3CCLO

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 31
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cclO00
3G4SO 1Q86P 1VQ6O 3CCSO 1YJWL 1VQ4O 1Q86M 3CD6L 3CCLL 3OW2N 3I55L 1VQ5L 1YJ9O 2OTLO 1KQSK 1YITL 3CCJO 1M1KM 1NJIM 1YIJO 3CXCK 3OW2K 1YHQO 1VQ9L 3CCEL 3CCRO 1VQ8O 3CC7O 1VQKO 1KC8P 3CCUL 1KC8M 1QVGK 1YJNL 1VQ7O 1Q81P 3CD6O 1M90P 1K8AM 3CCLO 1VQ5O 1M90M 1KQSN 3CCQL 3CXCN 1N8RP 3G6EL 1VQPL 1VQOL 3CC4L 3CPWN 1N8RM 2QEXO 2OTJL 1QVGN 3CCUO 1K73P 1S72O 3CPWK 1VQLL 3CMAL 1VQNL 1K73M 3CCVL 2QA4L 3CCQO 1YI2L 1YJWO 1Q82P 3I56L 3I55O 3G4SL 1Q81M 1VQ6L 3CMEL 3CC2L 1VQ4L 3CCML 1YITO 1KD1P 3CCEO 1VQ9O 2OTLL 3G71L 1VQML 3CCJL 3CCVO 1YIJL 1YHQL 1Q7YP 1YJNO 1VQ8L 3CC7L 1VQKL 1W2BN 3CMEO 3CC2O 1VQ7L 3CCMO 3G6EO 1VQPO 1VQOO 1Q82M 3CC4O 3CCSL 1W2BK 1QVFN 1M1KP 3G71O 1NJIP 1VQMO 1JJ2N 2OTJO 1YJ9L 1KD1M 2QEXL 1VQLO 3CMAO 1QVFK 1VQNO 2QA4O 1K8AP 1YI2O 1JJ2K 1K9MP 3I56O 1S72L 3CCRL 1Q7YM 1K9MM
chains in the Genus database with same CATH superfamily
3G4SO 1Q86P 1VQ6O 3CCSO 1YJWL 1VQ4O 1Q86M 3CD6L 3CCLL 3OW2N 3I55L 1VQ5L 1YJ9O 2OTLO 5DLJA 1KQSK 1YITL 3CCJO 1M1KM 1NJIM 1YIJO 3CXCK 3OW2K 1YHQO 1VQ9L 3CCEL 3CCRO 1VQ8O 3CC7O 1VQKO 1KC8P 3CCUL 1KC8M 1YJNL 1VQ7O 1Q81P 5DS4A 1QVGK 1M90P 3CD6O 1K8AM 3CCLO 4N06A 1VQ5O 1M90M 1KQSN 3CCQL 4W8KA 3CXCN 2YZSA 1N8RP 3G6EL 1VQPL 1VQOL 3CC4L 3CPWN 1N8RM 2QEXO 3NKDA 3GODA 2OTJL 1QVGN 3CCUO 1K73P 1S72O 5DS6A 3CPWK 1VQLL 3CMAL 1VQNL 1K73M 3CCVL 5FCLA 2QA4L 3CCQO 1YI2L 1YJWO 1Q82P 4QDLA 3I56L 3I55O 4XTKA 3G4SL 5DQTA 1Q81M 1VQ6L 3CMEL 3CC2L 1VQ4L 3CCML 1YITO 1KD1P 3CCEO 1VQ9O 2OTLL 3G71L 1VQML 5DS5A 3CCJL 3CCVO 1YIJL 1YHQL 1Q7YP 1YJNO 4WJ0A 1VQ8L 3CC7L 1VQKL 1W2BN 3CMEO 3CC2O 1VQ7L 3CCMO 3G6EO 1VQPO 1VQOO 5DQZA 4P6IC 1Q82M 3CC4O 3CCSL 1W2BK 1QVFN 1M1KP 3G71O 1NJIP 1VQMO 1JJ2N 2OTJO 1YJ9L 1KD1M 2QEXL 1VQLO 3CMAO 1QVFK 1VQNO 2QA4O 1K8AP 1YI2O 1JJ2K 1K9MP 3I56O 1S72L 3CCRL 1Q7YM 1K9MM
chains in the Genus database with same CATH topology
3G4SO 1Q86P 1VQ6O 3CCSO 1YJWL 1VQ4O 1Q86M 3CD6L 3CCLL 3OW2N 3I55L 1VQ5L 1YJ9O 2OTLO 5DLJA 1KQSK 1YITL 3CCJO 1M1KM 1NJIM 1YIJO 3CXCK 3OW2K 1YHQO 1VQ9L 3CCEL 3CCRO 1VQ8O 3CC7O 1VQKO 1KC8P 3CCUL 1KC8M 1YJNL 1VQ7O 1Q81P 5DS4A 1QVGK 1M90P 3CD6O 1K8AM 3CCLO 4N06A 1VQ5O 1M90M 1KQSN 3CCQL 4W8KA 3CXCN 2YZSA 1N8RP 3G6EL 1VQPL 1VQOL 3CC4L 3CPWN 1N8RM 2QEXO 3NKDA 3GODA 2OTJL 1QVGN 3CCUO 1K73P 1S72O 5DS6A 3CPWK 1VQLL 3CMAL 1VQNL 1K73M 3CCVL 5FCLA 2QA4L 3CCQO 1YI2L 1YJWO 1Q82P 4QDLA 3I56L 3I55O 4XTKA 3G4SL 5DQTA 1Q81M 1VQ6L 3CMEL 3CC2L 1VQ4L 3CCML 1YITO 1KD1P 3CCEO 1VQ9O 2OTLL 3G71L 1VQML 5DS5A 3CCJL 3CCVO 1YIJL 1YHQL 1Q7YP 1YJNO 4WJ0A 1VQ8L 3CC7L 1VQKL 1W2BN 3CMEO 3CC2O 1VQ7L 3CCMO 3G6EO 1VQPO 1VQOO 5DQZA 4P6IC 1Q82M 3CC4O 3CCSL 1W2BK 1QVFN 1M1KP 3G71O 1NJIP 1VQMO 1JJ2N 2OTJO 1YJ9L 1KD1M 2QEXL 1VQLO 3CMAO 1QVFK 1VQNO 2QA4O 1K8AP 1YI2O 1JJ2K 1K9MP 3I56O 1S72L 3CCRL 1Q7YM 1K9MM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S O;  1Q86 P;  1VQ6 O;  3CCS O;  1YJW L;  1VQ4 O;  1Q86 M;  3CD6 L;  3CCL L;  3OW2 N;  3I55 L;  1VQ5 L;  1YJ9 O;  2OTL O;  1KQS K;  1YIT L;  3CCJ O;  1M1K M;  1NJI M;  1YIJ O;  3CXC K;  3OW2 K;  1YHQ O;  1VQ9 L;  3CCE L;  3CCR O;  1VQ8 O;  3CC7 O;  1VQK O;  1KC8 P;  3CCU L;  1KC8 M;  1QVG K;  1YJN L;  1VQ7 O;  1Q81 P;  3CD6 O;  1M90 P;  1K8A M;  3CCL O;  1VQ5 O;  1M90 M;  1KQS N;  3CCQ L;  3CXC N;  1N8R P;  3G6E L;  1VQP L;  1VQO L;  3CC4 L;  3CPW N;  1N8R M;  2QEX O;  2OTJ L;  1QVG N;  3CCU O;  1K73 P;  1S72 O;  3CPW K;  1VQL L;  3CMA L;  1VQN L;  1K73 M;  3CCV L;  2QA4 L;  3CCQ O;  1YI2 L;  1YJW O;  1Q82 P;  3I56 L;  3I55 O;  3G4S L;  1Q81 M;  1VQ6 L;  3CME L;  3CC2 L;  1VQ4 L;  3CCM L;  1YIT O;  1KD1 P;  3CCE O;  1VQ9 O;  2OTL L;  3G71 L;  1VQM L;  3CCJ L;  3CCV O;  1YIJ L;  1YHQ L;  1Q7Y P;  1YJN O;  1VQ8 L;  3CC7 L;  1VQK L;  1W2B N;  3CME O;  3CC2 O;  1VQ7 L;  3CCM O;  3G6E O;  1VQP O;  1VQO O;  1Q82 M;  3CC4 O;  3CCS L;  1W2B K;  1QVF N;  1M1K P;  3G71 O;  1NJI P;  1VQM O;  1JJ2 N;  2OTJ O;  1YJ9 L;  1KD1 M;  2QEX L;  1VQL O;  3CMA O;  1QVF K;  1VQN O;  2QA4 O;  1K8A P;  1YI2 O;  1JJ2 K;  1K9M P;  3I56 O;  1S72 L;  3CCR L;  1Q7Y M;  1K9M M; 
#chains in the Genus database with same CATH topology
 3G4S O;  1Q86 P;  1VQ6 O;  3CCS O;  1YJW L;  1VQ4 O;  1Q86 M;  3CD6 L;  3CCL L;  3OW2 N;  3I55 L;  1VQ5 L;  1YJ9 O;  2OTL O;  5DLJ A;  1KQS K;  1YIT L;  3CCJ O;  1M1K M;  1NJI M;  1YIJ O;  3CXC K;  3OW2 K;  1YHQ O;  1VQ9 L;  3CCE L;  3CCR O;  1VQ8 O;  3CC7 O;  1VQK O;  1KC8 P;  3CCU L;  1KC8 M;  1YJN L;  1VQ7 O;  1Q81 P;  5DS4 A;  1QVG K;  1M90 P;  3CD6 O;  1K8A M;  3CCL O;  4N06 A;  1VQ5 O;  1M90 M;  1KQS N;  3CCQ L;  4W8K A;  3CXC N;  2YZS A;  1N8R P;  3G6E L;  1VQP L;  1VQO L;  3CC4 L;  3CPW N;  1N8R M;  2QEX O;  3NKD A;  3GOD A;  2OTJ L;  1QVG N;  3CCU O;  1K73 P;  1S72 O;  5DS6 A;  3CPW K;  1VQL L;  3CMA L;  1VQN L;  1K73 M;  3CCV L;  5FCL A;  2QA4 L;  3CCQ O;  1YI2 L;  1YJW O;  1Q82 P;  4QDL A;  3I56 L;  3I55 O;  4XTK A;  3G4S L;  5DQT A;  1Q81 M;  1VQ6 L;  3CME L;  3CC2 L;  1VQ4 L;  3CCM L;  1YIT O;  1KD1 P;  3CCE O;  1VQ9 O;  2OTL L;  3G71 L;  1VQM L;  5DS5 A;  3CCJ L;  3CCV O;  1YIJ L;  1YHQ L;  1Q7Y P;  1YJN O;  4WJ0 A;  1VQ8 L;  3CC7 L;  1VQK L;  1W2B N;  3CME O;  3CC2 O;  1VQ7 L;  3CCM O;  3G6E O;  1VQP O;  1VQO O;  5DQZ A;  4P6I C;  1Q82 M;  3CC4 O;  3CCS L;  1W2B K;  1QVF N;  1M1K P;  3G71 O;  1NJI P;  1VQM O;  1JJ2 N;  2OTJ O;  1YJ9 L;  1KD1 M;  2QEX L;  1VQL O;  3CMA O;  1QVF K;  1VQN O;  2QA4 O;  1K8A P;  1YI2 O;  1JJ2 K;  1K9M P;  3I56 O;  1S72 L;  3CCR L;  1Q7Y M;  1K9M M; 
#chains in the Genus database with same CATH homology
 3G4S O;  1Q86 P;  1VQ6 O;  3CCS O;  1YJW L;  1VQ4 O;  1Q86 M;  3CD6 L;  3CCL L;  3OW2 N;  3I55 L;  1VQ5 L;  1YJ9 O;  2OTL O;  5DLJ A;  1KQS K;  1YIT L;  3CCJ O;  1M1K M;  1NJI M;  1YIJ O;  3CXC K;  3OW2 K;  1YHQ O;  1VQ9 L;  3CCE L;  3CCR O;  1VQ8 O;  3CC7 O;  1VQK O;  1KC8 P;  3CCU L;  1KC8 M;  1YJN L;  1VQ7 O;  1Q81 P;  5DS4 A;  1QVG K;  1M90 P;  3CD6 O;  1K8A M;  3CCL O;  4N06 A;  1VQ5 O;  1M90 M;  1KQS N;  3CCQ L;  4W8K A;  3CXC N;  2YZS A;  1N8R P;  3G6E L;  1VQP L;  1VQO L;  3CC4 L;  3CPW N;  1N8R M;  2QEX O;  3NKD A;  3GOD A;  2OTJ L;  1QVG N;  3CCU O;  1K73 P;  1S72 O;  5DS6 A;  3CPW K;  1VQL L;  3CMA L;  1VQN L;  1K73 M;  3CCV L;  5FCL A;  2QA4 L;  3CCQ O;  1YI2 L;  1YJW O;  1Q82 P;  4QDL A;  3I56 L;  3I55 O;  4XTK A;  3G4S L;  5DQT A;  1Q81 M;  1VQ6 L;  3CME L;  3CC2 L;  1VQ4 L;  3CCM L;  1YIT O;  1KD1 P;  3CCE O;  1VQ9 O;  2OTL L;  3G71 L;  1VQM L;  5DS5 A;  3CCJ L;  3CCV O;  1YIJ L;  1YHQ L;  1Q7Y P;  1YJN O;  4WJ0 A;  1VQ8 L;  3CC7 L;  1VQK L;  1W2B N;  3CME O;  3CC2 O;  1VQ7 L;  3CCM O;  3G6E O;  1VQP O;  1VQO O;  5DQZ A;  4P6I C;  1Q82 M;  3CC4 O;  3CCS L;  1W2B K;  1QVF N;  1M1K P;  3G71 O;  1NJI P;  1VQM O;  1JJ2 N;  2OTJ O;  1YJ9 L;  1KD1 M;  2QEX L;  1VQL O;  3CMA O;  1QVF K;  1VQN O;  2QA4 O;  1K8A P;  1YI2 O;  1JJ2 K;  1K9M P;  3I56 O;  1S72 L;  3CCR L;  1Q7Y M;  1K9M M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...