;  1YIJ O;  1YHQ L;  3CMA L;  1QVF N;  1Q82 P;  3CME O;  1KD1 M;  2QEX O;  5DS6 A;  1VQ8 O;  3CCR L;  1YJN L;  1VQO O;  1VQ9 O;  3G4S O;  2YZS A;  1Q7Y M;  2OTL L;  1VQ5 O;  3CC2 O;  1K8A M;  3OW2 K;  3CXC N;  3I55 L;  1Q86 P;  1VQ6 O;  3CCM L;  3CCU L;  3CCQ L;  1VQL O;  5DS5 A;  1S72 L;  1JJ2 N;  3CCS L;  1YIT O;  1NJI M;  1VQN L;  4W8K A;  3CCV O;  1Q7Y P;  3CCJ O;  3I56 L;  1K8A P;  1VQ7 O;  1VQP L;  1M1K M;  1M90 M;  3CC7 O;  3G6E L;  3CPW K;  5DQT A;  1VQK O;  5DS4 A;  3NKD A;  1QVG K;  1YJW L;  1VQ4 O;  1VQM O;  1Q81 P;  1W2B N;  1YIJ L;  1NJI P;  1YJN O;  2OTJ O;  3CME L;  2QEX L;  4QDL A;  1VQ8 L;  3G71 O;  1VQO L;  1YJ9 O;  3G4S L;  1VQ9 L;  1Q81 M;  1M1K P;  1M90 P;  1KQS K;  3CCL O;  2QA4 O;  3CCE O;  3CD6 O;  1YI2 O;  1KC8 M;  1VQ6 L;  4XTK A;  4P6I C;  3CC4 O;  1S72 O;  1QVG N;  1YIT L;  3OW2 N;  3CMA O;  1YHQ O;  3CCV L;  3CCJ L;  3CCR O;  1VQ7 L;  3G6E O;  5DLJ A;  5FCL A;  1K9M P;  3CC7 L;  2OTL O;  1KC8 P;  1N8R P;  1JJ2 K;  1VQK L;  1KQS N;  1VQ5 L;  1K73 M;  3GOD A;  3I55 O;  1VQM L;  1VQ4 L;  3CC2 L;  3CCM O;  3CCU O;  1QVF K;  1K9M M;  3CCQ O;  2OTJ L;  1N8R M;  3G71 L;  1YJ9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...