3UM5A

Double mutant (a16v+s108t) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts-t9/94) complexed with pyrimethamine, nadph, and dump
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
608
structure length
546
Chain Sequence
MMEQVCDVFDIYAICVCCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKEKKLQNVVVMGRTTWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase, transferase/inhibitor
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title Combined Spatial Limitation around Residues 16 and 108 of Plasmodium falciparum Dihydrofolate Reductase Explains Resistance to Cycloguanil.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 177
structure length 546
sequence length 608
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3um5A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3um5A01
1AI9A 4Q6AA 4G6WX 5J7WA 1RB3A 2W9GA 3QL0A 4Q67A 3QJ7A 2W9TA 4XT5A 1RX5A 3QL3A 1J3IA 1RA3A 2FZIA 2LF1A 3TQ9A 1NJAA 4ELHA 2C2SA 2CIGA 1KLKA 4IQQA 1DISA 1JOLA 3JW5A 4QJZD 1IA1A 4ISKA 3JWCA 1ZDRA 4QJCA 3IA5A 3QLWA 1J3KC 1NJBA 4FGGA 3DG8C 2W3MA 1RA1A 1AO8A 5JG0X 1DR5A 4DQ1A 1PD8A 4IXED 2FZJA 1DG5A 3JWKA 1S3WA 4DPHA 4GEVA 1CI7A 3B5BA 4PSGA 2W3WA 3N5EB 1NJEA 3IX6A 4H0UA 5HSRA 3SQYX 3INVA 3M09A 3EF9A 5WRNA 1LCBA 4KY4A 2G86A 1DDSA 3FREX 4I13A 5HF0X 4DPDA 1BO7A 1TISA 1I00A 5H38A 1TLCA 1TSNA 1DYRA 4ISWA 3NZ6X 3K2HA 1DLRA 1VZAA 3HBBA 1JUTA 3JTWA 1E26A 1BIDA 2CD2A 4QLGA 5ECCA 1DHFA 4FHBA 1B5DA 5HPBA 3BGXA 3IK1A 3K74A 1AJMA 4PTJA 3SAIA 3SGYA 1DG8A 2TDMA 1HW4A 1DR3A 3JWMA 1DHIA 3VCOA 5HVEA 4E5OA 3RG9A 3SA2A 2ZZAA 3ZPCA 4E28A 1IA3A 4PDJA 1BDUA 4G3MA 4FOAA 3QLYA 3GHVA 3UM5A 4I1NA 3TQBA 1TSVA 4HOFA 1JMHA 4KAKA 1LY4A 3JSUA 1J3KA 4KM2A 1U70A 1RX9A 3DG8A 3UWLA 4LEKX 4TMSA 1RB2A 3DAUA 1MVTA 3E0BA 3LG4A 3TMSA 4OR7A 4LAHX 4LRRA 4XT8A 3F0QX 1TLSA 3EX8A 3FQ0A 1TSZA 3EEKA 1RX6A 4XRBA 4XSDA 1BSFA 1F4CA 1RD7A 3N5GA 1BQ2A 1HW3A 1SYNA 3NXRA 4GH8A 1F4GA 2C2TA 3FYVX 1RX1A 1DDUA 4M2XA 5HF2X 1KCEA 1CZ3A 4EIZA 2KCEA 2ANOA 3IROA 4KNZA 3NTZA 1BP0A 1BOZA 4UP1A 1AXWA 2W3BA 1VZCA 2JYBA 4QLFA 3HB8A 2BLAA 3QLXA 1B5EA 3CD2A 4X5GA 3ROAA 4KD7A 1LCAA 4XT7A 1TDAA 4P68A 3BFIA 3BHRA 1JOMA 3GHCA 3Q1HA 4LAGX 1RX4A 5HT5A 5H39A 2RD8A 4KBNA 5ECXA 1RC4A 3F0BX 1OHJA 4P66A 3F0XX 3F0UX 1THYA 4LAEX 3OAFA 2BL9A 4PSTA 4X5FA 3CLBA 4PSSA 2HM9A 2RDAA 1RG7A 3FL9A 3N0HA 3NU0A 4HOEA 4FGTA 5HI6A 1HFPA 1RX3A 3BZ0A 2BLCA 1JTQA 3FYWX 2DRCA 3EEJA 4EJ1A 4G95A 1F4EA 1DDRA 1DIUA 4XSCA 4QI9A 3QYLA 3QLZA 1AIQA 2INQA 1HVYA 4ELBA 2ANQA 1S3UA 1NCEA 4KYAA 3EIGA 3GHWA 5HT4A 2TDDA 4KL9A 4RGCA 3DATA 4H97A 1RA9A 3HJ3A 5HQYA 3D84X 1IA4A 3JW3A 1TDUA 1M79A 4ECKA 1RH3A 1TSMA 3GG5A 3IRNA 3EELA 3C06A 2ITHA 2G89A 5HUIA 1DRHA 4FOGA 1DF7A 3N5EA 1EV5A 1S3VA 3FY9X 3OCHA 3IK0A 3FQCA 3KFYA 1HZWA 1CD2A 4KLXA 3FRFX 1VZEA 3KGYA 4DP3A 1MVSA 5U27A 3C0AA 1DRFA 3EHIX 4EB4A 1D1GA 1BPJA 4F2VA 1AOBA 4H98A 4PSYA 3SRWX 1DRAA 2KGKA 2W3AA 1BJGA 4H1IA 4FGHA 1DHJA 3EBUA 4KJJA 1LUDA 1BKOA 4Q0EA 1DR6A 4DDRA 2ONBA 4OSGA 2FTOX 4M6JA 3S9UA 1DYJA 1B49A 1YPVA 3BYXA 3QLSA 4PTHA 3IHIA 1DNAA 4DFRA 1DLSA 4NX6A 2HQPA 3L3RA 3FL8A 4GYHA 4M7UA 1M78A 4O1XD 5JA3A 1PD9A 4EIGA 5BY6A 3KJSA 1TSWA 3NZAX 4H0RA 3IX9A 3SRSX 1S3YA 3GYFA 4P3RA 3NZCX 1JUVA 3FQZA 3NXYA 3TQ8A 4IQBA 5E8QA 1TVUA 1TJSA 3FRBX 4HOGA 1KZJA 1OHKA 4Q0DA 5DXVA 3EGYX 2W9HA 2QK8A 4KNEA 1VZDA 1KMVA 4HA7A 4EINA 1DYIA 1NJDA 4QHVA 1JG0A 1LCEA 4QLEA 1JU6A 3QGTA 2HXVA 2D0KA 5U26A 3V8HA 1AOEA 1TDCA 2L28A 3UM6A 3DFRA 5DFRA 3SR5X 1DAJA 3IA4A 1TVWA 2FTQA 3DGAC 1TVVA 3ED7A 3NXOA 5CCCA 4EZ8A 4X5HA 4H95A 1JMFA 3NXXA 3FY8X 2VETA 3S3VA 4IXGX 2W9SA 3K45A 3UM8A 5HVBA 3NXTA 4KM0A 1U72A 4X5IA 2BBQA 2W3VA 5HS3A 2XW7A 3QYOA 2O7PA 3NXVA 2G8AA 1JMGA 1JTUA 1DR1A 1BKPA 3OB7A 4IXFX 3SH2A 1KZIA 4XE6X 1QQQA 3EJLA 1J3JC 1TSDA 3FQFA 3FQVA 3EDWX 1JMIA 3F8YA 3EEMA 5EAJA 1BP6A 4XECX 1YHOA 1JUJA 3CSEA 1DYHA 1TSXA 4XSEA 1AN5A 2VF0A 1RF7A 3ZPGA 1TSLA 5HQZA 3GH2X 3B9HA 4NX7A 4XT6A 2GD9A 4KJLA 3RO9A 1F28A 5H3AA 5FDAA 3F0SX 4G2OX 1KMSA 3NZBX 2DHFA 1F4BA 1RA8A 2OIPA 1VJ3A 4FOXA 3QFXA 4M6KA 5HSUA 4G8ZX 1TDRA 3TD8A 2H2QA 3F0VX 1SEJA 4H96A 1F4FA 1DG7A 1LY3A 1NJCA 1RX7A 2D5NA 3D80A 3DGAA 1BZFA 3GI2A 3KY8A 1FWMA 3UWLB 3BHLA 2AZNA 3QG2A 4O1XA 3FS6A 3I8AX 4ELEA 3I3RA 3FRDX 1B02A 3DRCA 1HFRA 4KJKA 1BQ1A 1HFQA 3M08A 2OBCA 1TRGA 3JWFA 3IRMA 2A9WA 1VZBA 1FFLA 3TQAA 1J3IC 3GH0A 3DL6A 1QZFA 2BLBA 2G6VA 4JEFA 4ELGA 4O1UA 1DRBA 3F91A 1J3JA 4M7VA 6DFRA 8DFRA 5FCTA 3NRRA 4ELFA 1IA2A 2FZHA 1RE7A 1TSYA 3FRAX 3DL5A 1EVGA 2P4GA 4X5JA 3NZ9X 3K47A 1U71A 5CC9A 7DFRA 1DR7A 3SRRX 1ZPRA 3H9KA 4GD7A 1RA2A 2B3ZA 1RX2A 4KPWA 1DR4A 4O7UA 1TYSA 3SRQX 3S7AA 4P3QA 2FTNA 1F4DA 4CD2A 3F8ZA 1TDBA 3IJZA 1DREA 3KJRA 3R33A 1VDRA 3KGBA 3SA1A 1RTSA 1DR2A 3FQOA 3QLRA 2G8DA 1BO8A 4HA9A 4XT4A 3CL9A 3BNZA 4KFJA 3EAWX 1EV8A 2G8XA 2RD8B 3JVXA 4M6LA 1EVFA 3NZDA 4KY8A 1BSPA 4FQSA 4EILA 2AAZA 1RX8A 3SRUX 4TU5X 2TSRA 1PDBA 1M7AA 4KEBA 2TSCA 4IRRA
chains in the Genus database with same CATH superfamily
1AI9A 4Q6AA 4G6WX 5J7WA 1RB3A 2W9GA 3QL0A 4Q67A 3QJ7A 2W9TA 4XT5A 1RX5A 3QL3A 1J3IA 1RA3A 2FZIA 2LF1A 3TQ9A 1NJAA 4ELHA 2C2SA 2CIGA 1KLKA 4IQQA 1DISA 1JOLA 3JW5A 4QJZD 1IA1A 4ISKA 3JWCA 1ZDRA 4QJCA 3IA5A 3QLWA 1J3KC 1NJBA 4FGGA 3DG8C 2W3MA 1RA1A 1AO8A 5JG0X 1DR5A 4DQ1A 1PD8A 4IXED 2FZJA 1DG5A 3JWKA 1S3WA 4DPHA 4GEVA 1CI7A 3B5BA 4PSGA 2W3WA 3N5EB 1NJEA 3IX6A 4H0UA 5HSRA 3SQYX 3INVA 3M09A 3EF9A 5WRNA 1LCBA 4KY4A 2G86A 1DDSA 3FREX 4I13A 5HF0X 4DPDA 1BO7A 1TISA 1I00A 5H38A 1TLCA 1TSNA 1DYRA 4ISWA 3NZ6X 3K2HA 1DLRA 1VZAA 3HBBA 1JUTA 3JTWA 1E26A 1BIDA 2CD2A 4QLGA 5ECCA 1DHFA 4FHBA 1B5DA 5HPBA 3BGXA 3IK1A 3K74A 1AJMA 4PTJA 3SAIA 3SGYA 1DG8A 2TDMA 1HW4A 1DR3A 3JWMA 1DHIA 3VCOA 5HVEA 4E5OA 3RG9A 3SA2A 2ZZAA 3ZPCA 4E28A 1IA3A 4PDJA 1BDUA 4G3MA 4FOAA 3QLYA 3GHVA 3UM5A 4I1NA 3TQBA 1TSVA 4HOFA 1JMHA 4KAKA 1LY4A 3JSUA 1J3KA 4KM2A 1U70A 1RX9A 3DG8A 3UWLA 4LEKX 4TMSA 1RB2A 3DAUA 1MVTA 3E0BA 3LG4A 3TMSA 4OR7A 4LAHX 4LRRA 4XT8A 3F0QX 1TLSA 3EX8A 3FQ0A 1TSZA 3EEKA 1RX6A 4XRBA 4XSDA 1BSFA 1F4CA 1RD7A 3N5GA 1BQ2A 1HW3A 1SYNA 3NXRA 4GH8A 1F4GA 2C2TA 3FYVX 1RX1A 1DDUA 4M2XA 5HF2X 1KCEA 1CZ3A 4EIZA 2KCEA 2ANOA 3IROA 4KNZA 3NTZA 1BP0A 1BOZA 4UP1A 1AXWA 2W3BA 1VZCA 2JYBA 4QLFA 3HB8A 2BLAA 3QLXA 1B5EA 3CD2A 4X5GA 3ROAA 4KD7A 1LCAA 4XT7A 1TDAA 4P68A 3BFIA 3BHRA 1JOMA 3GHCA 3Q1HA 4LAGX 1RX4A 5HT5A 5H39A 2RD8A 4KBNA 5ECXA 1RC4A 3F0BX 1OHJA 4P66A 3F0XX 3F0UX 1THYA 4LAEX 3OAFA 2BL9A 4PSTA 4X5FA 3CLBA 4PSSA 2HM9A 2RDAA 1RG7A 3FL9A 3N0HA 3NU0A 4HOEA 4FGTA 5HI6A 1HFPA 1RX3A 3BZ0A 2BLCA 1JTQA 3FYWX 2DRCA 3EEJA 4EJ1A 4G95A 1F4EA 1DDRA 1DIUA 4XSCA 4QI9A 3QYLA 3QLZA 1AIQA 2INQA 1HVYA 4ELBA 2ANQA 1S3UA 1NCEA 4KYAA 3EIGA 3GHWA 5HT4A 2TDDA 4KL9A 4RGCA 3DATA 4H97A 1RA9A 3HJ3A 5HQYA 3D84X 1IA4A 3JW3A 1TDUA 1M79A 4ECKA 1RH3A 1TSMA 3GG5A 3IRNA 3EELA 3C06A 2ITHA 2G89A 5HUIA 1DRHA 4FOGA 1DF7A 3N5EA 1EV5A 1S3VA 3FY9X 3OCHA 3IK0A 3FQCA 3KFYA 1HZWA 1CD2A 4KLXA 3FRFX 1VZEA 3KGYA 4DP3A 1MVSA 5U27A 3C0AA 1DRFA 3EHIX 4EB4A 1D1GA 1BPJA 4F2VA 1AOBA 4H98A 4PSYA 3SRWX 1DRAA 2KGKA 2W3AA 1BJGA 4H1IA 4FGHA 1DHJA 3EBUA 4KJJA 1LUDA 1BKOA 4Q0EA 1DR6A 4DDRA 2ONBA 4OSGA 2FTOX 4M6JA 3S9UA 1DYJA 1B49A 1YPVA 3BYXA 3QLSA 4PTHA 3IHIA 1DNAA 4DFRA 1DLSA 4NX6A 2HQPA 3L3RA 3FL8A 4GYHA 4M7UA 1M78A 4O1XD 5JA3A 1PD9A 4EIGA 5BY6A 3KJSA 1TSWA 3NZAX 4H0RA 3IX9A 3SRSX 1S3YA 3GYFA 4P3RA 3NZCX 1JUVA 3FQZA 3NXYA 3TQ8A 4IQBA 5E8QA 1TVUA 1TJSA 3FRBX 4HOGA 1KZJA 1OHKA 4Q0DA 5DXVA 3EGYX 2W9HA 2QK8A 4KNEA 1VZDA 1KMVA 4HA7A 4EINA 1DYIA 1NJDA 4QHVA 1JG0A 1LCEA 4QLEA 1JU6A 3QGTA 2HXVA 2D0KA 5U26A 3V8HA 1AOEA 1TDCA 2L28A 3UM6A 3DFRA 5DFRA 3SR5X 1DAJA 3IA4A 1TVWA 2FTQA 3DGAC 1TVVA 3ED7A 3NXOA 5CCCA 4EZ8A 4X5HA 4H95A 1JMFA 3NXXA 3FY8X 2VETA 3S3VA 4IXGX 2W9SA 3K45A 3UM8A 5HVBA 3NXTA 4KM0A 1U72A 4X5IA 2BBQA 2W3VA 5HS3A 2XW7A 3QYOA 2O7PA 3NXVA 2G8AA 1JMGA 1JTUA 1DR1A 1BKPA 3OB7A 4IXFX 3SH2A 1KZIA 4XE6X 1QQQA 3EJLA 1J3JC 1TSDA 3FQFA 3FQVA 3EDWX 1JMIA 3F8YA 3EEMA 5EAJA 1BP6A 4XECX 1YHOA 1JUJA 3CSEA 1DYHA 1TSXA 4XSEA 1AN5A 2VF0A 1RF7A 3ZPGA 1TSLA 5HQZA 3GH2X 3B9HA 4NX7A 4XT6A 2GD9A 4KJLA 3RO9A 1F28A 5H3AA 5FDAA 3F0SX 4G2OX 1KMSA 3NZBX 2DHFA 1F4BA 1RA8A 2OIPA 1VJ3A 4FOXA 3QFXA 4M6KA 5HSUA 4G8ZX 1TDRA 3TD8A 2H2QA 3F0VX 1SEJA 4H96A 1F4FA 1DG7A 1LY3A 1NJCA 1RX7A 2D5NA 3D80A 3DGAA 1BZFA 3GI2A 3KY8A 1FWMA 3UWLB 3BHLA 2AZNA 3QG2A 4O1XA 3FS6A 3I8AX 4ELEA 3I3RA 3FRDX 1B02A 3DRCA 1HFRA 4KJKA 1BQ1A 1HFQA 3M08A 2OBCA 1TRGA 3JWFA 3IRMA 2A9WA 1VZBA 1FFLA 3TQAA 1J3IC 3GH0A 3DL6A 1QZFA 2BLBA 2G6VA 4JEFA 4ELGA 4O1UA 1DRBA 3F91A 1J3JA 4M7VA 6DFRA 8DFRA 5FCTA 3NRRA 4ELFA 1IA2A 2FZHA 1RE7A 1TSYA 3FRAX 3DL5A 1EVGA 2P4GA 4X5JA 3NZ9X 3K47A 1U71A 5CC9A 7DFRA 1DR7A 3SRRX 1ZPRA 3H9KA 4GD7A 1RA2A 2B3ZA 1RX2A 4KPWA 1DR4A 4O7UA 1TYSA 3SRQX 3S7AA 4P3QA 2FTNA 1F4DA 4CD2A 3F8ZA 1TDBA 3IJZA 1DREA 3KJRA 3R33A 1VDRA 3KGBA 3SA1A 1RTSA 1DR2A 3FQOA 3QLRA 2G8DA 1BO8A 4HA9A 4XT4A 3CL9A 3BNZA 4KFJA 3EAWX 1EV8A 2G8XA 2RD8B 3JVXA 4M6LA 1EVFA 3NZDA 4KY8A 1BSPA 4FQSA 4EILA 2AAZA 1RX8A 3SRUX 4TU5X 2TSRA 1PDBA 1M7AA 4KEBA 2TSCA 4IRRA
chains in the Genus database with same CATH topology
1AI9A 4Q6AA 4G6WX 5J7WA 1RB3A 2W9GA 3QL0A 4Q67A 3QJ7A 2W9TA 4XT5A 1RX5A 3QL3A 1J3IA 1RA3A 2FZIA 2LF1A 3TQ9A 1NJAA 4ELHA 2C2SA 2CIGA 1KLKA 4IQQA 1DISA 1JOLA 3JW5A 4QJZD 1IA1A 4ISKA 3JWCA 1ZDRA 4QJCA 3IA5A 3QLWA 1J3KC 1NJBA 4FGGA 3DG8C 2W3MA 1RA1A 1AO8A 5JG0X 1DR5A 4DQ1A 1PD8A 4IXED 2FZJA 1DG5A 3JWKA 1S3WA 4DPHA 4GEVA 1CI7A 3B5BA 4PSGA 2W3WA 3N5EB 1NJEA 3IX6A 4H0UA 5HSRA 3SQYX 3INVA 3M09A 3EF9A 5WRNA 1LCBA 4KY4A 2G86A 1DDSA 3FREX 4I13A 5HF0X 4DPDA 1BO7A 1TISA 1I00A 5H38A 1TLCA 1TSNA 1DYRA 4ISWA 3NZ6X 3K2HA 1DLRA 1VZAA 3HBBA 1JUTA 3JTWA 1E26A 1BIDA 2CD2A 4QLGA 5ECCA 1DHFA 4FHBA 1B5DA 5HPBA 3BGXA 3IK1A 3K74A 1AJMA 4PTJA 3SAIA 3SGYA 1DG8A 2TDMA 1HW4A 1DR3A 3JWMA 1DHIA 3VCOA 5HVEA 4E5OA 3RG9A 3SA2A 2ZZAA 3ZPCA 4E28A 1IA3A 4PDJA 1BDUA 4G3MA 4FOAA 3QLYA 3GHVA 3UM5A 4I1NA 3TQBA 1TSVA 4HOFA 1JMHA 4KAKA 1LY4A 3JSUA 1J3KA 4KM2A 1U70A 1RX9A 3DG8A 3UWLA 4LEKX 4TMSA 1RB2A 3DAUA 1MVTA 3E0BA 3LG4A 3TMSA 4OR7A 4LAHX 4LRRA 4XT8A 3F0QX 1TLSA 3EX8A 3FQ0A 1TSZA 3EEKA 1RX6A 4XRBA 4XSDA 1BSFA 1F4CA 1RD7A 3N5GA 1BQ2A 1HW3A 1SYNA 3NXRA 4GH8A 1F4GA 2C2TA 3FYVX 1RX1A 1DDUA 4M2XA 5HF2X 1KCEA 1CZ3A 4EIZA 2KCEA 2ANOA 3IROA 4KNZA 3NTZA 1BP0A 1BOZA 4UP1A 1AXWA 2W3BA 1VZCA 2JYBA 4QLFA 3HB8A 2BLAA 3QLXA 1B5EA 3CD2A 4X5GA 3ROAA 4KD7A 1LCAA 4XT7A 1TDAA 4P68A 3BFIA 3BHRA 1JOMA 3GHCA 3Q1HA 4LAGX 1RX4A 5HT5A 5H39A 2RD8A 4KBNA 5ECXA 1RC4A 3F0BX 1OHJA 4P66A 3F0XX 3F0UX 1THYA 4LAEX 3OAFA 2BL9A 4PSTA 4X5FA 3CLBA 4PSSA 2HM9A 2RDAA 1RG7A 3FL9A 3N0HA 3NU0A 4HOEA 4FGTA 5HI6A 1HFPA 1RX3A 3BZ0A 2BLCA 1JTQA 3FYWX 2DRCA 3EEJA 4EJ1A 4G95A 1F4EA 1DDRA 1DIUA 4XSCA 4QI9A 3QYLA 3QLZA 1AIQA 2INQA 1HVYA 4ELBA 2ANQA 1S3UA 1NCEA 4KYAA 3EIGA 3GHWA 5HT4A 2TDDA 4KL9A 4RGCA 3DATA 4H97A 1RA9A 3HJ3A 5HQYA 3D84X 1IA4A 3JW3A 1TDUA 1M79A 4ECKA 1RH3A 1TSMA 3GG5A 3IRNA 3EELA 3C06A 2ITHA 2G89A 5HUIA 1DRHA 4FOGA 1DF7A 3N5EA 1EV5A 1S3VA 3FY9X 3OCHA 3IK0A 3FQCA 3KFYA 1HZWA 1CD2A 4KLXA 3FRFX 1VZEA 3KGYA 4DP3A 1MVSA 5U27A 3C0AA 1DRFA 3EHIX 4EB4A 1D1GA 1BPJA 4F2VA 1AOBA 4H98A 4PSYA 3SRWX 1DRAA 2KGKA 2W3AA 1BJGA 4H1IA 4FGHA 1DHJA 3EBUA 4KJJA 1LUDA 1BKOA 4Q0EA 1DR6A 4DDRA 2ONBA 4OSGA 2FTOX 4M6JA 3S9UA 1DYJA 1B49A 1YPVA 3BYXA 3QLSA 4PTHA 3IHIA 1DNAA 4DFRA 1DLSA 4NX6A 2HQPA 3L3RA 3FL8A 4GYHA 4M7UA 1M78A 4O1XD 5JA3A 1PD9A 4EIGA 5BY6A 3KJSA 1TSWA 3NZAX 4H0RA 3IX9A 3SRSX 1S3YA 3GYFA 4P3RA 3NZCX 1JUVA 3FQZA 3NXYA 3TQ8A 4IQBA 5E8QA 1TVUA 1TJSA 3FRBX 4HOGA 1KZJA 1OHKA 4Q0DA 5DXVA 3EGYX 2W9HA 2QK8A 4KNEA 1VZDA 1KMVA 4HA7A 4EINA 1DYIA 1NJDA 4QHVA 1JG0A 1LCEA 4QLEA 1JU6A 3QGTA 2HXVA 2D0KA 5U26A 3V8HA 1AOEA 1TDCA 2L28A 3UM6A 3DFRA 5DFRA 3SR5X 1DAJA 3IA4A 1TVWA 2FTQA 3DGAC 1TVVA 3ED7A 3NXOA 5CCCA 4EZ8A 4X5HA 4H95A 1JMFA 3NXXA 3FY8X 2VETA 3S3VA 4IXGX 2W9SA 3K45A 3UM8A 5HVBA 3NXTA 4KM0A 1U72A 4X5IA 2BBQA 2W3VA 5HS3A 2XW7A 3QYOA 2O7PA 3NXVA 2G8AA 1JMGA 1JTUA 1DR1A 1BKPA 3OB7A 4IXFX 3SH2A 1KZIA 4XE6X 1QQQA 3EJLA 1J3JC 1TSDA 3FQFA 3FQVA 3EDWX 1JMIA 3F8YA 3EEMA 5EAJA 1BP6A 4XECX 1YHOA 1JUJA 3CSEA 1DYHA 1TSXA 4XSEA 1AN5A 2VF0A 1RF7A 3ZPGA 1TSLA 5HQZA 3GH2X 3B9HA 4NX7A 4XT6A 2GD9A 4KJLA 3RO9A 1F28A 5H3AA 5FDAA 3F0SX 4G2OX 1KMSA 3NZBX 2DHFA 1F4BA 1RA8A 2OIPA 1VJ3A 4FOXA 3QFXA 4M6KA 5HSUA 4G8ZX 1TDRA 3TD8A 2H2QA 3F0VX 1SEJA 4H96A 1F4FA 1DG7A 1LY3A 1NJCA 1RX7A 2D5NA 3D80A 3DGAA 1BZFA 3GI2A 3KY8A 1FWMA 3UWLB 3BHLA 2AZNA 3QG2A 4O1XA 3FS6A 3I8AX 4ELEA 3I3RA 3FRDX 1B02A 3DRCA 1HFRA 4KJKA 1BQ1A 1HFQA 3M08A 2OBCA 1TRGA 3JWFA 3IRMA 2A9WA 1VZBA 1FFLA 3TQAA 1J3IC 3GH0A 3DL6A 1QZFA 2BLBA 2G6VA 4JEFA 4ELGA 4O1UA 1DRBA 3F91A 1J3JA 4M7VA 6DFRA 8DFRA 5FCTA 3NRRA 4ELFA 1IA2A 2FZHA 1RE7A 1TSYA 3FRAX 3DL5A 1EVGA 2P4GA 4X5JA 3NZ9X 3K47A 1U71A 5CC9A 7DFRA 1DR7A 3SRRX 1ZPRA 3H9KA 4GD7A 1RA2A 2B3ZA 1RX2A 4KPWA 1DR4A 4O7UA 1TYSA 3SRQX 3S7AA 4P3QA 2FTNA 1F4DA 4CD2A 3F8ZA 1TDBA 3IJZA 1DREA 3KJRA 3R33A 1VDRA 3KGBA 3SA1A 1RTSA 1DR2A 3FQOA 3QLRA 2G8DA 1BO8A 4HA9A 4XT4A 3CL9A 3BNZA 4KFJA 3EAWX 1EV8A 2G8XA 2RD8B 3JVXA 4M6LA 1EVFA 3NZDA 4KY8A 1BSPA 4FQSA 4EILA 2AAZA 1RX8A 3SRUX 4TU5X 2TSRA 1PDBA 1M7AA 4KEBA 2TSCA 4IRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AI9 A;  4Q6A A;  4G6W X;  5J7W A;  1RB3 A;  2W9G A;  3QL0 A;  4Q67 A;  3QJ7 A;  2W9T A;  4XT5 A;  1RX5 A;  3QL3 A;  1J3I A;  1RA3 A;  2FZI A;  2LF1 A;  3TQ9 A;  1NJA A;  4ELH A;  2C2S A;  2CIG A;  1KLK A;  4IQQ A;  1DIS A;  1JOL A;  3JW5 A;  4QJZ D;  1IA1 A;  4ISK A;  3JWC A;  1ZDR A;  4QJC A;  3IA5 A;  3QLW A;  1J3K C;  1NJB A;  4FGG A;  3DG8 C;  2W3M A;  1RA1 A;  1AO8 A;  5JG0 X;  1DR5 A;  4DQ1 A;  1PD8 A;  4IXE D;  2FZJ A;  1DG5 A;  3JWK A;  1S3W A;  4DPH A;  4GEV A;  1CI7 A;  3B5B A;  4PSG A;  2W3W A;  3N5E B;  1NJE A;  3IX6 A;  4H0U A;  5HSR A;  3SQY X;  3INV A;  3M09 A;  3EF9 A;  5WRN A;  1LCB A;  4KY4 A;  2G86 A;  1DDS A;  3FRE X;  4I13 A;  5HF0 X;  4DPD A;  1BO7 A;  1TIS A;  1I00 A;  5H38 A;  1TLC A;  1TSN A;  1DYR A;  4ISW A;  3NZ6 X;  3K2H A;  1DLR A;  1VZA A;  3HBB A;  1JUT A;  3JTW A;  1E26 A;  1BID A;  2CD2 A;  4QLG A;  5ECC A;  1DHF A;  4FHB A;  1B5D A;  5HPB A;  3BGX A;  3IK1 A;  3K74 A;  1AJM A;  4PTJ A;  3SAI A;  3SGY A;  1DG8 A;  2TDM A;  1HW4 A;  1DR3 A;  3JWM A;  1DHI A;  3VCO A;  5HVE A;  4E5O A;  3RG9 A;  3SA2 A;  2ZZA A;  3ZPC A;  4E28 A;  1IA3 A;  4PDJ A;  1BDU A;  4G3M A;  4FOA A;  3QLY A;  3GHV A;  3UM5 A;  4I1N A;  3TQB A;  1TSV A;  4HOF A;  1JMH A;  4KAK A;  1LY4 A;  3JSU A;  1J3K A;  4KM2 A;  1U70 A;  1RX9 A;  3DG8 A;  3UWL A;  4LEK X;  4TMS A;  1RB2 A;  3DAU A;  1MVT A;  3E0B A;  3LG4 A;  3TMS A;  4OR7 A;  4LAH X;  4LRR A;  4XT8 A;  3F0Q X;  1TLS A;  3EX8 A;  3FQ0 A;  1TSZ A;  3EEK A;  1RX6 A;  4XRB A;  4XSD A;  1BSF A;  1F4C A;  1RD7 A;  3N5G A;  1BQ2 A;  1HW3 A;  1SYN A;  3NXR A;  4GH8 A;  1F4G A;  2C2T A;  3FYV X;  1RX1 A;  1DDU A;  4M2X A;  5HF2 X;  1KCE A;  1CZ3 A;  4EIZ A;  2KCE A;  2ANO A;  3IRO A;  4KNZ A;  3NTZ A;  1BP0 A;  1BOZ A;  4UP1 A;  1AXW A;  2W3B A;  1VZC A;  2JYB A;  4QLF A;  3HB8 A;  2BLA A;  3QLX A;  1B5E A;  3CD2 A;  4X5G A;  3ROA A;  4KD7 A;  1LCA A;  4XT7 A;  1TDA A;  4P68 A;  3BFI A;  3BHR A;  1JOM A;  3GHC A;  3Q1H A;  4LAG X;  1RX4 A;  5HT5 A;  5H39 A;  2RD8 A;  4KBN A;  5ECX A;  1RC4 A;  3F0B X;  1OHJ A;  4P66 A;  3F0X X;  3F0U X;  1THY A;  4LAE X;  3OAF A;  2BL9 A;  4PST A;  4X5F A;  3CLB A;  4PSS A;  2HM9 A;  2RDA A;  1RG7 A;  3FL9 A;  3N0H A;  3NU0 A;  4HOE A;  4FGT A;  5HI6 A;  1HFP A;  1RX3 A;  3BZ0 A;  2BLC A;  1JTQ A;  3FYW X;  2DRC A;  3EEJ A;  4EJ1 A;  4G95 A;  1F4E A;  1DDR A;  1DIU A;  4XSC A;  4QI9 A;  3QYL A;  3QLZ A;  1AIQ A;  2INQ A;  1HVY A;  4ELB A;  2ANQ A;  1S3U A;  1NCE A;  4KYA A;  3EIG A;  3GHW A;  5HT4 A;  2TDD A;  4KL9 A;  4RGC A;  3DAT A;  4H97 A;  1RA9 A;  3HJ3 A;  5HQY A;  3D84 X;  1IA4 A;  3JW3 A;  1TDU A;  1M79 A;  4ECK A;  1RH3 A;  1TSM A;  3GG5 A;  3IRN A;  3EEL A;  3C06 A;  2ITH A;  2G89 A;  5HUI A;  1DRH A;  4FOG A;  1DF7 A;  3N5E A;  1EV5 A;  1S3V A;  3FY9 X;  3OCH A;  3IK0 A;  3FQC A;  3KFY A;  1HZW A;  1CD2 A;  4KLX A;  3FRF X;  1VZE A;  3KGY A;  4DP3 A;  1MVS A;  5U27 A;  3C0A A;  1DRF A;  3EHI X;  4EB4 A;  1D1G A;  1BPJ A;  4F2V A;  1AOB A;  4H98 A;  4PSY A;  3SRW X;  1DRA A;  2KGK A;  2W3A A;  1BJG A;  4H1I A;  4FGH A;  1DHJ A;  3EBU A;  4KJJ A;  1LUD A;  1BKO A;  4Q0E A;  1DR6 A;  4DDR A;  2ONB A;  4OSG A;  2FTO X;  4M6J A;  3S9U A;  1DYJ A;  1B49 A;  1YPV A;  3BYX A;  3QLS A;  4PTH A;  3IHI A;  1DNA A;  4DFR A;  1DLS A;  4NX6 A;  2HQP A;  3L3R A;  3FL8 A;  4GYH A;  4M7U A;  1M78 A;  4O1X D;  5JA3 A;  1PD9 A;  4EIG A;  5BY6 A;  3KJS A;  1TSW A;  3NZA X;  4H0R A;  3IX9 A;  3SRS X;  1S3Y A;  3GYF A;  4P3R A;  3NZC X;  1JUV A;  3FQZ A;  3NXY A;  3TQ8 A;  4IQB A;  5E8Q A;  1TVU A;  1TJS A;  3FRB X;  4HOG A;  1KZJ A;  1OHK A;  4Q0D A;  5DXV A;  3EGY X;  2W9H A;  2QK8 A;  4KNE A;  1VZD A;  1KMV A;  4HA7 A;  4EIN A;  1DYI A;  1NJD A;  4QHV A;  1JG0 A;  1LCE A;  4QLE A;  1JU6 A;  3QGT A;  2HXV A;  2D0K A;  5U26 A;  3V8H A;  1AOE A;  1TDC A;  2L28 A;  3UM6 A;  3DFR A;  5DFR A;  3SR5 X;  1DAJ A;  3IA4 A;  1TVW A;  2FTQ A;  3DGA C;  1TVV A;  3ED7 A;  3NXO A;  5CCC A;  4EZ8 A;  4X5H A;  4H95 A;  1JMF A;  3NXX A;  3FY8 X;  2VET A;  3S3V A;  4IXG X;  2W9S A;  3K45 A;  3UM8 A;  5HVB A;  3NXT A;  4KM0 A;  1U72 A;  4X5I A;  2BBQ A;  2W3V A;  5HS3 A;  2XW7 A;  3QYO A;  2O7P A;  3NXV A;  2G8A A;  1JMG A;  1JTU A;  1DR1 A;  1BKP A;  3OB7 A;  4IXF X;  3SH2 A;  1KZI A;  4XE6 X;  1QQQ A;  3EJL A;  1J3J C;  1TSD A;  3FQF A;  3FQV A;  3EDW X;  1JMI A;  3F8Y A;  3EEM A;  5EAJ A;  1BP6 A;  4XEC X;  1YHO A;  1JUJ A;  3CSE A;  1DYH A;  1TSX A;  4XSE A;  1AN5 A;  2VF0 A;  1RF7 A;  3ZPG A;  1TSL A;  5HQZ A;  3GH2 X;  3B9H A;  4NX7 A;  4XT6 A;  2GD9 A;  4KJL A;  3RO9 A;  1F28 A;  5H3A A;  5FDA A;  3F0S X;  4G2O X;  1KMS A;  3NZB X;  2DHF A;  1F4B A;  1RA8 A;  2OIP A;  1VJ3 A;  4FOX A;  3QFX A;  4M6K A;  5HSU A;  4G8Z X;  1TDR A;  3TD8 A;  2H2Q A;  3F0V X;  1SEJ A;  4H96 A;  1F4F A;  1DG7 A;  1LY3 A;  1NJC A;  1RX7 A;  2D5N A;  3D80 A;  3DGA A;  1BZF A;  3GI2 A;  3KY8 A;  1FWM A;  3UWL B;  3BHL A;  2AZN A;  3QG2 A;  4O1X A;  3FS6 A;  3I8A X;  4ELE A;  3I3R A;  3FRD X;  1B02 A;  3DRC A;  1HFR A;  4KJK A;  1BQ1 A;  1HFQ A;  3M08 A;  2OBC A;  1TRG A;  3JWF A;  3IRM A;  2A9W A;  1VZB A;  1FFL A;  3TQA A;  1J3I C;  3GH0 A;  3DL6 A;  1QZF A;  2BLB A;  2G6V A;  4JEF A;  4ELG A;  4O1U A;  1DRB A;  3F91 A;  1J3J A;  4M7V A;  6DFR A;  8DFR A;  5FCT A;  3NRR A;  4ELF A;  1IA2 A;  2FZH A;  1RE7 A;  1TSY A;  3FRA X;  3DL5 A;  1EVG A;  2P4G A;  4X5J A;  3NZ9 X;  3K47 A;  1U71 A;  5CC9 A;  7DFR A;  1DR7 A;  3SRR X;  1ZPR A;  3H9K A;  4GD7 A;  1RA2 A;  2B3Z A;  1RX2 A;  4KPW A;  1DR4 A;  4O7U A;  1TYS A;  3SRQ X;  3S7A A;  4P3Q A;  2FTN A;  1F4D A;  4CD2 A;  3F8Z A;  1TDB A;  3IJZ A;  1DRE A;  3KJR A;  3R33 A;  1VDR A;  3KGB A;  3SA1 A;  1RTS A;  1DR2 A;  3FQO A;  3QLR A;  2G8D A;  1BO8 A;  4HA9 A;  4XT4 A;  3CL9 A;  3BNZ A;  4KFJ A;  3EAW X;  1EV8 A;  2G8X A;  2RD8 B;  3JVX A;  4M6L A;  1EVF A;  3NZD A;  4KY8 A;  1BSP A;  4FQS A;  4EIL A;  2AAZ A;  1RX8 A;  3SRU X;  4TU5 X;  2TSR A;  1PDB A;  1M7A A;  4KEB A;  2TSC A;  4IRR A; 
#chains in the Genus database with same CATH topology
 1AI9 A;  4Q6A A;  4G6W X;  5J7W A;  1RB3 A;  2W9G A;  3QL0 A;  4Q67 A;  3QJ7 A;  2W9T A;  4XT5 A;  1RX5 A;  3QL3 A;  1J3I A;  1RA3 A;  2FZI A;  2LF1 A;  3TQ9 A;  1NJA A;  4ELH A;  2C2S A;  2CIG A;  1KLK A;  4IQQ A;  1DIS A;  1JOL A;  3JW5 A;  4QJZ D;  1IA1 A;  4ISK A;  3JWC A;  1ZDR A;  4QJC A;  3IA5 A;  3QLW A;  1J3K C;  1NJB A;  4FGG A;  3DG8 C;  2W3M A;  1RA1 A;  1AO8 A;  5JG0 X;  1DR5 A;  4DQ1 A;  1PD8 A;  4IXE D;  2FZJ A;  1DG5 A;  3JWK A;  1S3W A;  4DPH A;  4GEV A;  1CI7 A;  3B5B A;  4PSG A;  2W3W A;  3N5E B;  1NJE A;  3IX6 A;  4H0U A;  5HSR A;  3SQY X;  3INV A;  3M09 A;  3EF9 A;  5WRN A;  1LCB A;  4KY4 A;  2G86 A;  1DDS A;  3FRE X;  4I13 A;  5HF0 X;  4DPD A;  1BO7 A;  1TIS A;  1I00 A;  5H38 A;  1TLC A;  1TSN A;  1DYR A;  4ISW A;  3NZ6 X;  3K2H A;  1DLR A;  1VZA A;  3HBB A;  1JUT A;  3JTW A;  1E26 A;  1BID A;  2CD2 A;  4QLG A;  5ECC A;  1DHF A;  4FHB A;  1B5D A;  5HPB A;  3BGX A;  3IK1 A;  3K74 A;  1AJM A;  4PTJ A;  3SAI A;  3SGY A;  1DG8 A;  2TDM A;  1HW4 A;  1DR3 A;  3JWM A;  1DHI A;  3VCO A;  5HVE A;  4E5O A;  3RG9 A;  3SA2 A;  2ZZA A;  3ZPC A;  4E28 A;  1IA3 A;  4PDJ A;  1BDU A;  4G3M A;  4FOA A;  3QLY A;  3GHV A;  3UM5 A;  4I1N A;  3TQB A;  1TSV A;  4HOF A;  1JMH A;  4KAK A;  1LY4 A;  3JSU A;  1J3K A;  4KM2 A;  1U70 A;  1RX9 A;  3DG8 A;  3UWL A;  4LEK X;  4TMS A;  1RB2 A;  3DAU A;  1MVT A;  3E0B A;  3LG4 A;  3TMS A;  4OR7 A;  4LAH X;  4LRR A;  4XT8 A;  3F0Q X;  1TLS A;  3EX8 A;  3FQ0 A;  1TSZ A;  3EEK A;  1RX6 A;  4XRB A;  4XSD A;  1BSF A;  1F4C A;  1RD7 A;  3N5G A;  1BQ2 A;  1HW3 A;  1SYN A;  3NXR A;  4GH8 A;  1F4G A;  2C2T A;  3FYV X;  1RX1 A;  1DDU A;  4M2X A;  5HF2 X;  1KCE A;  1CZ3 A;  4EIZ A;  2KCE A;  2ANO A;  3IRO A;  4KNZ A;  3NTZ A;  1BP0 A;  1BOZ A;  4UP1 A;  1AXW A;  2W3B A;  1VZC A;  2JYB A;  4QLF A;  3HB8 A;  2BLA A;  3QLX A;  1B5E A;  3CD2 A;  4X5G A;  3ROA A;  4KD7 A;  1LCA A;  4XT7 A;  1TDA A;  4P68 A;  3BFI A;  3BHR A;  1JOM A;  3GHC A;  3Q1H A;  4LAG X;  1RX4 A;  5HT5 A;  5H39 A;  2RD8 A;  4KBN A;  5ECX A;  1RC4 A;  3F0B X;  1OHJ A;  4P66 A;  3F0X X;  3F0U X;  1THY A;  4LAE X;  3OAF A;  2BL9 A;  4PST A;  4X5F A;  3CLB A;  4PSS A;  2HM9 A;  2RDA A;  1RG7 A;  3FL9 A;  3N0H A;  3NU0 A;  4HOE A;  4FGT A;  5HI6 A;  1HFP A;  1RX3 A;  3BZ0 A;  2BLC A;  1JTQ A;  3FYW X;  2DRC A;  3EEJ A;  4EJ1 A;  4G95 A;  1F4E A;  1DDR A;  1DIU A;  4XSC A;  4QI9 A;  3QYL A;  3QLZ A;  1AIQ A;  2INQ A;  1HVY A;  4ELB A;  2ANQ A;  1S3U A;  1NCE A;  4KYA A;  3EIG A;  3GHW A;  5HT4 A;  2TDD A;  4KL9 A;  4RGC A;  3DAT A;  4H97 A;  1RA9 A;  3HJ3 A;  5HQY A;  3D84 X;  1IA4 A;  3JW3 A;  1TDU A;  1M79 A;  4ECK A;  1RH3 A;  1TSM A;  3GG5 A;  3IRN A;  3EEL A;  3C06 A;  2ITH A;  2G89 A;  5HUI A;  1DRH A;  4FOG A;  1DF7 A;  3N5E A;  1EV5 A;  1S3V A;  3FY9 X;  3OCH A;  3IK0 A;  3FQC A;  3KFY A;  1HZW A;  1CD2 A;  4KLX A;  3FRF X;  1VZE A;  3KGY A;  4DP3 A;  1MVS A;  5U27 A;  3C0A A;  1DRF A;  3EHI X;  4EB4 A;  1D1G A;  1BPJ A;  4F2V A;  1AOB A;  4H98 A;  4PSY A;  3SRW X;  1DRA A;  2KGK A;  2W3A A;  1BJG A;  4H1I A;  4FGH A;  1DHJ A;  3EBU A;  4KJJ A;  1LUD A;  1BKO A;  4Q0E A;  1DR6 A;  4DDR A;  2ONB A;  4OSG A;  2FTO X;  4M6J A;  3S9U A;  1DYJ A;  1B49 A;  1YPV A;  3BYX A;  3QLS A;  4PTH A;  3IHI A;  1DNA A;  4DFR A;  1DLS A;  4NX6 A;  2HQP A;  3L3R A;  3FL8 A;  4GYH A;  4M7U A;  1M78 A;  4O1X D;  5JA3 A;  1PD9 A;  4EIG A;  5BY6 A;  3KJS A;  1TSW A;  3NZA X;  4H0R A;  3IX9 A;  3SRS X;  1S3Y A;  3GYF A;  4P3R A;  3NZC X;  1JUV A;  3FQZ A;  3NXY A;  3TQ8 A;  4IQB A;  5E8Q A;  1TVU A;  1TJS A;  3FRB X;  4HOG A;  1KZJ A;  1OHK A;  4Q0D A;  5DXV A;  3EGY X;  2W9H A;  2QK8 A;  4KNE A;  1VZD A;  1KMV A;  4HA7 A;  4EIN A;  1DYI A;  1NJD A;  4QHV A;  1JG0 A;  1LCE A;  4QLE A;  1JU6 A;  3QGT A;  2HXV A;  2D0K A;  5U26 A;  3V8H A;  1AOE A;  1TDC A;  2L28 A;  3UM6 A;  3DFR A;  5DFR A;  3SR5 X;  1DAJ A;  3IA4 A;  1TVW A;  2FTQ A;  3DGA C;  1TVV A;  3ED7 A;  3NXO A;  5CCC A;  4EZ8 A;  4X5H A;  4H95 A;  1JMF A;  3NXX A;  3FY8 X;  2VET A;  3S3V A;  4IXG X;  2W9S A;  3K45 A;  3UM8 A;  5HVB A;  3NXT A;  4KM0 A;  1U72 A;  4X5I A;  2BBQ A;  2W3V A;  5HS3 A;  2XW7 A;  3QYO A;  2O7P A;  3NXV A;  2G8A A;  1JMG A;  1JTU A;  1DR1 A;  1BKP A;  3OB7 A;  4IXF X;  3SH2 A;  1KZI A;  4XE6 X;  1QQQ A;  3EJL A;  1J3J C;  1TSD A;  3FQF A;  3FQV A;  3EDW X;  1JMI A;  3F8Y A;  3EEM A;  5EAJ A;  1BP6 A;  4XEC X;  1YHO A;  1JUJ A;  3CSE A;  1DYH A;  1TSX A;  4XSE A;  1AN5 A;  2VF0 A;  1RF7 A;  3ZPG A;  1TSL A;  5HQZ A;  3GH2 X;  3B9H A;  4NX7 A;  4XT6 A;  2GD9 A;  4KJL A;  3RO9 A;  1F28 A;  5H3A A;  5FDA A;  3F0S X;  4G2O X;  1KMS A;  3NZB X;  2DHF A;  1F4B A;  1RA8 A;  2OIP A;  1VJ3 A;  4FOX A;  3QFX A;  4M6K A;  5HSU A;  4G8Z X;  1TDR A;  3TD8 A;  2H2Q A;  3F0V X;  1SEJ A;  4H96 A;  1F4F A;  1DG7 A;  1LY3 A;  1NJC A;  1RX7 A;  2D5N A;  3D80 A;  3DGA A;  1BZF A;  3GI2 A;  3KY8 A;  1FWM A;  3UWL B;  3BHL A;  2AZN A;  3QG2 A;  4O1X A;  3FS6 A;  3I8A X;  4ELE A;  3I3R A;  3FRD X;  1B02 A;  3DRC A;  1HFR A;  4KJK A;  1BQ1 A;  1HFQ A;  3M08 A;  2OBC A;  1TRG A;  3JWF A;  3IRM A;  2A9W A;  1VZB A;  1FFL A;  3TQA A;  1J3I C;  3GH0 A;  3DL6 A;  1QZF A;  2BLB A;  2G6V A;  4JEF A;  4ELG A;  4O1U A;  1DRB A;  3F91 A;  1J3J A;  4M7V A;  6DFR A;  8DFR A;  5FCT A;  3NRR A;  4ELF A;  1IA2 A;  2FZH A;  1RE7 A;  1TSY A;  3FRA X;  3DL5 A;  1EVG A;  2P4G A;  4X5J A;  3NZ9 X;  3K47 A;  1U71 A;  5CC9 A;  7DFR A;  1DR7 A;  3SRR X;  1ZPR A;  3H9K A;  4GD7 A;  1RA2 A;  2B3Z A;  1RX2 A;  4KPW A;  1DR4 A;  4O7U A;  1TYS A;  3SRQ X;  3S7A A;  4P3Q A;  2FTN A;  1F4D A;  4CD2 A;  3F8Z A;  1TDB A;  3IJZ A;  1DRE A;  3KJR A;  3R33 A;  1VDR A;  3KGB A;  3SA1 A;  1RTS A;  1DR2 A;  3FQO A;  3QLR A;  2G8D A;  1BO8 A;  4HA9 A;  4XT4 A;  3CL9 A;  3BNZ A;  4KFJ A;  3EAW X;  1EV8 A;  2G8X A;  2RD8 B;  3JVX A;  4M6L A;  1EVF A;  3NZD A;  4KY8 A;  1BSP A;  4FQS A;  4EIL A;  2AAZ A;  1RX8 A;  3SRU X;  4TU5 X;  2TSR A;  1PDB A;  1M7A A;  4KEB A;  2TSC A;  4IRR A; 
#chains in the Genus database with same CATH homology
 1AI9 A;  4Q6A A;  4G6W X;  5J7W A;  1RB3 A;  2W9G A;  3QL0 A;  4Q67 A;  3QJ7 A;  2W9T A;  4XT5 A;  1RX5 A;  3QL3 A;  1J3I A;  1RA3 A;  2FZI A;  2LF1 A;  3TQ9 A;  1NJA A;  4ELH A;  2C2S A;  2CIG A;  1KLK A;  4IQQ A;  1DIS A;  1JOL A;  3JW5 A;  4QJZ D;  1IA1 A;  4ISK A;  3JWC A;  1ZDR A;  4QJC A;  3IA5 A;  3QLW A;  1J3K C;  1NJB A;  4FGG A;  3DG8 C;  2W3M A;  1RA1 A;  1AO8 A;  5JG0 X;  1DR5 A;  4DQ1 A;  1PD8 A;  4IXE D;  2FZJ A;  1DG5 A;  3JWK A;  1S3W A;  4DPH A;  4GEV A;  1CI7 A;  3B5B A;  4PSG A;  2W3W A;  3N5E B;  1NJE A;  3IX6 A;  4H0U A;  5HSR A;  3SQY X;  3INV A;  3M09 A;  3EF9 A;  5WRN A;  1LCB A;  4KY4 A;  2G86 A;  1DDS A;  3FRE X;  4I13 A;  5HF0 X;  4DPD A;  1BO7 A;  1TIS A;  1I00 A;  5H38 A;  1TLC A;  1TSN A;  1DYR A;  4ISW A;  3NZ6 X;  3K2H A;  1DLR A;  1VZA A;  3HBB A;  1JUT A;  3JTW A;  1E26 A;  1BID A;  2CD2 A;  4QLG A;  5ECC A;  1DHF A;  4FHB A;  1B5D A;  5HPB A;  3BGX A;  3IK1 A;  3K74 A;  1AJM A;  4PTJ A;  3SAI A;  3SGY A;  1DG8 A;  2TDM A;  1HW4 A;  1DR3 A;  3JWM A;  1DHI A;  3VCO A;  5HVE A;  4E5O A;  3RG9 A;  3SA2 A;  2ZZA A;  3ZPC A;  4E28 A;  1IA3 A;  4PDJ A;  1BDU A;  4G3M A;  4FOA A;  3QLY A;  3GHV A;  3UM5 A;  4I1N A;  3TQB A;  1TSV A;  4HOF A;  1JMH A;  4KAK A;  1LY4 A;  3JSU A;  1J3K A;  4KM2 A;  1U70 A;  1RX9 A;  3DG8 A;  3UWL A;  4LEK X;  4TMS A;  1RB2 A;  3DAU A;  1MVT A;  3E0B A;  3LG4 A;  3TMS A;  4OR7 A;  4LAH X;  4LRR A;  4XT8 A;  3F0Q X;  1TLS A;  3EX8 A;  3FQ0 A;  1TSZ A;  3EEK A;  1RX6 A;  4XRB A;  4XSD A;  1BSF A;  1F4C A;  1RD7 A;  3N5G A;  1BQ2 A;  1HW3 A;  1SYN A;  3NXR A;  4GH8 A;  1F4G A;  2C2T A;  3FYV X;  1RX1 A;  1DDU A;  4M2X A;  5HF2 X;  1KCE A;  1CZ3 A;  4EIZ A;  2KCE A;  2ANO A;  3IRO A;  4KNZ A;  3NTZ A;  1BP0 A;  1BOZ A;  4UP1 A;  1AXW A;  2W3B A;  1VZC A;  2JYB A;  4QLF A;  3HB8 A;  2BLA A;  3QLX A;  1B5E A;  3CD2 A;  4X5G A;  3ROA A;  4KD7 A;  1LCA A;  4XT7 A;  1TDA A;  4P68 A;  3BFI A;  3BHR A;  1JOM A;  3GHC A;  3Q1H A;  4LAG X;  1RX4 A;  5HT5 A;  5H39 A;  2RD8 A;  4KBN A;  5ECX A;  1RC4 A;  3F0B X;  1OHJ A;  4P66 A;  3F0X X;  3F0U X;  1THY A;  4LAE X;  3OAF A;  2BL9 A;  4PST A;  4X5F A;  3CLB A;  4PSS A;  2HM9 A;  2RDA A;  1RG7 A;  3FL9 A;  3N0H A;  3NU0 A;  4HOE A;  4FGT A;  5HI6 A;  1HFP A;  1RX3 A;  3BZ0 A;  2BLC A;  1JTQ A;  3FYW X;  2DRC A;  3EEJ A;  4EJ1 A;  4G95 A;  1F4E A;  1DDR A;  1DIU A;  4XSC A;  4QI9 A;  3QYL A;  3QLZ A;  1AIQ A;  2INQ A;  1HVY A;  4ELB A;  2ANQ A;  1S3U A;  1NCE A;  4KYA A;  3EIG A;  3GHW A;  5HT4 A;  2TDD A;  4KL9 A;  4RGC A;  3DAT A;  4H97 A;  1RA9 A;  3HJ3 A;  5HQY A;  3D84 X;  1IA4 A;  3JW3 A;  1TDU A;  1M79 A;  4ECK A;  1RH3 A;  1TSM A;  3GG5 A;  3IRN A;  3EEL A;  3C06 A;  2ITH A;  2G89 A;  5HUI A;  1DRH A;  4FOG A;  1DF7 A;  3N5E A;  1EV5 A;  1S3V A;  3FY9 X;  3OCH A;  3IK0 A;  3FQC A;  3KFY A;  1HZW A;  1CD2 A;  4KLX A;  3FRF X;  1VZE A;  3KGY A;  4DP3 A;  1MVS A;  5U27 A;  3C0A A;  1DRF A;  3EHI X;  4EB4 A;  1D1G A;  1BPJ A;  4F2V A;  1AOB A;  4H98 A;  4PSY A;  3SRW X;  1DRA A;  2KGK A;  2W3A A;  1BJG A;  4H1I A;  4FGH A;  1DHJ A;  3EBU A;  4KJJ A;  1LUD A;  1BKO A;  4Q0E A;  1DR6 A;  4DDR A;  2ONB A;  4OSG A;  2FTO X;  4M6J A;  3S9U A;  1DYJ A;  1B49 A;  1YPV A;  3BYX A;  3QLS A;  4PTH A;  3IHI A;  1DNA A;  4DFR A;  1DLS A;  4NX6 A;  2HQP A;  3L3R A;  3FL8 A;  4GYH A;  4M7U A;  1M78 A;  4O1X D;  5JA3 A;  1PD9 A;  4EIG A;  5BY6 A;  3KJS A;  1TSW A;  3NZA X;  4H0R A;  3IX9 A;  3SRS X;  1S3Y A;  3GYF A;  4P3R A;  3NZC X;  1JUV A;  3FQZ A;  3NXY A;  3TQ8 A;  4IQB A;  5E8Q A;  1TVU A;  1TJS A;  3FRB X;  4HOG A;  1KZJ A;  1OHK A;  4Q0D A;  5DXV A;  3EGY X;  2W9H A;  2QK8 A;  4KNE A;  1VZD A;  1KMV A;  4HA7 A;  4EIN A;  1DYI A;  1NJD A;  4QHV A;  1JG0 A;  1LCE A;  4QLE A;  1JU6 A;  3QGT A;  2HXV A;  2D0K A;  5U26 A;  3V8H A;  1AOE A;  1TDC A;  2L28 A;  3UM6 A;  3DFR A;  5DFR A;  3SR5 X;  1DAJ A;  3IA4 A;  1TVW A;  2FTQ A;  3DGA C;  1TVV A;  3ED7 A;  3NXO A;  5CCC A;  4EZ8 A;  4X5H A;  4H95 A;  1JMF A;  3NXX A;  3FY8 X;  2VET A;  3S3V A;  4IXG X;  2W9S A;  3K45 A;  3UM8 A;  5HVB A;  3NXT A;  4KM0 A;  1U72 A;  4X5I A;  2BBQ A;  2W3V A;  5HS3 A;  2XW7 A;  3QYO A;  2O7P A;  3NXV A;  2G8A A;  1JMG A;  1JTU A;  1DR1 A;  1BKP A;  3OB7 A;  4IXF X;  3SH2 A;  1KZI A;  4XE6 X;  1QQQ A;  3EJL A;  1J3J C;  1TSD A;  3FQF A;  3FQV A;  3EDW X;  1JMI A;  3F8Y A;  3EEM A;  5EAJ A;  1BP6 A;  4XEC X;  1YHO A;  1JUJ A;  3CSE A;  1DYH A;  1TSX A;  4XSE A;  1AN5 A;  2VF0 A;  1RF7 A;  3ZPG A;  1TSL A;  5HQZ A;  3GH2 X;  3B9H A;  4NX7 A;  4XT6 A;  2GD9 A;  4KJL A;  3RO9 A;  1F28 A;  5H3A A;  5FDA A;  3F0S X;  4G2O X;  1KMS A;  3NZB X;  2DHF A;  1F4B A;  1RA8 A;  2OIP A;  1VJ3 A;  4FOX A;  3QFX A;  4M6K A;  5HSU A;  4G8Z X;  1TDR A;  3TD8 A;  2H2Q A;  3F0V X;  1SEJ A;  4H96 A;  1F4F A;  1DG7 A;  1LY3 A;  1NJC A;  1RX7 A;  2D5N A;  3D80 A;  3DGA A;  1BZF A;  3GI2 A;  3KY8 A;  1FWM A;  3UWL B;  3BHL A;  2AZN A;  3QG2 A;  4O1X A;  3FS6 A;  3I8A X;  4ELE A;  3I3R A;  3FRD X;  1B02 A;  3DRC A;  1HFR A;  4KJK A;  1BQ1 A;  1HFQ A;  3M08 A;  2OBC A;  1TRG A;  3JWF A;  3IRM A;  2A9W A;  1VZB A;  1FFL A;  3TQA A;  1J3I C;  3GH0 A;  3DL6 A;  1QZF A;  2BLB A;  2G6V A;  4JEF A;  4ELG A;  4O1U A;  1DRB A;  3F91 A;  1J3J A;  4M7V A;  6DFR A;  8DFR A;  5FCT A;  3NRR A;  4ELF A;  1IA2 A;  2FZH A;  1RE7 A;  1TSY A;  3FRA X;  3DL5 A;  1EVG A;  2P4G A;  4X5J A;  3NZ9 X;  3K47 A;  1U71 A;  5CC9 A;  7DFR A;  1DR7 A;  3SRR X;  1ZPR A;  3H9K A;  4GD7 A;  1RA2 A;  2B3Z A;  1RX2 A;  4KPW A;  1DR4 A;  4O7U A;  1TYS A;  3SRQ X;  3S7A A;  4P3Q A;  2FTN A;  1F4D A;  4CD2 A;  3F8Z A;  1TDB A;  3IJZ A;  1DRE A;  3KJR A;  3R33 A;  1VDR A;  3KGB A;  3SA1 A;  1RTS A;  1DR2 A;  3FQO A;  3QLR A;  2G8D A;  1BO8 A;  4HA9 A;  4XT4 A;  3CL9 A;  3BNZ A;  4KFJ A;  3EAW X;  1EV8 A;  2G8X A;  2RD8 B;  3JVX A;  4M6L A;  1EVF A;  3NZD A;  4KY8 A;  1BSP A;  4FQS A;  4EIL A;  2AAZ A;  1RX8 A;  3SRU X;  4TU5 X;  2TSR A;  1PDB A;  1M7A A;  4KEB A;  2TSC A;  4IRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...