3UM6A

Double mutant (a16v+s108t) plasmodium falciparum dhfr-ts (t9/94) complexed with cycloguanil, nadph and dump
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
608
structure length
546
Chain Sequence
MMEQVCDVFDIYAICVCCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKEKKLQNVVVMGRTTWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, transferase/inhibitor
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title Combined Spatial Limitation around Residues 16 and 108 of Plasmodium falciparum Dihydrofolate Reductase Explains Resistance to Cycloguanil.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 168
structure length 546
sequence length 608
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3um6A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3um6A01
1RH3A 4XRBA 5JA3A 1AOEA 2BLCA 4FGTA 2AZNA 1B02A 3NXXA 5JG0X 3IA4A 3DL6A 3GG5A 3NZBX 1F4BA 4LAHX 5HSUA 3SRUX 1SEJA 1LCEA 2O7PA 3FQCA 4EIGA 1CD2A 1TDBA 3KY8A 3Q1HA 1IA2A 4EIZA 3N5EB 4G3MA 3ED7A 1RX9A 3KGYA 3ROAA 4FOGA 1QQQA 1JMGA 2D5NA 4ELFA 4KM0A 1VJ3A 4M7VA 2RDAA 4ISWA 3HB8A 1JG0A 1DDRA 2GD9A 1TVUA 3F0SX 1KLKA 2G86A 4Q67A 4I1NA 2FZJA 4QLFA 3EJLA 1EV8A 1IA3A 1RX1A 4M6JA 2HXVA 1RE7A 4FGGA 3JSUA 1LCAA 1J3KA 1ZDRA 1TVWA 3I3RA 1PD9A 4F2VA 1HVYA 1BP0A 1BOZA 3BNZA 1DR2A 3DGAC 3N5GA 1DLSA 1RA9A 1J3JA 1JMIA 4FOAA 1MVSA 3SR5X 3IX6A 3EGYX 4TMSA 1TSVA 5U26A 5HSRA 1NJEA 1S3YA 3IJZA 4X5JA 1LUDA 4P3QA 8DFRA 1RX5A 4PTJA 4IQBA 1BIDA 4GD7A 6DFRA 2CIGA 3IK1A 3EEJA 1TDAA 4X5FA 4UP1A 2FTNA 2P4GA 4QLGA 3GH0A 3DG8C 4GYHA 1AI9A 3JWMA 4LEKX 3QFXA 4ELEA 1BPJA 1DF7A 1NCEA 4M2XA 1LCBA 3JW3A 2TSCA 2CD2A 5WRNA 3NXVA 2LF1A 3QLRA 4KD7A 1JUTA 2TSRA 4DPDA 1NJBA 2W3AA 4FOXA 1KZIA 1DLRA 1I00A 3DGAA 1M79A 3VCOA 2KCEA 1FFLA 4EILA 1VZEA 4ELBA 1DIUA 2G8XA 1M7AA 4E5OA 1IA1A 1DDSA 2AAZA 3FYWX 3N0HA 3UM6A 1PDBA 4KBNA 3GHWA 1JMHA 3SA1A 1LY4A 3FRDX 4LAGX 5HF0X 3BHLA 4QJCA 1J3IC 3DRCA 1AOBA 3BFIA 2W3BA 2HM9A 4ECKA 3EX8A 3FQZA 4H96A 3EEKA 2G6VA 1RA8A 3UM5A 2C2TA 3S7AA 1JOMA 4JEFA 1F4DA 4O1UA 5EAJA 1BQ2A 3FQOA 5HQYA 1JU6A 1EVGA 1RA1A 3SA2A 3DATA 3IROA 1TDRA 3ZPCA 5DFRA 3IRNA 1KMSA 1YHOA 2W9TA 3UWLB 3FY9X 3NZ6X 4EB4A 5H3AA 1JUJA 1RB2A 3F91A 3IX9A 4H0RA 2VETA 4EZ8A 3RG9A 4KYAA 1DHIA 3TQ8A 3M08A 3CD2A 1RD7A 1CZ3A 5H38A 3SRSX 2G89A 1KMVA 2HQPA 4PDJA 4KM2A 1F28A 4PSTA 3JWCA 3UM8A 3KGBA 1F4GA 3EHIX 1RX7A 4M7UA 1DRFA 1MVTA 3F0QX 2KGKA 1BQ1A 1BJGA 2C2SA 3QLZA 1B5EA 1RB3A 2G8DA 3QL0A 3NU0A 4XT8A 1RA2A 2H2QA 3FQ0A 4P68A 1TDUA 3SGYA 1EV5A 3EELA 2DHFA 3GH2X 1DYRA 1DRBA 1JTUA 4KFJA 4X5GA 4H1IA 3EDWX 3C06A 1RX3A 3NXOA 3FS6A 4RGCA 1BSFA 3FRBX 2W9GA 1TJSA 1BKPA 4PTHA 1RX4A 1DISA 4NX7A 1JUVA 3F0VX 3R33A 3KFYA 3C0AA 5HVBA 4KJKA 3EIGA 1DAJA 4DP3A 1DHJA 1DG5A 2FZHA 2ZZAA 2W3MA 2A9WA 1BP6A 3FRAX 3D80A 4DFRA 5ECXA 1FWMA 1TYSA 2RD8A 1DR6A 4ELHA 3E0BA 1S3WA 1KCEA 3I8AX 1RX2A 3BZ0A 1NJDA 3GHCA 2BLBA 3TQBA 3FY8X 1VZDA 3JWFA 4G95A 3F0UX 1F4EA 3EAWX 1JMFA 3QJ7A 3B5BA 3K47A 4IXFX 1RX8A 4KPWA 1U71A 1BO7A 2L28A 3QGTA 2ANQA 3OAFA 5HF2X 1TSLA 3SRQX 3FREX 5HPBA 3IRMA 3CLBA 1DR1A 3NZDA 3K74A 4I13A 4KY8A 3F0XX 3GYFA 3FQFA 1DNAA 1RC4A 1OHKA 4O1XD 4OR7A 3OB7A 3DG8A 4XT7A 3NZAX 4KL9A 3CL9A 1HW4A 1TSZA 3QG2A 2B3ZA 2G8AA 4HOGA 3JW5A 3QL3A 1NJCA 3TD8A 4XT6A 1JTQA 1BZFA 2FTQA 5H39A 3QLWA 1DG8A 1DYJA 2ANOA 4M6LA 3M09A 1S3VA 3D84X 3EEMA 1HFQA 1TDCA 2JYBA 4IRRA 3DAUA 3NXYA 3LG4A 3S9UA 4KEBA 5FCTA 4ISKA 5HS3A 3QLXA 1E26A 2BBQA 1DDUA 5HI6A 3FRFX 1DR4A 1RTSA 4PSSA 1DHFA 1SYNA 2INQA 4FHBA 1DR5A 2W9SA 1J3KC 4H97A 4QI9A 3DFRA 3TMSA 3IK0A 1RA3A 4KJJA 5E8QA 3NRRA 4M6KA 1J3IA 1VZAA 4KAKA 4KY4A 4O1XA 4Q0DA 1D1GA 5HT5A 1J3JC 4P66A 4XSCA 4XSDA 3HBBA 4G2OX 3KJRA 4HOFA 3N5EA 2W9HA 4IQQA 1RG7A 3EBUA 3NZ9X 4KLXA 5CCCA 4XSEA 3EF9A 4KNEA 1DG7A 4CD2A 1VZBA 3QYLA 1QZFA 1TSXA 1DR3A 4IXGX 3RO9A 5DXVA 1S3UA 1JOLA 4X5IA 3HJ3A 3SRRX 1DYIA 2FZIA 1B5DA 4ELGA 1EVFA 3NZCX 1AJMA 4IXED 4FGHA 1HFPA 1TVVA 1BKOA 3DL5A 2TDMA 3JTWA 1DR7A 4KJLA 1BSPA 2DRCA 4EINA 2ITHA 1F4FA 3SQYX 3H9KA 1TRGA 1ZPRA 1TSYA 3QLSA 4DDRA 3FYVX 2OIPA 4LRRA 3SH2A 3BGXA 5U27A 3NTZA 4HA7A 4XT4A 1NJAA 1KZJA 5J7WA 1RF7A 2ONBA 3NXRA 3TQAA 3F8YA 3F8ZA 4GH8A 4QHVA 1TLCA 4H98A 4XT5A 1AXWA 4PSYA 3KJSA 2RD8B 1F4CA 3FL9A 4QJZD 3V8HA 3S3VA 1AN5A 5HQZA 5BY6A 2OBCA 4H95A 4X5HA 5CC9A 3L3RA 4GEVA 3BHRA 1THYA 1TSMA 1YPVA 3INVA 4O7UA 1HFRA 2W3VA 1U72A 5ECCA 2BL9A 3K2HA 1AIQA 4HA9A 4PSGA 3FQVA 1OHJA 4E28A 4LAEX 4KNZA 3ZPGA 1DREA 3B9HA 1DYHA 1LY3A 2BLAA 3QLYA 1VDRA 4NX6A 1CI7A 4QLEA 3GHVA 3JVXA 4XE6X 1BO8A 1TISA 5FDAA 3JWKA 4FQSA 4DPHA 1TSDA 1M78A 3TQ9A 3SAIA 5HUIA 1U70A 5HVEA 4XECX 3QYOA 4OSGA 1HZWA 3GI2A 2TDDA 3IA5A 7DFRA 1PD8A 1IA4A 3NXTA 1VZCA 1AO8A 4G6WX 1RX6A 3OCHA 2VF0A 4P3RA 1TLSA 1B49A 2D0KA 3CSEA 4EJ1A 1TSNA 4TU5X 4Q0EA 1BDUA 3K45A 3IHIA 3UWLA 4Q6AA 4H0UA 1DRAA 4G8ZX 3FL8A 4HOEA 2QK8A 3SRWX 4DQ1A 2W3WA 1HW3A 2FTOX 3BYXA 3F0BX 5HT4A 1TSWA 2XW7A 1DRHA
chains in the Genus database with same CATH superfamily
1RH3A 4XRBA 5JA3A 1AOEA 2BLCA 4FGTA 2AZNA 1B02A 3NXXA 5JG0X 3IA4A 3DL6A 3GG5A 3NZBX 1F4BA 4LAHX 5HSUA 3SRUX 1SEJA 1LCEA 2O7PA 3FQCA 4EIGA 1CD2A 1TDBA 3KY8A 3Q1HA 1IA2A 4EIZA 3N5EB 4G3MA 3ED7A 1RX9A 3KGYA 3ROAA 4FOGA 1QQQA 1JMGA 2D5NA 4ELFA 4KM0A 1VJ3A 4M7VA 2RDAA 4ISWA 3HB8A 1JG0A 1DDRA 2GD9A 1TVUA 3F0SX 1KLKA 2G86A 4Q67A 4I1NA 2FZJA 4QLFA 3EJLA 1EV8A 1IA3A 1RX1A 4M6JA 2HXVA 1RE7A 4FGGA 3JSUA 1LCAA 1J3KA 1ZDRA 1TVWA 3I3RA 1PD9A 4F2VA 1HVYA 1BP0A 1BOZA 3BNZA 1DR2A 3DGAC 3N5GA 1DLSA 1RA9A 1J3JA 1JMIA 4FOAA 1MVSA 3SR5X 3IX6A 3EGYX 4TMSA 1TSVA 5U26A 5HSRA 1NJEA 1S3YA 3IJZA 4X5JA 1LUDA 4P3QA 8DFRA 1RX5A 4PTJA 4IQBA 1BIDA 4GD7A 6DFRA 2CIGA 3IK1A 3EEJA 1TDAA 4X5FA 4UP1A 2FTNA 2P4GA 4QLGA 3GH0A 3DG8C 4GYHA 1AI9A 3JWMA 4LEKX 3QFXA 4ELEA 1BPJA 1DF7A 1NCEA 4M2XA 1LCBA 3JW3A 2TSCA 2CD2A 5WRNA 3NXVA 2LF1A 3QLRA 4KD7A 1JUTA 2TSRA 4DPDA 1NJBA 2W3AA 4FOXA 1KZIA 1DLRA 1I00A 3DGAA 1M79A 3VCOA 2KCEA 1FFLA 4EILA 1VZEA 4ELBA 1DIUA 2G8XA 1M7AA 4E5OA 1IA1A 1DDSA 2AAZA 3FYWX 3N0HA 3UM6A 1PDBA 4KBNA 3GHWA 1JMHA 3SA1A 1LY4A 3FRDX 4LAGX 5HF0X 3BHLA 4QJCA 1J3IC 3DRCA 1AOBA 3BFIA 2W3BA 2HM9A 4ECKA 3EX8A 3FQZA 4H96A 3EEKA 2G6VA 1RA8A 3UM5A 2C2TA 3S7AA 1JOMA 4JEFA 1F4DA 4O1UA 5EAJA 1BQ2A 3FQOA 5HQYA 1JU6A 1EVGA 1RA1A 3SA2A 3DATA 3IROA 1TDRA 3ZPCA 5DFRA 3IRNA 1KMSA 1YHOA 2W9TA 3UWLB 3FY9X 3NZ6X 4EB4A 5H3AA 1JUJA 1RB2A 3F91A 3IX9A 4H0RA 2VETA 4EZ8A 3RG9A 4KYAA 1DHIA 3TQ8A 3M08A 3CD2A 1RD7A 1CZ3A 5H38A 3SRSX 2G89A 1KMVA 2HQPA 4PDJA 4KM2A 1F28A 4PSTA 3JWCA 3UM8A 3KGBA 1F4GA 3EHIX 1RX7A 4M7UA 1DRFA 1MVTA 3F0QX 2KGKA 1BQ1A 1BJGA 2C2SA 3QLZA 1B5EA 1RB3A 2G8DA 3QL0A 3NU0A 4XT8A 1RA2A 2H2QA 3FQ0A 4P68A 1TDUA 3SGYA 1EV5A 3EELA 2DHFA 3GH2X 1DYRA 1DRBA 1JTUA 4KFJA 4X5GA 4H1IA 3EDWX 3C06A 1RX3A 3NXOA 3FS6A 4RGCA 1BSFA 3FRBX 2W9GA 1TJSA 1BKPA 4PTHA 1RX4A 1DISA 4NX7A 1JUVA 3F0VX 3R33A 3KFYA 3C0AA 5HVBA 4KJKA 3EIGA 1DAJA 4DP3A 1DHJA 1DG5A 2FZHA 2ZZAA 2W3MA 2A9WA 1BP6A 3FRAX 3D80A 4DFRA 5ECXA 1FWMA 1TYSA 2RD8A 1DR6A 4ELHA 3E0BA 1S3WA 1KCEA 3I8AX 1RX2A 3BZ0A 1NJDA 3GHCA 2BLBA 3TQBA 3FY8X 1VZDA 3JWFA 4G95A 3F0UX 1F4EA 3EAWX 1JMFA 3QJ7A 3B5BA 3K47A 4IXFX 1RX8A 4KPWA 1U71A 1BO7A 2L28A 3QGTA 2ANQA 3OAFA 5HF2X 1TSLA 3SRQX 3FREX 5HPBA 3IRMA 3CLBA 1DR1A 3NZDA 3K74A 4I13A 4KY8A 3F0XX 3GYFA 3FQFA 1DNAA 1RC4A 1OHKA 4O1XD 4OR7A 3OB7A 3DG8A 4XT7A 3NZAX 4KL9A 3CL9A 1HW4A 1TSZA 3QG2A 2B3ZA 2G8AA 4HOGA 3JW5A 3QL3A 1NJCA 3TD8A 4XT6A 1JTQA 1BZFA 2FTQA 5H39A 3QLWA 1DG8A 1DYJA 2ANOA 4M6LA 3M09A 1S3VA 3D84X 3EEMA 1HFQA 1TDCA 2JYBA 4IRRA 3DAUA 3NXYA 3LG4A 3S9UA 4KEBA 5FCTA 4ISKA 5HS3A 3QLXA 1E26A 2BBQA 1DDUA 5HI6A 3FRFX 1DR4A 1RTSA 4PSSA 1DHFA 1SYNA 2INQA 4FHBA 1DR5A 2W9SA 1J3KC 4H97A 4QI9A 3DFRA 3TMSA 3IK0A 1RA3A 4KJJA 5E8QA 3NRRA 4M6KA 1J3IA 1VZAA 4KAKA 4KY4A 4O1XA 4Q0DA 1D1GA 5HT5A 1J3JC 4P66A 4XSCA 4XSDA 3HBBA 4G2OX 3KJRA 4HOFA 3N5EA 2W9HA 4IQQA 1RG7A 3EBUA 3NZ9X 4KLXA 5CCCA 4XSEA 3EF9A 4KNEA 1DG7A 4CD2A 1VZBA 3QYLA 1QZFA 1TSXA 1DR3A 4IXGX 3RO9A 5DXVA 1S3UA 1JOLA 4X5IA 3HJ3A 3SRRX 1DYIA 2FZIA 1B5DA 4ELGA 1EVFA 3NZCX 1AJMA 4IXED 4FGHA 1HFPA 1TVVA 1BKOA 3DL5A 2TDMA 3JTWA 1DR7A 4KJLA 1BSPA 2DRCA 4EINA 2ITHA 1F4FA 3SQYX 3H9KA 1TRGA 1ZPRA 1TSYA 3QLSA 4DDRA 3FYVX 2OIPA 4LRRA 3SH2A 3BGXA 5U27A 3NTZA 4HA7A 4XT4A 1NJAA 1KZJA 5J7WA 1RF7A 2ONBA 3NXRA 3TQAA 3F8YA 3F8ZA 4GH8A 4QHVA 1TLCA 4H98A 4XT5A 1AXWA 4PSYA 3KJSA 2RD8B 1F4CA 3FL9A 4QJZD 3V8HA 3S3VA 1AN5A 5HQZA 5BY6A 2OBCA 4H95A 4X5HA 5CC9A 3L3RA 4GEVA 3BHRA 1THYA 1TSMA 1YPVA 3INVA 4O7UA 1HFRA 2W3VA 1U72A 5ECCA 2BL9A 3K2HA 1AIQA 4HA9A 4PSGA 3FQVA 1OHJA 4E28A 4LAEX 4KNZA 3ZPGA 1DREA 3B9HA 1DYHA 1LY3A 2BLAA 3QLYA 1VDRA 4NX6A 1CI7A 4QLEA 3GHVA 3JVXA 4XE6X 1BO8A 1TISA 5FDAA 3JWKA 4FQSA 4DPHA 1TSDA 1M78A 3TQ9A 3SAIA 5HUIA 1U70A 5HVEA 4XECX 3QYOA 4OSGA 1HZWA 3GI2A 2TDDA 3IA5A 7DFRA 1PD8A 1IA4A 3NXTA 1VZCA 1AO8A 4G6WX 1RX6A 3OCHA 2VF0A 4P3RA 1TLSA 1B49A 2D0KA 3CSEA 4EJ1A 1TSNA 4TU5X 4Q0EA 1BDUA 3K45A 3IHIA 3UWLA 4Q6AA 4H0UA 1DRAA 4G8ZX 3FL8A 4HOEA 2QK8A 3SRWX 4DQ1A 2W3WA 1HW3A 2FTOX 3BYXA 3F0BX 5HT4A 1TSWA 2XW7A 1DRHA
chains in the Genus database with same CATH topology
1RH3A 4XRBA 5JA3A 1AOEA 2BLCA 4FGTA 2AZNA 1B02A 3NXXA 5JG0X 3IA4A 3DL6A 3GG5A 3NZBX 1F4BA 4LAHX 5HSUA 3SRUX 1SEJA 1LCEA 2O7PA 3FQCA 4EIGA 1CD2A 1TDBA 3KY8A 3Q1HA 1IA2A 4EIZA 3N5EB 4G3MA 3ED7A 1RX9A 3KGYA 3ROAA 4FOGA 1QQQA 1JMGA 2D5NA 4ELFA 4KM0A 1VJ3A 4M7VA 2RDAA 4ISWA 3HB8A 1JG0A 1DDRA 2GD9A 1TVUA 3F0SX 1KLKA 2G86A 4Q67A 4I1NA 2FZJA 4QLFA 3EJLA 1EV8A 1IA3A 1RX1A 4M6JA 2HXVA 1RE7A 4FGGA 3JSUA 1LCAA 1J3KA 1ZDRA 1TVWA 3I3RA 1PD9A 4F2VA 1HVYA 1BP0A 1BOZA 3BNZA 1DR2A 3DGAC 3N5GA 1DLSA 1RA9A 1J3JA 1JMIA 4FOAA 1MVSA 3SR5X 3IX6A 3EGYX 4TMSA 1TSVA 5U26A 5HSRA 1NJEA 1S3YA 3IJZA 4X5JA 1LUDA 4P3QA 8DFRA 1RX5A 4PTJA 4IQBA 1BIDA 4GD7A 6DFRA 2CIGA 3IK1A 3EEJA 1TDAA 4X5FA 4UP1A 2FTNA 2P4GA 4QLGA 3GH0A 3DG8C 4GYHA 1AI9A 3JWMA 4LEKX 3QFXA 4ELEA 1BPJA 1DF7A 1NCEA 4M2XA 1LCBA 3JW3A 2TSCA 2CD2A 5WRNA 3NXVA 2LF1A 3QLRA 4KD7A 1JUTA 2TSRA 4DPDA 1NJBA 2W3AA 4FOXA 1KZIA 1DLRA 1I00A 3DGAA 1M79A 3VCOA 2KCEA 1FFLA 4EILA 1VZEA 4ELBA 1DIUA 2G8XA 1M7AA 4E5OA 1IA1A 1DDSA 2AAZA 3FYWX 3N0HA 3UM6A 1PDBA 4KBNA 3GHWA 1JMHA 3SA1A 1LY4A 3FRDX 4LAGX 5HF0X 3BHLA 4QJCA 1J3IC 3DRCA 1AOBA 3BFIA 2W3BA 2HM9A 4ECKA 3EX8A 3FQZA 4H96A 3EEKA 2G6VA 1RA8A 3UM5A 2C2TA 3S7AA 1JOMA 4JEFA 1F4DA 4O1UA 5EAJA 1BQ2A 3FQOA 5HQYA 1JU6A 1EVGA 1RA1A 3SA2A 3DATA 3IROA 1TDRA 3ZPCA 5DFRA 3IRNA 1KMSA 1YHOA 2W9TA 3UWLB 3FY9X 3NZ6X 4EB4A 5H3AA 1JUJA 1RB2A 3F91A 3IX9A 4H0RA 2VETA 4EZ8A 3RG9A 4KYAA 1DHIA 3TQ8A 3M08A 3CD2A 1RD7A 1CZ3A 5H38A 3SRSX 2G89A 1KMVA 2HQPA 4PDJA 4KM2A 1F28A 4PSTA 3JWCA 3UM8A 3KGBA 1F4GA 3EHIX 1RX7A 4M7UA 1DRFA 1MVTA 3F0QX 2KGKA 1BQ1A 1BJGA 2C2SA 3QLZA 1B5EA 1RB3A 2G8DA 3QL0A 3NU0A 4XT8A 1RA2A 2H2QA 3FQ0A 4P68A 1TDUA 3SGYA 1EV5A 3EELA 2DHFA 3GH2X 1DYRA 1DRBA 1JTUA 4KFJA 4X5GA 4H1IA 3EDWX 3C06A 1RX3A 3NXOA 3FS6A 4RGCA 1BSFA 3FRBX 2W9GA 1TJSA 1BKPA 4PTHA 1RX4A 1DISA 4NX7A 1JUVA 3F0VX 3R33A 3KFYA 3C0AA 5HVBA 4KJKA 3EIGA 1DAJA 4DP3A 1DHJA 1DG5A 2FZHA 2ZZAA 2W3MA 2A9WA 1BP6A 3FRAX 3D80A 4DFRA 5ECXA 1FWMA 1TYSA 2RD8A 1DR6A 4ELHA 3E0BA 1S3WA 1KCEA 3I8AX 1RX2A 3BZ0A 1NJDA 3GHCA 2BLBA 3TQBA 3FY8X 1VZDA 3JWFA 4G95A 3F0UX 1F4EA 3EAWX 1JMFA 3QJ7A 3B5BA 3K47A 4IXFX 1RX8A 4KPWA 1U71A 1BO7A 2L28A 3QGTA 2ANQA 3OAFA 5HF2X 1TSLA 3SRQX 3FREX 5HPBA 3IRMA 3CLBA 1DR1A 3NZDA 3K74A 4I13A 4KY8A 3F0XX 3GYFA 3FQFA 1DNAA 1RC4A 1OHKA 4O1XD 4OR7A 3OB7A 3DG8A 4XT7A 3NZAX 4KL9A 3CL9A 1HW4A 1TSZA 3QG2A 2B3ZA 2G8AA 4HOGA 3JW5A 3QL3A 1NJCA 3TD8A 4XT6A 1JTQA 1BZFA 2FTQA 5H39A 3QLWA 1DG8A 1DYJA 2ANOA 4M6LA 3M09A 1S3VA 3D84X 3EEMA 1HFQA 1TDCA 2JYBA 4IRRA 3DAUA 3NXYA 3LG4A 3S9UA 4KEBA 5FCTA 4ISKA 5HS3A 3QLXA 1E26A 2BBQA 1DDUA 5HI6A 3FRFX 1DR4A 1RTSA 4PSSA 1DHFA 1SYNA 2INQA 4FHBA 1DR5A 2W9SA 1J3KC 4H97A 4QI9A 3DFRA 3TMSA 3IK0A 1RA3A 4KJJA 5E8QA 3NRRA 4M6KA 1J3IA 1VZAA 4KAKA 4KY4A 4O1XA 4Q0DA 1D1GA 5HT5A 1J3JC 4P66A 4XSCA 4XSDA 3HBBA 4G2OX 3KJRA 4HOFA 3N5EA 2W9HA 4IQQA 1RG7A 3EBUA 3NZ9X 4KLXA 5CCCA 4XSEA 3EF9A 4KNEA 1DG7A 4CD2A 1VZBA 3QYLA 1QZFA 1TSXA 1DR3A 4IXGX 3RO9A 5DXVA 1S3UA 1JOLA 4X5IA 3HJ3A 3SRRX 1DYIA 2FZIA 1B5DA 4ELGA 1EVFA 3NZCX 1AJMA 4IXED 4FGHA 1HFPA 1TVVA 1BKOA 3DL5A 2TDMA 3JTWA 1DR7A 4KJLA 1BSPA 2DRCA 4EINA 2ITHA 1F4FA 3SQYX 3H9KA 1TRGA 1ZPRA 1TSYA 3QLSA 4DDRA 3FYVX 2OIPA 4LRRA 3SH2A 3BGXA 5U27A 3NTZA 4HA7A 4XT4A 1NJAA 1KZJA 5J7WA 1RF7A 2ONBA 3NXRA 3TQAA 3F8YA 3F8ZA 4GH8A 4QHVA 1TLCA 4H98A 4XT5A 1AXWA 4PSYA 3KJSA 2RD8B 1F4CA 3FL9A 4QJZD 3V8HA 3S3VA 1AN5A 5HQZA 5BY6A 2OBCA 4H95A 4X5HA 5CC9A 3L3RA 4GEVA 3BHRA 1THYA 1TSMA 1YPVA 3INVA 4O7UA 1HFRA 2W3VA 1U72A 5ECCA 2BL9A 3K2HA 1AIQA 4HA9A 4PSGA 3FQVA 1OHJA 4E28A 4LAEX 4KNZA 3ZPGA 1DREA 3B9HA 1DYHA 1LY3A 2BLAA 3QLYA 1VDRA 4NX6A 1CI7A 4QLEA 3GHVA 3JVXA 4XE6X 1BO8A 1TISA 5FDAA 3JWKA 4FQSA 4DPHA 1TSDA 1M78A 3TQ9A 3SAIA 5HUIA 1U70A 5HVEA 4XECX 3QYOA 4OSGA 1HZWA 3GI2A 2TDDA 3IA5A 7DFRA 1PD8A 1IA4A 3NXTA 1VZCA 1AO8A 4G6WX 1RX6A 3OCHA 2VF0A 4P3RA 1TLSA 1B49A 2D0KA 3CSEA 4EJ1A 1TSNA 4TU5X 4Q0EA 1BDUA 3K45A 3IHIA 3UWLA 4Q6AA 4H0UA 1DRAA 4G8ZX 3FL8A 4HOEA 2QK8A 3SRWX 4DQ1A 2W3WA 1HW3A 2FTOX 3BYXA 3F0BX 5HT4A 1TSWA 2XW7A 1DRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RH3 A;  4XRB A;  5JA3 A;  1AOE A;  2BLC A;  4FGT A;  2AZN A;  1B02 A;  3NXX A;  5JG0 X;  3IA4 A;  3DL6 A;  3GG5 A;  3NZB X;  1F4B A;  4LAH X;  5HSU A;  3SRU X;  1SEJ A;  1LCE A;  2O7P A;  3FQC A;  4EIG A;  1CD2 A;  1TDB A;  3KY8 A;  3Q1H A;  1IA2 A;  4EIZ A;  3N5E B;  4G3M A;  3ED7 A;  1RX9 A;  3KGY A;  3ROA A;  4FOG A;  1QQQ A;  1JMG A;  2D5N A;  4ELF A;  4KM0 A;  1VJ3 A;  4M7V A;  2RDA A;  4ISW A;  3HB8 A;  1JG0 A;  1DDR A;  2GD9 A;  1TVU A;  3F0S X;  1KLK A;  2G86 A;  4Q67 A;  4I1N A;  2FZJ A;  4QLF A;  3EJL A;  1EV8 A;  1IA3 A;  1RX1 A;  4M6J A;  2HXV A;  1RE7 A;  4FGG A;  3JSU A;  1LCA A;  1J3K A;  1ZDR A;  1TVW A;  3I3R A;  1PD9 A;  4F2V A;  1HVY A;  1BP0 A;  1BOZ A;  3BNZ A;  1DR2 A;  3DGA C;  3N5G A;  1DLS A;  1RA9 A;  1J3J A;  1JMI A;  4FOA A;  1MVS A;  3SR5 X;  3IX6 A;  3EGY X;  4TMS A;  1TSV A;  5U26 A;  5HSR A;  1NJE A;  1S3Y A;  3IJZ A;  4X5J A;  1LUD A;  4P3Q A;  8DFR A;  1RX5 A;  4PTJ A;  4IQB A;  1BID A;  4GD7 A;  6DFR A;  2CIG A;  3IK1 A;  3EEJ A;  1TDA A;  4X5F A;  4UP1 A;  2FTN A;  2P4G A;  4QLG A;  3GH0 A;  3DG8 C;  4GYH A;  1AI9 A;  3JWM A;  4LEK X;  3QFX A;  4ELE A;  1BPJ A;  1DF7 A;  1NCE A;  4M2X A;  1LCB A;  3JW3 A;  2TSC A;  2CD2 A;  5WRN A;  3NXV A;  2LF1 A;  3QLR A;  4KD7 A;  1JUT A;  2TSR A;  4DPD A;  1NJB A;  2W3A A;  4FOX A;  1KZI A;  1DLR A;  1I00 A;  3DGA A;  1M79 A;  3VCO A;  2KCE A;  1FFL A;  4EIL A;  1VZE A;  4ELB A;  1DIU A;  2G8X A;  1M7A A;  4E5O A;  1IA1 A;  1DDS A;  2AAZ A;  3FYW X;  3N0H A;  3UM6 A;  1PDB A;  4KBN A;  3GHW A;  1JMH A;  3SA1 A;  1LY4 A;  3FRD X;  4LAG X;  5HF0 X;  3BHL A;  4QJC A;  1J3I C;  3DRC A;  1AOB A;  3BFI A;  2W3B A;  2HM9 A;  4ECK A;  3EX8 A;  3FQZ A;  4H96 A;  3EEK A;  2G6V A;  1RA8 A;  3UM5 A;  2C2T A;  3S7A A;  1JOM A;  4JEF A;  1F4D A;  4O1U A;  5EAJ A;  1BQ2 A;  3FQO A;  5HQY A;  1JU6 A;  1EVG A;  1RA1 A;  3SA2 A;  3DAT A;  3IRO A;  1TDR A;  3ZPC A;  5DFR A;  3IRN A;  1KMS A;  1YHO A;  2W9T A;  3UWL B;  3FY9 X;  3NZ6 X;  4EB4 A;  5H3A A;  1JUJ A;  1RB2 A;  3F91 A;  3IX9 A;  4H0R A;  2VET A;  4EZ8 A;  3RG9 A;  4KYA A;  1DHI A;  3TQ8 A;  3M08 A;  3CD2 A;  1RD7 A;  1CZ3 A;  5H38 A;  3SRS X;  2G89 A;  1KMV A;  2HQP A;  4PDJ A;  4KM2 A;  1F28 A;  4PST A;  3JWC A;  3UM8 A;  3KGB A;  1F4G A;  3EHI X;  1RX7 A;  4M7U A;  1DRF A;  1MVT A;  3F0Q X;  2KGK A;  1BQ1 A;  1BJG A;  2C2S A;  3QLZ A;  1B5E A;  1RB3 A;  2G8D A;  3QL0 A;  3NU0 A;  4XT8 A;  1RA2 A;  2H2Q A;  3FQ0 A;  4P68 A;  1TDU A;  3SGY A;  1EV5 A;  3EEL A;  2DHF A;  3GH2 X;  1DYR A;  1DRB A;  1JTU A;  4KFJ A;  4X5G A;  4H1I A;  3EDW X;  3C06 A;  1RX3 A;  3NXO A;  3FS6 A;  4RGC A;  1BSF A;  3FRB X;  2W9G A;  1TJS A;  1BKP A;  4PTH A;  1RX4 A;  1DIS A;  4NX7 A;  1JUV A;  3F0V X;  3R33 A;  3KFY A;  3C0A A;  5HVB A;  4KJK A;  3EIG A;  1DAJ A;  4DP3 A;  1DHJ A;  1DG5 A;  2FZH A;  2ZZA A;  2W3M A;  2A9W A;  1BP6 A;  3FRA X;  3D80 A;  4DFR A;  5ECX A;  1FWM A;  1TYS A;  2RD8 A;  1DR6 A;  4ELH A;  3E0B A;  1S3W A;  1KCE A;  3I8A X;  1RX2 A;  3BZ0 A;  1NJD A;  3GHC A;  2BLB A;  3TQB A;  3FY8 X;  1VZD A;  3JWF A;  4G95 A;  3F0U X;  1F4E A;  3EAW X;  1JMF A;  3QJ7 A;  3B5B A;  3K47 A;  4IXF X;  1RX8 A;  4KPW A;  1U71 A;  1BO7 A;  2L28 A;  3QGT A;  2ANQ A;  3OAF A;  5HF2 X;  1TSL A;  3SRQ X;  3FRE X;  5HPB A;  3IRM A;  3CLB A;  1DR1 A;  3NZD A;  3K74 A;  4I13 A;  4KY8 A;  3F0X X;  3GYF A;  3FQF A;  1DNA A;  1RC4 A;  1OHK A;  4O1X D;  4OR7 A;  3OB7 A;  3DG8 A;  4XT7 A;  3NZA X;  4KL9 A;  3CL9 A;  1HW4 A;  1TSZ A;  3QG2 A;  2B3Z A;  2G8A A;  4HOG A;  3JW5 A;  3QL3 A;  1NJC A;  3TD8 A;  4XT6 A;  1JTQ A;  1BZF A;  2FTQ A;  5H39 A;  3QLW A;  1DG8 A;  1DYJ A;  2ANO A;  4M6L A;  3M09 A;  1S3V A;  3D84 X;  3EEM A;  1HFQ A;  1TDC A;  2JYB A;  4IRR A;  3DAU A;  3NXY A;  3LG4 A;  3S9U A;  4KEB A;  5FCT A;  4ISK A;  5HS3 A;  3QLX A;  1E26 A;  2BBQ A;  1DDU A;  5HI6 A;  3FRF X;  1DR4 A;  1RTS A;  4PSS A;  1DHF A;  1SYN A;  2INQ A;  4FHB A;  1DR5 A;  2W9S A;  1J3K C;  4H97 A;  4QI9 A;  3DFR A;  3TMS A;  3IK0 A;  1RA3 A;  4KJJ A;  5E8Q A;  3NRR A;  4M6K A;  1J3I A;  1VZA A;  4KAK A;  4KY4 A;  4O1X A;  4Q0D A;  1D1G A;  5HT5 A;  1J3J C;  4P66 A;  4XSC A;  4XSD A;  3HBB A;  4G2O X;  3KJR A;  4HOF A;  3N5E A;  2W9H A;  4IQQ A;  1RG7 A;  3EBU A;  3NZ9 X;  4KLX A;  5CCC A;  4XSE A;  3EF9 A;  4KNE A;  1DG7 A;  4CD2 A;  1VZB A;  3QYL A;  1QZF A;  1TSX A;  1DR3 A;  4IXG X;  3RO9 A;  5DXV A;  1S3U A;  1JOL A;  4X5I A;  3HJ3 A;  3SRR X;  1DYI A;  2FZI A;  1B5D A;  4ELG A;  1EVF A;  3NZC X;  1AJM A;  4IXE D;  4FGH A;  1HFP A;  1TVV A;  1BKO A;  3DL5 A;  2TDM A;  3JTW A;  1DR7 A;  4KJL A;  1BSP A;  2DRC A;  4EIN A;  2ITH A;  1F4F A;  3SQY X;  3H9K A;  1TRG A;  1ZPR A;  1TSY A;  3QLS A;  4DDR A;  3FYV X;  2OIP A;  4LRR A;  3SH2 A;  3BGX A;  5U27 A;  3NTZ A;  4HA7 A;  4XT4 A;  1NJA A;  1KZJ A;  5J7W A;  1RF7 A;  2ONB A;  3NXR A;  3TQA A;  3F8Y A;  3F8Z A;  4GH8 A;  4QHV A;  1TLC A;  4H98 A;  4XT5 A;  1AXW A;  4PSY A;  3KJS A;  2RD8 B;  1F4C A;  3FL9 A;  4QJZ D;  3V8H A;  3S3V A;  1AN5 A;  5HQZ A;  5BY6 A;  2OBC A;  4H95 A;  4X5H A;  5CC9 A;  3L3R A;  4GEV A;  3BHR A;  1THY A;  1TSM A;  1YPV A;  3INV A;  4O7U A;  1HFR A;  2W3V A;  1U72 A;  5ECC A;  2BL9 A;  3K2H A;  1AIQ A;  4HA9 A;  4PSG A;  3FQV A;  1OHJ A;  4E28 A;  4LAE X;  4KNZ A;  3ZPG A;  1DRE A;  3B9H A;  1DYH A;  1LY3 A;  2BLA A;  3QLY A;  1VDR A;  4NX6 A;  1CI7 A;  4QLE A;  3GHV A;  3JVX A;  4XE6 X;  1BO8 A;  1TIS A;  5FDA A;  3JWK A;  4FQS A;  4DPH A;  1TSD A;  1M78 A;  3TQ9 A;  3SAI A;  5HUI A;  1U70 A;  5HVE A;  4XEC X;  3QYO A;  4OSG A;  1HZW A;  3GI2 A;  2TDD A;  3IA5 A;  7DFR A;  1PD8 A;  1IA4 A;  3NXT A;  1VZC A;  1AO8 A;  4G6W X;  1RX6 A;  3OCH A;  2VF0 A;  4P3R A;  1TLS A;  1B49 A;  2D0K A;  3CSE A;  4EJ1 A;  1TSN A;  4TU5 X;  4Q0E A;  1BDU A;  3K45 A;  3IHI A;  3UWL A;  4Q6A A;  4H0U A;  1DRA A;  4G8Z X;  3FL8 A;  4HOE A;  2QK8 A;  3SRW X;  4DQ1 A;  2W3W A;  1HW3 A;  2FTO X;  3BYX A;  3F0B X;  5HT4 A;  1TSW A;  2XW7 A;  1DRH A; 
#chains in the Genus database with same CATH topology
 1RH3 A;  4XRB A;  5JA3 A;  1AOE A;  2BLC A;  4FGT A;  2AZN A;  1B02 A;  3NXX A;  5JG0 X;  3IA4 A;  3DL6 A;  3GG5 A;  3NZB X;  1F4B A;  4LAH X;  5HSU A;  3SRU X;  1SEJ A;  1LCE A;  2O7P A;  3FQC A;  4EIG A;  1CD2 A;  1TDB A;  3KY8 A;  3Q1H A;  1IA2 A;  4EIZ A;  3N5E B;  4G3M A;  3ED7 A;  1RX9 A;  3KGY A;  3ROA A;  4FOG A;  1QQQ A;  1JMG A;  2D5N A;  4ELF A;  4KM0 A;  1VJ3 A;  4M7V A;  2RDA A;  4ISW A;  3HB8 A;  1JG0 A;  1DDR A;  2GD9 A;  1TVU A;  3F0S X;  1KLK A;  2G86 A;  4Q67 A;  4I1N A;  2FZJ A;  4QLF A;  3EJL A;  1EV8 A;  1IA3 A;  1RX1 A;  4M6J A;  2HXV A;  1RE7 A;  4FGG A;  3JSU A;  1LCA A;  1J3K A;  1ZDR A;  1TVW A;  3I3R A;  1PD9 A;  4F2V A;  1HVY A;  1BP0 A;  1BOZ A;  3BNZ A;  1DR2 A;  3DGA C;  3N5G A;  1DLS A;  1RA9 A;  1J3J A;  1JMI A;  4FOA A;  1MVS A;  3SR5 X;  3IX6 A;  3EGY X;  4TMS A;  1TSV A;  5U26 A;  5HSR A;  1NJE A;  1S3Y A;  3IJZ A;  4X5J A;  1LUD A;  4P3Q A;  8DFR A;  1RX5 A;  4PTJ A;  4IQB A;  1BID A;  4GD7 A;  6DFR A;  2CIG A;  3IK1 A;  3EEJ A;  1TDA A;  4X5F A;  4UP1 A;  2FTN A;  2P4G A;  4QLG A;  3GH0 A;  3DG8 C;  4GYH A;  1AI9 A;  3JWM A;  4LEK X;  3QFX A;  4ELE A;  1BPJ A;  1DF7 A;  1NCE A;  4M2X A;  1LCB A;  3JW3 A;  2TSC A;  2CD2 A;  5WRN A;  3NXV A;  2LF1 A;  3QLR A;  4KD7 A;  1JUT A;  2TSR A;  4DPD A;  1NJB A;  2W3A A;  4FOX A;  1KZI A;  1DLR A;  1I00 A;  3DGA A;  1M79 A;  3VCO A;  2KCE A;  1FFL A;  4EIL A;  1VZE A;  4ELB A;  1DIU A;  2G8X A;  1M7A A;  4E5O A;  1IA1 A;  1DDS A;  2AAZ A;  3FYW X;  3N0H A;  3UM6 A;  1PDB A;  4KBN A;  3GHW A;  1JMH A;  3SA1 A;  1LY4 A;  3FRD X;  4LAG X;  5HF0 X;  3BHL A;  4QJC A;  1J3I C;  3DRC A;  1AOB A;  3BFI A;  2W3B A;  2HM9 A;  4ECK A;  3EX8 A;  3FQZ A;  4H96 A;  3EEK A;  2G6V A;  1RA8 A;  3UM5 A;  2C2T A;  3S7A A;  1JOM A;  4JEF A;  1F4D A;  4O1U A;  5EAJ A;  1BQ2 A;  3FQO A;  5HQY A;  1JU6 A;  1EVG A;  1RA1 A;  3SA2 A;  3DAT A;  3IRO A;  1TDR A;  3ZPC A;  5DFR A;  3IRN A;  1KMS A;  1YHO A;  2W9T A;  3UWL B;  3FY9 X;  3NZ6 X;  4EB4 A;  5H3A A;  1JUJ A;  1RB2 A;  3F91 A;  3IX9 A;  4H0R A;  2VET A;  4EZ8 A;  3RG9 A;  4KYA A;  1DHI A;  3TQ8 A;  3M08 A;  3CD2 A;  1RD7 A;  1CZ3 A;  5H38 A;  3SRS X;  2G89 A;  1KMV A;  2HQP A;  4PDJ A;  4KM2 A;  1F28 A;  4PST A;  3JWC A;  3UM8 A;  3KGB A;  1F4G A;  3EHI X;  1RX7 A;  4M7U A;  1DRF A;  1MVT A;  3F0Q X;  2KGK A;  1BQ1 A;  1BJG A;  2C2S A;  3QLZ A;  1B5E A;  1RB3 A;  2G8D A;  3QL0 A;  3NU0 A;  4XT8 A;  1RA2 A;  2H2Q A;  3FQ0 A;  4P68 A;  1TDU A;  3SGY A;  1EV5 A;  3EEL A;  2DHF A;  3GH2 X;  1DYR A;  1DRB A;  1JTU A;  4KFJ A;  4X5G A;  4H1I A;  3EDW X;  3C06 A;  1RX3 A;  3NXO A;  3FS6 A;  4RGC A;  1BSF A;  3FRB X;  2W9G A;  1TJS A;  1BKP A;  4PTH A;  1RX4 A;  1DIS A;  4NX7 A;  1JUV A;  3F0V X;  3R33 A;  3KFY A;  3C0A A;  5HVB A;  4KJK A;  3EIG A;  1DAJ A;  4DP3 A;  1DHJ A;  1DG5 A;  2FZH A;  2ZZA A;  2W3M A;  2A9W A;  1BP6 A;  3FRA X;  3D80 A;  4DFR A;  5ECX A;  1FWM A;  1TYS A;  2RD8 A;  1DR6 A;  4ELH A;  3E0B A;  1S3W A;  1KCE A;  3I8A X;  1RX2 A;  3BZ0 A;  1NJD A;  3GHC A;  2BLB A;  3TQB A;  3FY8 X;  1VZD A;  3JWF A;  4G95 A;  3F0U X;  1F4E A;  3EAW X;  1JMF A;  3QJ7 A;  3B5B A;  3K47 A;  4IXF X;  1RX8 A;  4KPW A;  1U71 A;  1BO7 A;  2L28 A;  3QGT A;  2ANQ A;  3OAF A;  5HF2 X;  1TSL A;  3SRQ X;  3FRE X;  5HPB A;  3IRM A;  3CLB A;  1DR1 A;  3NZD A;  3K74 A;  4I13 A;  4KY8 A;  3F0X X;  3GYF A;  3FQF A;  1DNA A;  1RC4 A;  1OHK A;  4O1X D;  4OR7 A;  3OB7 A;  3DG8 A;  4XT7 A;  3NZA X;  4KL9 A;  3CL9 A;  1HW4 A;  1TSZ A;  3QG2 A;  2B3Z A;  2G8A A;  4HOG A;  3JW5 A;  3QL3 A;  1NJC A;  3TD8 A;  4XT6 A;  1JTQ A;  1BZF A;  2FTQ A;  5H39 A;  3QLW A;  1DG8 A;  1DYJ A;  2ANO A;  4M6L A;  3M09 A;  1S3V A;  3D84 X;  3EEM A;  1HFQ A;  1TDC A;  2JYB A;  4IRR A;  3DAU A;  3NXY A;  3LG4 A;  3S9U A;  4KEB A;  5FCT A;  4ISK A;  5HS3 A;  3QLX A;  1E26 A;  2BBQ A;  1DDU A;  5HI6 A;  3FRF X;  1DR4 A;  1RTS A;  4PSS A;  1DHF A;  1SYN A;  2INQ A;  4FHB A;  1DR5 A;  2W9S A;  1J3K C;  4H97 A;  4QI9 A;  3DFR A;  3TMS A;  3IK0 A;  1RA3 A;  4KJJ A;  5E8Q A;  3NRR A;  4M6K A;  1J3I A;  1VZA A;  4KAK A;  4KY4 A;  4O1X A;  4Q0D A;  1D1G A;  5HT5 A;  1J3J C;  4P66 A;  4XSC A;  4XSD A;  3HBB A;  4G2O X;  3KJR A;  4HOF A;  3N5E A;  2W9H A;  4IQQ A;  1RG7 A;  3EBU A;  3NZ9 X;  4KLX A;  5CCC A;  4XSE A;  3EF9 A;  4KNE A;  1DG7 A;  4CD2 A;  1VZB A;  3QYL A;  1QZF A;  1TSX A;  1DR3 A;  4IXG X;  3RO9 A;  5DXV A;  1S3U A;  1JOL A;  4X5I A;  3HJ3 A;  3SRR X;  1DYI A;  2FZI A;  1B5D A;  4ELG A;  1EVF A;  3NZC X;  1AJM A;  4IXE D;  4FGH A;  1HFP A;  1TVV A;  1BKO A;  3DL5 A;  2TDM A;  3JTW A;  1DR7 A;  4KJL A;  1BSP A;  2DRC A;  4EIN A;  2ITH A;  1F4F A;  3SQY X;  3H9K A;  1TRG A;  1ZPR A;  1TSY A;  3QLS A;  4DDR A;  3FYV X;  2OIP A;  4LRR A;  3SH2 A;  3BGX A;  5U27 A;  3NTZ A;  4HA7 A;  4XT4 A;  1NJA A;  1KZJ A;  5J7W A;  1RF7 A;  2ONB A;  3NXR A;  3TQA A;  3F8Y A;  3F8Z A;  4GH8 A;  4QHV A;  1TLC A;  4H98 A;  4XT5 A;  1AXW A;  4PSY A;  3KJS A;  2RD8 B;  1F4C A;  3FL9 A;  4QJZ D;  3V8H A;  3S3V A;  1AN5 A;  5HQZ A;  5BY6 A;  2OBC A;  4H95 A;  4X5H A;  5CC9 A;  3L3R A;  4GEV A;  3BHR A;  1THY A;  1TSM A;  1YPV A;  3INV A;  4O7U A;  1HFR A;  2W3V A;  1U72 A;  5ECC A;  2BL9 A;  3K2H A;  1AIQ A;  4HA9 A;  4PSG A;  3FQV A;  1OHJ A;  4E28 A;  4LAE X;  4KNZ A;  3ZPG A;  1DRE A;  3B9H A;  1DYH A;  1LY3 A;  2BLA A;  3QLY A;  1VDR A;  4NX6 A;  1CI7 A;  4QLE A;  3GHV A;  3JVX A;  4XE6 X;  1BO8 A;  1TIS A;  5FDA A;  3JWK A;  4FQS A;  4DPH A;  1TSD A;  1M78 A;  3TQ9 A;  3SAI A;  5HUI A;  1U70 A;  5HVE A;  4XEC X;  3QYO A;  4OSG A;  1HZW A;  3GI2 A;  2TDD A;  3IA5 A;  7DFR A;  1PD8 A;  1IA4 A;  3NXT A;  1VZC A;  1AO8 A;  4G6W X;  1RX6 A;  3OCH A;  2VF0 A;  4P3R A;  1TLS A;  1B49 A;  2D0K A;  3CSE A;  4EJ1 A;  1TSN A;  4TU5 X;  4Q0E A;  1BDU A;  3K45 A;  3IHI A;  3UWL A;  4Q6A A;  4H0U A;  1DRA A;  4G8Z X;  3FL8 A;  4HOE A;  2QK8 A;  3SRW X;  4DQ1 A;  2W3W A;  1HW3 A;  2FTO X;  3BYX A;  3F0B X;  5HT4 A;  1TSW A;  2XW7 A;  1DRH A; 
#chains in the Genus database with same CATH homology
 1RH3 A;  4XRB A;  5JA3 A;  1AOE A;  2BLC A;  4FGT A;  2AZN A;  1B02 A;  3NXX A;  5JG0 X;  3IA4 A;  3DL6 A;  3GG5 A;  3NZB X;  1F4B A;  4LAH X;  5HSU A;  3SRU X;  1SEJ A;  1LCE A;  2O7P A;  3FQC A;  4EIG A;  1CD2 A;  1TDB A;  3KY8 A;  3Q1H A;  1IA2 A;  4EIZ A;  3N5E B;  4G3M A;  3ED7 A;  1RX9 A;  3KGY A;  3ROA A;  4FOG A;  1QQQ A;  1JMG A;  2D5N A;  4ELF A;  4KM0 A;  1VJ3 A;  4M7V A;  2RDA A;  4ISW A;  3HB8 A;  1JG0 A;  1DDR A;  2GD9 A;  1TVU A;  3F0S X;  1KLK A;  2G86 A;  4Q67 A;  4I1N A;  2FZJ A;  4QLF A;  3EJL A;  1EV8 A;  1IA3 A;  1RX1 A;  4M6J A;  2HXV A;  1RE7 A;  4FGG A;  3JSU A;  1LCA A;  1J3K A;  1ZDR A;  1TVW A;  3I3R A;  1PD9 A;  4F2V A;  1HVY A;  1BP0 A;  1BOZ A;  3BNZ A;  1DR2 A;  3DGA C;  3N5G A;  1DLS A;  1RA9 A;  1J3J A;  1JMI A;  4FOA A;  1MVS A;  3SR5 X;  3IX6 A;  3EGY X;  4TMS A;  1TSV A;  5U26 A;  5HSR A;  1NJE A;  1S3Y A;  3IJZ A;  4X5J A;  1LUD A;  4P3Q A;  8DFR A;  1RX5 A;  4PTJ A;  4IQB A;  1BID A;  4GD7 A;  6DFR A;  2CIG A;  3IK1 A;  3EEJ A;  1TDA A;  4X5F A;  4UP1 A;  2FTN A;  2P4G A;  4QLG A;  3GH0 A;  3DG8 C;  4GYH A;  1AI9 A;  3JWM A;  4LEK X;  3QFX A;  4ELE A;  1BPJ A;  1DF7 A;  1NCE A;  4M2X A;  1LCB A;  3JW3 A;  2TSC A;  2CD2 A;  5WRN A;  3NXV A;  2LF1 A;  3QLR A;  4KD7 A;  1JUT A;  2TSR A;  4DPD A;  1NJB A;  2W3A A;  4FOX A;  1KZI A;  1DLR A;  1I00 A;  3DGA A;  1M79 A;  3VCO A;  2KCE A;  1FFL A;  4EIL A;  1VZE A;  4ELB A;  1DIU A;  2G8X A;  1M7A A;  4E5O A;  1IA1 A;  1DDS A;  2AAZ A;  3FYW X;  3N0H A;  3UM6 A;  1PDB A;  4KBN A;  3GHW A;  1JMH A;  3SA1 A;  1LY4 A;  3FRD X;  4LAG X;  5HF0 X;  3BHL A;  4QJC A;  1J3I C;  3DRC A;  1AOB A;  3BFI A;  2W3B A;  2HM9 A;  4ECK A;  3EX8 A;  3FQZ A;  4H96 A;  3EEK A;  2G6V A;  1RA8 A;  3UM5 A;  2C2T A;  3S7A A;  1JOM A;  4JEF A;  1F4D A;  4O1U A;  5EAJ A;  1BQ2 A;  3FQO A;  5HQY A;  1JU6 A;  1EVG A;  1RA1 A;  3SA2 A;  3DAT A;  3IRO A;  1TDR A;  3ZPC A;  5DFR A;  3IRN A;  1KMS A;  1YHO A;  2W9T A;  3UWL B;  3FY9 X;  3NZ6 X;  4EB4 A;  5H3A A;  1JUJ A;  1RB2 A;  3F91 A;  3IX9 A;  4H0R A;  2VET A;  4EZ8 A;  3RG9 A;  4KYA A;  1DHI A;  3TQ8 A;  3M08 A;  3CD2 A;  1RD7 A;  1CZ3 A;  5H38 A;  3SRS X;  2G89 A;  1KMV A;  2HQP A;  4PDJ A;  4KM2 A;  1F28 A;  4PST A;  3JWC A;  3UM8 A;  3KGB A;  1F4G A;  3EHI X;  1RX7 A;  4M7U A;  1DRF A;  1MVT A;  3F0Q X;  2KGK A;  1BQ1 A;  1BJG A;  2C2S A;  3QLZ A;  1B5E A;  1RB3 A;  2G8D A;  3QL0 A;  3NU0 A;  4XT8 A;  1RA2 A;  2H2Q A;  3FQ0 A;  4P68 A;  1TDU A;  3SGY A;  1EV5 A;  3EEL A;  2DHF A;  3GH2 X;  1DYR A;  1DRB A;  1JTU A;  4KFJ A;  4X5G A;  4H1I A;  3EDW X;  3C06 A;  1RX3 A;  3NXO A;  3FS6 A;  4RGC A;  1BSF A;  3FRB X;  2W9G A;  1TJS A;  1BKP A;  4PTH A;  1RX4 A;  1DIS A;  4NX7 A;  1JUV A;  3F0V X;  3R33 A;  3KFY A;  3C0A A;  5HVB A;  4KJK A;  3EIG A;  1DAJ A;  4DP3 A;  1DHJ A;  1DG5 A;  2FZH A;  2ZZA A;  2W3M A;  2A9W A;  1BP6 A;  3FRA X;  3D80 A;  4DFR A;  5ECX A;  1FWM A;  1TYS A;  2RD8 A;  1DR6 A;  4ELH A;  3E0B A;  1S3W A;  1KCE A;  3I8A X;  1RX2 A;  3BZ0 A;  1NJD A;  3GHC A;  2BLB A;  3TQB A;  3FY8 X;  1VZD A;  3JWF A;  4G95 A;  3F0U X;  1F4E A;  3EAW X;  1JMF A;  3QJ7 A;  3B5B A;  3K47 A;  4IXF X;  1RX8 A;  4KPW A;  1U71 A;  1BO7 A;  2L28 A;  3QGT A;  2ANQ A;  3OAF A;  5HF2 X;  1TSL A;  3SRQ X;  3FRE X;  5HPB A;  3IRM A;  3CLB A;  1DR1 A;  3NZD A;  3K74 A;  4I13 A;  4KY8 A;  3F0X X;  3GYF A;  3FQF A;  1DNA A;  1RC4 A;  1OHK A;  4O1X D;  4OR7 A;  3OB7 A;  3DG8 A;  4XT7 A;  3NZA X;  4KL9 A;  3CL9 A;  1HW4 A;  1TSZ A;  3QG2 A;  2B3Z A;  2G8A A;  4HOG A;  3JW5 A;  3QL3 A;  1NJC A;  3TD8 A;  4XT6 A;  1JTQ A;  1BZF A;  2FTQ A;  5H39 A;  3QLW A;  1DG8 A;  1DYJ A;  2ANO A;  4M6L A;  3M09 A;  1S3V A;  3D84 X;  3EEM A;  1HFQ A;  1TDC A;  2JYB A;  4IRR A;  3DAU A;  3NXY A;  3LG4 A;  3S9U A;  4KEB A;  5FCT A;  4ISK A;  5HS3 A;  3QLX A;  1E26 A;  2BBQ A;  1DDU A;  5HI6 A;  3FRF X;  1DR4 A;  1RTS A;  4PSS A;  1DHF A;  1SYN A;  2INQ A;  4FHB A;  1DR5 A;  2W9S A;  1J3K C;  4H97 A;  4QI9 A;  3DFR A;  3TMS A;  3IK0 A;  1RA3 A;  4KJJ A;  5E8Q A;  3NRR A;  4M6K A;  1J3I A;  1VZA A;  4KAK A;  4KY4 A;  4O1X A;  4Q0D A;  1D1G A;  5HT5 A;  1J3J C;  4P66 A;  4XSC A;  4XSD A;  3HBB A;  4G2O X;  3KJR A;  4HOF A;  3N5E A;  2W9H A;  4IQQ A;  1RG7 A;  3EBU A;  3NZ9 X;  4KLX A;  5CCC A;  4XSE A;  3EF9 A;  4KNE A;  1DG7 A;  4CD2 A;  1VZB A;  3QYL A;  1QZF A;  1TSX A;  1DR3 A;  4IXG X;  3RO9 A;  5DXV A;  1S3U A;  1JOL A;  4X5I A;  3HJ3 A;  3SRR X;  1DYI A;  2FZI A;  1B5D A;  4ELG A;  1EVF A;  3NZC X;  1AJM A;  4IXE D;  4FGH A;  1HFP A;  1TVV A;  1BKO A;  3DL5 A;  2TDM A;  3JTW A;  1DR7 A;  4KJL A;  1BSP A;  2DRC A;  4EIN A;  2ITH A;  1F4F A;  3SQY X;  3H9K A;  1TRG A;  1ZPR A;  1TSY A;  3QLS A;  4DDR A;  3FYV X;  2OIP A;  4LRR A;  3SH2 A;  3BGX A;  5U27 A;  3NTZ A;  4HA7 A;  4XT4 A;  1NJA A;  1KZJ A;  5J7W A;  1RF7 A;  2ONB A;  3NXR A;  3TQA A;  3F8Y A;  3F8Z A;  4GH8 A;  4QHV A;  1TLC A;  4H98 A;  4XT5 A;  1AXW A;  4PSY A;  3KJS A;  2RD8 B;  1F4C A;  3FL9 A;  4QJZ D;  3V8H A;  3S3V A;  1AN5 A;  5HQZ A;  5BY6 A;  2OBC A;  4H95 A;  4X5H A;  5CC9 A;  3L3R A;  4GEV A;  3BHR A;  1THY A;  1TSM A;  1YPV A;  3INV A;  4O7U A;  1HFR A;  2W3V A;  1U72 A;  5ECC A;  2BL9 A;  3K2H A;  1AIQ A;  4HA9 A;  4PSG A;  3FQV A;  1OHJ A;  4E28 A;  4LAE X;  4KNZ A;  3ZPG A;  1DRE A;  3B9H A;  1DYH A;  1LY3 A;  2BLA A;  3QLY A;  1VDR A;  4NX6 A;  1CI7 A;  4QLE A;  3GHV A;  3JVX A;  4XE6 X;  1BO8 A;  1TIS A;  5FDA A;  3JWK A;  4FQS A;  4DPH A;  1TSD A;  1M78 A;  3TQ9 A;  3SAI A;  5HUI A;  1U70 A;  5HVE A;  4XEC X;  3QYO A;  4OSG A;  1HZW A;  3GI2 A;  2TDD A;  3IA5 A;  7DFR A;  1PD8 A;  1IA4 A;  3NXT A;  1VZC A;  1AO8 A;  4G6W X;  1RX6 A;  3OCH A;  2VF0 A;  4P3R A;  1TLS A;  1B49 A;  2D0K A;  3CSE A;  4EJ1 A;  1TSN A;  4TU5 X;  4Q0E A;  1BDU A;  3K45 A;  3IHI A;  3UWL A;  4Q6A A;  4H0U A;  1DRA A;  4G8Z X;  3FL8 A;  4HOE A;  2QK8 A;  3SRW X;  4DQ1 A;  2W3W A;  1HW3 A;  2FTO X;  3BYX A;  3F0B X;  5HT4 A;  1TSW A;  2XW7 A;  1DRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...