3UM8A

Wild-type plasmodium falciparum dhfr-ts complexed with cycloguanil and nadph
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
608
structure length
547
Chain Sequence
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKETKKLQNVVVMGRTSWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined Spatial Limitation around Residues 16 and 108 of Plasmodium falciparum Dihydrofolate Reductase Explains Resistance to Cycloguanil.
pubmed doi rcsb
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
molecule tags Oxidoreductase, transferase/inhibitor
source organism Plasmodium falciparum
total genus 169
structure length 547
sequence length 608
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3um8A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3um8A01
4E5OA 4GYHA 5HSUA 4P66A 1TSMA 4EZ8A 4M6LA 1U70A 1NJEA 1BPJA 2OBCA 2VF0A 2FZJA 1DR1A 3EX8A 4QHVA 1DLSA 2KCEA 1IA3A 1TVUA 1F4GA 4XT5A 3QYLA 4P68A 1QZFA 4KNZA 2A9WA 3GHCA 4PTHA 2ANOA 3N5EA 1MVTA 3K74A 4LAGX 1QQQA 4KJKA 3SA1A 2BLCA 1JMIA 3I8AX 3DRCA 1EV8A 3GH0A 2BLBA 4E28A 4PDJA 2RD8A 3OB7A 1NJDA 4XECX 3NZ6X 1JMFA 2W9GA 3FYVX 3F0BX 4ISKA 3FRAX 1DHJA 2ITHA 3JTWA 5HS3A 1LY4A 4KNEA 3QGTA 3EHIX 1KCEA 4GH8A 2G8AA 3IROA 4KL9A 1B49A 1KLKA 3SR5X 3F91A 2FTQA 1DYHA 3N0HA 2HXVA 3FYWX 4IXED 1F4FA 2FZIA 3JWFA 1EVGA 1DF7A 1RE7A 1ZPRA 4RGCA 3EBUA 1RA1A 1DNAA 5HVEA 1HW4A 2G8XA 4G8ZX 4EIZA 1BQ1A 3D84X 1TSXA 3B9HA 3NXYA 1AOEA 3BHRA 1RB3A 3IA4A 4DDRA 5FCTA 1IA4A 1S3VA 1JMHA 4XRBA 4EINA 3KGYA 4I1NA 2D0KA 3JSUA 1TVWA 3DAUA 1HFQA 2CD2A 3SRUX 3TQAA 1RX6A 2W3WA 2L28A 5HT4A 4O1XA 1BOZA 1BP6A 5DFRA 1J3JA 4PSGA 1RH3A 4TU5X 1J3JC 3QFXA 3CSEA 3QLYA 4ECKA 4IXGX 1VDRA 1S3YA 4IQBA 4EB4A 3QG2A 4QI9A 3NRRA 3UM6A 4QLFA 1BSPA 1LCEA 3F0QX 3K47A 4M2XA 1VZBA 1AO8A 3NZCX 1SEJA 2ZZAA 3N5EB 1DHIA 3RG9A 1BJGA 2G86A 2BLAA 1BO8A 5HF2X 1BDUA 1PDBA 3SQYX 5JA3A 1DLRA 1TSNA 2RD8B 3KFYA 2B3ZA 3DGAA 3C06A 1CZ3A 3EIGA 3CL9A 4TMSA 3UWLA 3EEJA 4QJZD 3DGAC 4QLGA 4DFRA 3IX6A 1BSFA 3JWMA 4ELHA 5HVBA 1S3UA 1DDRA 1THYA 4OSGA 4LAHX 4JEFA 1RX7A 4ELEA 3NZBX 5U26A 4F2VA 3GG5A 4EJ1A 1DR7A 1DRFA 1RD7A 4G6WX 3IA5A 1FWMA 2VETA 1DR2A 1RX8A 5E8QA 4QLEA 1JOMA 7DFRA 3JW5A 1TSYA 1CD2A 1RA8A 3NZAX 5FDAA 3EAWX 3BZ0A 4GD7A 5J7WA 1F4BA 1JU6A 1RA9A 3LG4A 5H39A 2G89A 4FGTA 3GI2A 5JG0X 3JWKA 1KZIA 3FL8A 2W9TA 1AI9A 2GD9A 1LCBA 3S3VA 1TSZA 3TQ8A 4GEVA 1HVYA 3I3RA 4XSEA 1E26A 3F0VX 3QLSA 3SRRX 2INQA 3D80A 1TSLA 3DFRA 3KY8A 3FREX 3M08A 3NU0A 2BL9A 3INVA 3V8HA 1DG7A 1DYJA 2FTNA 3ZPGA 5HT5A 3JVXA 4KEBA 1LUDA 3S7AA 2KGKA 3FQ0A 5H3AA 2FTOX 4O1UA 1DRBA 3RO9A 1VZEA 4DP3A 5DXVA 3NZ9X 1B5EA 3NXRA 2W3MA 3QLWA 3BNZA 2W9SA 2TSRA 3UWLB 4KM0A 3FQFA 5HQYA 3HBBA 2W9HA 1DAJA 1DDSA 3FY9X 4DPDA 1DYIA 4FQSA 2W3VA 3ED7A 1TJSA 3VCOA 3IRNA 3NXOA 3QLRA 3NXXA 3HB8A 2QK8A 1J3IA 3B5BA 4XSCA 1KMVA 3F0SX 1J3IC 4ISWA 3FL9A 1HW3A 3L3RA 1J3KA 1RB2A 3TQBA 1U72A 3QL3A 3EF9A 4O1XD 4XT7A 1J3KC 3BHLA 3QYOA 1IA1A 4Q0DA 5CCCA 3SH2A 3OCHA 1BIDA 3ZPCA 1U71A 4DPHA 3BFIA 1TSDA 3FQVA 1JMGA 4XT4A 1RA3A 3F0UX 1NJBA 4H0UA 2TDDA 4PTJA 3FS6A 3FQCA 4KLXA 3M09A 1RA2A 3CD2A 4QJCA 4PSSA 1IA2A 1TISA 1LCAA 2TSCA 4M6KA 2HQPA 3TD8A 5H38A 5HSRA 1EV5A 4H0RA 1B5DA 4LAEX 1PD9A 4CD2A 1DRAA 4KPWA 4ELFA 1M7AA 3K45A 3IHIA 1OHJA 1JTQA 2C2SA 2DHFA 2D5NA 3NXTA 2W3BA 4LEKX 3EELA 3JW3A 1HFPA 4HOGA 3GHWA 4G2OX 1RG7A 1TSWA 3DG8C 3IRMA 4M6JA 1JUTA 4X5HA 5WRNA 1VZAA 3SGYA 1YHOA 4KAKA 5HF0X 4FGHA 1M79A 1AOBA 1DG5A 1DRHA 4HA7A 1YPVA 1B02A 6DFRA 1AXWA 2AZNA 1BKPA 1TDCA 3EEKA 4H1IA 1PD8A 3F8ZA 3FQZA 4Q0EA 1TDUA 2OIPA 1F4DA 1HFRA 4PSYA 1DR6A 1DIUA 2ANQA 1F28A 1EVFA 1JTUA 3BYXA 1D1GA 1AJMA 4H95A 3EDWX 1AN5A 3QJ7A 4FHBA 2C2TA 3BGXA 4I13A 4ELBA 4G95A 1ZDRA 1TYSA 3EGYX 1DG8A 1TLSA 1BQ2A 3UM5A 1M78A 4FOGA 8DFRA 4HOFA 2W3AA 3QLXA 4EILA 3TMSA 1CI7A 2ONBA 1MVSA 4KFJA 2O7PA 5CC9A 2G8DA 1RC4A 1TDBA 3SA2A 3KGBA 4FOXA 3OAFA 1DR5A 4H97A 1DISA 3E0BA 4XSDA 3S9UA 1NJAA 4P3QA 3IK0A 5ECCA 3N5GA 1HZWA 4XT6A 3JWCA 1TVVA 4Q6AA 1JUJA 5HQZA 3DL5A 3F8YA 1DR4A 4IXFX 3QLZA 1NCEA 1TDAA 3EEMA 4HA9A 1DR3A 4LRRA 1TLCA 1SYNA 1DDUA 1VZDA 1S3WA 3F0XX 2G6VA 1RX1A 4KM2A 1KMSA 3CLBA 5BY6A 3K2HA 1DREA 2FZHA 1RX2A 1TDRA 3KJSA 3UM8A 3GH2X 1F4EA 4IRRA 4X5GA 2TDMA 3GYFA 1FFLA 4IQQA 3DL6A 5ECXA 3ROAA 3H9KA 4KY4A 5HUIA 4DQ1A 1VZCA 4X5FA 1DHFA 3NXVA 5U27A 1LY3A 3KJRA 1RX5A 2P4GA 3HJ3A 4KD7A 3TQ9A 1F4CA 3DATA 4P3RA 2RDAA 2DRCA 3NTZA 3IK1A 1RX3A 5HPBA 4O7UA 1RX9A 4M7VA 3SAIA 3R33A 2HM9A 3FY8X 3FRBX 3C0AA 3IJZA 4PSTA 5HI6A 3SRWX 1KZJA 1RF7A 5EAJA 4KBNA 4XE6X 3EJLA 1BO7A 3FQOA 1NJCA 1RTSA 4ELGA 1BZFA 4KY8A 4FGGA 4NX6A 2AAZA 3GHVA 3DG8A 4G3MA 4UP1A 2JYBA 1I00A 4KJJA 3SRQX 1AIQA 2XW7A 2CIGA 1JG0A 3SRSX 1TRGA 1BKOA 2LF1A 1JOLA 1OHKA 3IX9A 4H96A 1BP0A 4HOEA 4EIGA 4KJLA 4XT8A 3FRDX 4H98A 4X5IA 3Q1HA 3NZDA 1RX4A 3QL0A 1JUVA 2H2QA 4OR7A 1TSVA 4FOAA 2BBQA 1VJ3A 4Q67A 4M7UA 1DYRA 4KYAA 4X5JA 3FRFX 4NX7A
chains in the Genus database with same CATH superfamily
4E5OA 4GYHA 5HSUA 4P66A 1TSMA 4EZ8A 4M6LA 1U70A 1NJEA 1BPJA 2OBCA 2VF0A 2FZJA 1DR1A 3EX8A 4QHVA 1DLSA 2KCEA 1IA3A 1TVUA 1F4GA 4XT5A 3QYLA 4P68A 1QZFA 4KNZA 2A9WA 3GHCA 4PTHA 2ANOA 3N5EA 1MVTA 3K74A 4LAGX 1QQQA 4KJKA 3SA1A 2BLCA 1JMIA 3I8AX 3DRCA 1EV8A 3GH0A 2BLBA 4E28A 4PDJA 2RD8A 3OB7A 1NJDA 4XECX 3NZ6X 1JMFA 2W9GA 3FYVX 3F0BX 4ISKA 3FRAX 1DHJA 2ITHA 3JTWA 5HS3A 1LY4A 4KNEA 3QGTA 3EHIX 1KCEA 4GH8A 2G8AA 3IROA 4KL9A 1B49A 1KLKA 3SR5X 3F91A 2FTQA 1DYHA 3N0HA 2HXVA 3FYWX 4IXED 1F4FA 2FZIA 3JWFA 1EVGA 1DF7A 1RE7A 1ZPRA 4RGCA 3EBUA 1RA1A 1DNAA 5HVEA 1HW4A 2G8XA 4G8ZX 4EIZA 1BQ1A 3D84X 1TSXA 3B9HA 3NXYA 1AOEA 3BHRA 1RB3A 3IA4A 4DDRA 5FCTA 1IA4A 1S3VA 1JMHA 4XRBA 4EINA 3KGYA 4I1NA 2D0KA 3JSUA 1TVWA 3DAUA 1HFQA 2CD2A 3SRUX 3TQAA 1RX6A 2W3WA 2L28A 5HT4A 4O1XA 1BOZA 1BP6A 5DFRA 1J3JA 4PSGA 1RH3A 4TU5X 1J3JC 3QFXA 3CSEA 3QLYA 4ECKA 4IXGX 1VDRA 1S3YA 4IQBA 4EB4A 3QG2A 4QI9A 3NRRA 3UM6A 4QLFA 1BSPA 1LCEA 3F0QX 3K47A 4M2XA 1VZBA 1AO8A 3NZCX 1SEJA 2ZZAA 3N5EB 1DHIA 3RG9A 1BJGA 2G86A 2BLAA 1BO8A 5HF2X 1BDUA 1PDBA 3SQYX 5JA3A 1DLRA 1TSNA 2RD8B 3KFYA 2B3ZA 3DGAA 3C06A 1CZ3A 3EIGA 3CL9A 4TMSA 3UWLA 3EEJA 4QJZD 3DGAC 4QLGA 4DFRA 3IX6A 1BSFA 3JWMA 4ELHA 5HVBA 1S3UA 1DDRA 1THYA 4OSGA 4LAHX 4JEFA 1RX7A 4ELEA 3NZBX 5U26A 4F2VA 3GG5A 4EJ1A 1DR7A 1DRFA 1RD7A 4G6WX 3IA5A 1FWMA 2VETA 1DR2A 1RX8A 5E8QA 4QLEA 1JOMA 7DFRA 3JW5A 1TSYA 1CD2A 1RA8A 3NZAX 5FDAA 3EAWX 3BZ0A 4GD7A 5J7WA 1F4BA 1JU6A 1RA9A 3LG4A 5H39A 2G89A 4FGTA 3GI2A 5JG0X 3JWKA 1KZIA 3FL8A 2W9TA 1AI9A 2GD9A 1LCBA 3S3VA 1TSZA 3TQ8A 4GEVA 1HVYA 3I3RA 4XSEA 1E26A 3F0VX 3QLSA 3SRRX 2INQA 3D80A 1TSLA 3DFRA 3KY8A 3FREX 3M08A 3NU0A 2BL9A 3INVA 3V8HA 1DG7A 1DYJA 2FTNA 3ZPGA 5HT5A 3JVXA 4KEBA 1LUDA 3S7AA 2KGKA 3FQ0A 5H3AA 2FTOX 4O1UA 1DRBA 3RO9A 1VZEA 4DP3A 5DXVA 3NZ9X 1B5EA 3NXRA 2W3MA 3QLWA 3BNZA 2W9SA 2TSRA 3UWLB 4KM0A 3FQFA 5HQYA 3HBBA 2W9HA 1DAJA 1DDSA 3FY9X 4DPDA 1DYIA 4FQSA 2W3VA 3ED7A 1TJSA 3VCOA 3IRNA 3NXOA 3QLRA 3NXXA 3HB8A 2QK8A 1J3IA 3B5BA 4XSCA 1KMVA 3F0SX 1J3IC 4ISWA 3FL9A 1HW3A 3L3RA 1J3KA 1RB2A 3TQBA 1U72A 3QL3A 3EF9A 4O1XD 4XT7A 1J3KC 3BHLA 3QYOA 1IA1A 4Q0DA 5CCCA 3SH2A 3OCHA 1BIDA 3ZPCA 1U71A 4DPHA 3BFIA 1TSDA 3FQVA 1JMGA 4XT4A 1RA3A 3F0UX 1NJBA 4H0UA 2TDDA 4PTJA 3FS6A 3FQCA 4KLXA 3M09A 1RA2A 3CD2A 4QJCA 4PSSA 1IA2A 1TISA 1LCAA 2TSCA 4M6KA 2HQPA 3TD8A 5H38A 5HSRA 1EV5A 4H0RA 1B5DA 4LAEX 1PD9A 4CD2A 1DRAA 4KPWA 4ELFA 1M7AA 3K45A 3IHIA 1OHJA 1JTQA 2C2SA 2DHFA 2D5NA 3NXTA 2W3BA 4LEKX 3EELA 3JW3A 1HFPA 4HOGA 3GHWA 4G2OX 1RG7A 1TSWA 3DG8C 3IRMA 4M6JA 1JUTA 4X5HA 5WRNA 1VZAA 3SGYA 1YHOA 4KAKA 5HF0X 4FGHA 1M79A 1AOBA 1DG5A 1DRHA 4HA7A 1YPVA 1B02A 6DFRA 1AXWA 2AZNA 1BKPA 1TDCA 3EEKA 4H1IA 1PD8A 3F8ZA 3FQZA 4Q0EA 1TDUA 2OIPA 1F4DA 1HFRA 4PSYA 1DR6A 1DIUA 2ANQA 1F28A 1EVFA 1JTUA 3BYXA 1D1GA 1AJMA 4H95A 3EDWX 1AN5A 3QJ7A 4FHBA 2C2TA 3BGXA 4I13A 4ELBA 4G95A 1ZDRA 1TYSA 3EGYX 1DG8A 1TLSA 1BQ2A 3UM5A 1M78A 4FOGA 8DFRA 4HOFA 2W3AA 3QLXA 4EILA 3TMSA 1CI7A 2ONBA 1MVSA 4KFJA 2O7PA 5CC9A 2G8DA 1RC4A 1TDBA 3SA2A 3KGBA 4FOXA 3OAFA 1DR5A 4H97A 1DISA 3E0BA 4XSDA 3S9UA 1NJAA 4P3QA 3IK0A 5ECCA 3N5GA 1HZWA 4XT6A 3JWCA 1TVVA 4Q6AA 1JUJA 5HQZA 3DL5A 3F8YA 1DR4A 4IXFX 3QLZA 1NCEA 1TDAA 3EEMA 4HA9A 1DR3A 4LRRA 1TLCA 1SYNA 1DDUA 1VZDA 1S3WA 3F0XX 2G6VA 1RX1A 4KM2A 1KMSA 3CLBA 5BY6A 3K2HA 1DREA 2FZHA 1RX2A 1TDRA 3KJSA 3UM8A 3GH2X 1F4EA 4IRRA 4X5GA 2TDMA 3GYFA 1FFLA 4IQQA 3DL6A 5ECXA 3ROAA 3H9KA 4KY4A 5HUIA 4DQ1A 1VZCA 4X5FA 1DHFA 3NXVA 5U27A 1LY3A 3KJRA 1RX5A 2P4GA 3HJ3A 4KD7A 3TQ9A 1F4CA 3DATA 4P3RA 2RDAA 2DRCA 3NTZA 3IK1A 1RX3A 5HPBA 4O7UA 1RX9A 4M7VA 3SAIA 3R33A 2HM9A 3FY8X 3FRBX 3C0AA 3IJZA 4PSTA 5HI6A 3SRWX 1KZJA 1RF7A 5EAJA 4KBNA 4XE6X 3EJLA 1BO7A 3FQOA 1NJCA 1RTSA 4ELGA 1BZFA 4KY8A 4FGGA 4NX6A 2AAZA 3GHVA 3DG8A 4G3MA 4UP1A 2JYBA 1I00A 4KJJA 3SRQX 1AIQA 2XW7A 2CIGA 1JG0A 3SRSX 1TRGA 1BKOA 2LF1A 1JOLA 1OHKA 3IX9A 4H96A 1BP0A 4HOEA 4EIGA 4KJLA 4XT8A 3FRDX 4H98A 4X5IA 3Q1HA 3NZDA 1RX4A 3QL0A 1JUVA 2H2QA 4OR7A 1TSVA 4FOAA 2BBQA 1VJ3A 4Q67A 4M7UA 1DYRA 4KYAA 4X5JA 3FRFX 4NX7A
chains in the Genus database with same CATH topology
4E5OA 4GYHA 5HSUA 4P66A 1TSMA 4EZ8A 4M6LA 1U70A 1NJEA 1BPJA 2OBCA 2VF0A 2FZJA 1DR1A 3EX8A 4QHVA 1DLSA 2KCEA 1IA3A 1TVUA 1F4GA 4XT5A 3QYLA 4P68A 1QZFA 4KNZA 2A9WA 3GHCA 4PTHA 2ANOA 3N5EA 1MVTA 3K74A 4LAGX 1QQQA 4KJKA 3SA1A 2BLCA 1JMIA 3I8AX 3DRCA 1EV8A 3GH0A 2BLBA 4E28A 4PDJA 2RD8A 3OB7A 1NJDA 4XECX 3NZ6X 1JMFA 2W9GA 3FYVX 3F0BX 4ISKA 3FRAX 1DHJA 2ITHA 3JTWA 5HS3A 1LY4A 4KNEA 3QGTA 3EHIX 1KCEA 4GH8A 2G8AA 3IROA 4KL9A 1B49A 1KLKA 3SR5X 3F91A 2FTQA 1DYHA 3N0HA 2HXVA 3FYWX 4IXED 1F4FA 2FZIA 3JWFA 1EVGA 1DF7A 1RE7A 1ZPRA 4RGCA 3EBUA 1RA1A 1DNAA 5HVEA 1HW4A 2G8XA 4G8ZX 4EIZA 1BQ1A 3D84X 1TSXA 3B9HA 3NXYA 1AOEA 3BHRA 1RB3A 3IA4A 4DDRA 5FCTA 1IA4A 1S3VA 1JMHA 4XRBA 4EINA 3KGYA 4I1NA 2D0KA 3JSUA 1TVWA 3DAUA 1HFQA 2CD2A 3SRUX 3TQAA 1RX6A 2W3WA 2L28A 5HT4A 4O1XA 1BOZA 1BP6A 5DFRA 1J3JA 4PSGA 1RH3A 4TU5X 1J3JC 3QFXA 3CSEA 3QLYA 4ECKA 4IXGX 1VDRA 1S3YA 4IQBA 4EB4A 3QG2A 4QI9A 3NRRA 3UM6A 4QLFA 1BSPA 1LCEA 3F0QX 3K47A 4M2XA 1VZBA 1AO8A 3NZCX 1SEJA 2ZZAA 3N5EB 1DHIA 3RG9A 1BJGA 2G86A 2BLAA 1BO8A 5HF2X 1BDUA 1PDBA 3SQYX 5JA3A 1DLRA 1TSNA 2RD8B 3KFYA 2B3ZA 3DGAA 3C06A 1CZ3A 3EIGA 3CL9A 4TMSA 3UWLA 3EEJA 4QJZD 3DGAC 4QLGA 4DFRA 3IX6A 1BSFA 3JWMA 4ELHA 5HVBA 1S3UA 1DDRA 1THYA 4OSGA 4LAHX 4JEFA 1RX7A 4ELEA 3NZBX 5U26A 4F2VA 3GG5A 4EJ1A 1DR7A 1DRFA 1RD7A 4G6WX 3IA5A 1FWMA 2VETA 1DR2A 1RX8A 5E8QA 4QLEA 1JOMA 7DFRA 3JW5A 1TSYA 1CD2A 1RA8A 3NZAX 5FDAA 3EAWX 3BZ0A 4GD7A 5J7WA 1F4BA 1JU6A 1RA9A 3LG4A 5H39A 2G89A 4FGTA 3GI2A 5JG0X 3JWKA 1KZIA 3FL8A 2W9TA 1AI9A 2GD9A 1LCBA 3S3VA 1TSZA 3TQ8A 4GEVA 1HVYA 3I3RA 4XSEA 1E26A 3F0VX 3QLSA 3SRRX 2INQA 3D80A 1TSLA 3DFRA 3KY8A 3FREX 3M08A 3NU0A 2BL9A 3INVA 3V8HA 1DG7A 1DYJA 2FTNA 3ZPGA 5HT5A 3JVXA 4KEBA 1LUDA 3S7AA 2KGKA 3FQ0A 5H3AA 2FTOX 4O1UA 1DRBA 3RO9A 1VZEA 4DP3A 5DXVA 3NZ9X 1B5EA 3NXRA 2W3MA 3QLWA 3BNZA 2W9SA 2TSRA 3UWLB 4KM0A 3FQFA 5HQYA 3HBBA 2W9HA 1DAJA 1DDSA 3FY9X 4DPDA 1DYIA 4FQSA 2W3VA 3ED7A 1TJSA 3VCOA 3IRNA 3NXOA 3QLRA 3NXXA 3HB8A 2QK8A 1J3IA 3B5BA 4XSCA 1KMVA 3F0SX 1J3IC 4ISWA 3FL9A 1HW3A 3L3RA 1J3KA 1RB2A 3TQBA 1U72A 3QL3A 3EF9A 4O1XD 4XT7A 1J3KC 3BHLA 3QYOA 1IA1A 4Q0DA 5CCCA 3SH2A 3OCHA 1BIDA 3ZPCA 1U71A 4DPHA 3BFIA 1TSDA 3FQVA 1JMGA 4XT4A 1RA3A 3F0UX 1NJBA 4H0UA 2TDDA 4PTJA 3FS6A 3FQCA 4KLXA 3M09A 1RA2A 3CD2A 4QJCA 4PSSA 1IA2A 1TISA 1LCAA 2TSCA 4M6KA 2HQPA 3TD8A 5H38A 5HSRA 1EV5A 4H0RA 1B5DA 4LAEX 1PD9A 4CD2A 1DRAA 4KPWA 4ELFA 1M7AA 3K45A 3IHIA 1OHJA 1JTQA 2C2SA 2DHFA 2D5NA 3NXTA 2W3BA 4LEKX 3EELA 3JW3A 1HFPA 4HOGA 3GHWA 4G2OX 1RG7A 1TSWA 3DG8C 3IRMA 4M6JA 1JUTA 4X5HA 5WRNA 1VZAA 3SGYA 1YHOA 4KAKA 5HF0X 4FGHA 1M79A 1AOBA 1DG5A 1DRHA 4HA7A 1YPVA 1B02A 6DFRA 1AXWA 2AZNA 1BKPA 1TDCA 3EEKA 4H1IA 1PD8A 3F8ZA 3FQZA 4Q0EA 1TDUA 2OIPA 1F4DA 1HFRA 4PSYA 1DR6A 1DIUA 2ANQA 1F28A 1EVFA 1JTUA 3BYXA 1D1GA 1AJMA 4H95A 3EDWX 1AN5A 3QJ7A 4FHBA 2C2TA 3BGXA 4I13A 4ELBA 4G95A 1ZDRA 1TYSA 3EGYX 1DG8A 1TLSA 1BQ2A 3UM5A 1M78A 4FOGA 8DFRA 4HOFA 2W3AA 3QLXA 4EILA 3TMSA 1CI7A 2ONBA 1MVSA 4KFJA 2O7PA 5CC9A 2G8DA 1RC4A 1TDBA 3SA2A 3KGBA 4FOXA 3OAFA 1DR5A 4H97A 1DISA 3E0BA 4XSDA 3S9UA 1NJAA 4P3QA 3IK0A 5ECCA 3N5GA 1HZWA 4XT6A 3JWCA 1TVVA 4Q6AA 1JUJA 5HQZA 3DL5A 3F8YA 1DR4A 4IXFX 3QLZA 1NCEA 1TDAA 3EEMA 4HA9A 1DR3A 4LRRA 1TLCA 1SYNA 1DDUA 1VZDA 1S3WA 3F0XX 2G6VA 1RX1A 4KM2A 1KMSA 3CLBA 5BY6A 3K2HA 1DREA 2FZHA 1RX2A 1TDRA 3KJSA 3UM8A 3GH2X 1F4EA 4IRRA 4X5GA 2TDMA 3GYFA 1FFLA 4IQQA 3DL6A 5ECXA 3ROAA 3H9KA 4KY4A 5HUIA 4DQ1A 1VZCA 4X5FA 1DHFA 3NXVA 5U27A 1LY3A 3KJRA 1RX5A 2P4GA 3HJ3A 4KD7A 3TQ9A 1F4CA 3DATA 4P3RA 2RDAA 2DRCA 3NTZA 3IK1A 1RX3A 5HPBA 4O7UA 1RX9A 4M7VA 3SAIA 3R33A 2HM9A 3FY8X 3FRBX 3C0AA 3IJZA 4PSTA 5HI6A 3SRWX 1KZJA 1RF7A 5EAJA 4KBNA 4XE6X 3EJLA 1BO7A 3FQOA 1NJCA 1RTSA 4ELGA 1BZFA 4KY8A 4FGGA 4NX6A 2AAZA 3GHVA 3DG8A 4G3MA 4UP1A 2JYBA 1I00A 4KJJA 3SRQX 1AIQA 2XW7A 2CIGA 1JG0A 3SRSX 1TRGA 1BKOA 2LF1A 1JOLA 1OHKA 3IX9A 4H96A 1BP0A 4HOEA 4EIGA 4KJLA 4XT8A 3FRDX 4H98A 4X5IA 3Q1HA 3NZDA 1RX4A 3QL0A 1JUVA 2H2QA 4OR7A 1TSVA 4FOAA 2BBQA 1VJ3A 4Q67A 4M7UA 1DYRA 4KYAA 4X5JA 3FRFX 4NX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E5O A;  4GYH A;  5HSU A;  4P66 A;  1TSM A;  4EZ8 A;  4M6L A;  1U70 A;  1NJE A;  1BPJ A;  2OBC A;  2VF0 A;  2FZJ A;  1DR1 A;  3EX8 A;  4QHV A;  1DLS A;  2KCE A;  1IA3 A;  1TVU A;  1F4G A;  4XT5 A;  3QYL A;  4P68 A;  1QZF A;  4KNZ A;  2A9W A;  3GHC A;  4PTH A;  2ANO A;  3N5E A;  1MVT A;  3K74 A;  4LAG X;  1QQQ A;  4KJK A;  3SA1 A;  2BLC A;  1JMI A;  3I8A X;  3DRC A;  1EV8 A;  3GH0 A;  2BLB A;  4E28 A;  4PDJ A;  2RD8 A;  3OB7 A;  1NJD A;  4XEC X;  3NZ6 X;  1JMF A;  2W9G A;  3FYV X;  3F0B X;  4ISK A;  3FRA X;  1DHJ A;  2ITH A;  3JTW A;  5HS3 A;  1LY4 A;  4KNE A;  3QGT A;  3EHI X;  1KCE A;  4GH8 A;  2G8A A;  3IRO A;  4KL9 A;  1B49 A;  1KLK A;  3SR5 X;  3F91 A;  2FTQ A;  1DYH A;  3N0H A;  2HXV A;  3FYW X;  4IXE D;  1F4F A;  2FZI A;  3JWF A;  1EVG A;  1DF7 A;  1RE7 A;  1ZPR A;  4RGC A;  3EBU A;  1RA1 A;  1DNA A;  5HVE A;  1HW4 A;  2G8X A;  4G8Z X;  4EIZ A;  1BQ1 A;  3D84 X;  1TSX A;  3B9H A;  3NXY A;  1AOE A;  3BHR A;  1RB3 A;  3IA4 A;  4DDR A;  5FCT A;  1IA4 A;  1S3V A;  1JMH A;  4XRB A;  4EIN A;  3KGY A;  4I1N A;  2D0K A;  3JSU A;  1TVW A;  3DAU A;  1HFQ A;  2CD2 A;  3SRU X;  3TQA A;  1RX6 A;  2W3W A;  2L28 A;  5HT4 A;  4O1X A;  1BOZ A;  1BP6 A;  5DFR A;  1J3J A;  4PSG A;  1RH3 A;  4TU5 X;  1J3J C;  3QFX A;  3CSE A;  3QLY A;  4ECK A;  4IXG X;  1VDR A;  1S3Y A;  4IQB A;  4EB4 A;  3QG2 A;  4QI9 A;  3NRR A;  3UM6 A;  4QLF A;  1BSP A;  1LCE A;  3F0Q X;  3K47 A;  4M2X A;  1VZB A;  1AO8 A;  3NZC X;  1SEJ A;  2ZZA A;  3N5E B;  1DHI A;  3RG9 A;  1BJG A;  2G86 A;  2BLA A;  1BO8 A;  5HF2 X;  1BDU A;  1PDB A;  3SQY X;  5JA3 A;  1DLR A;  1TSN A;  2RD8 B;  3KFY A;  2B3Z A;  3DGA A;  3C06 A;  1CZ3 A;  3EIG A;  3CL9 A;  4TMS A;  3UWL A;  3EEJ A;  4QJZ D;  3DGA C;  4QLG A;  4DFR A;  3IX6 A;  1BSF A;  3JWM A;  4ELH A;  5HVB A;  1S3U A;  1DDR A;  1THY A;  4OSG A;  4LAH X;  4JEF A;  1RX7 A;  4ELE A;  3NZB X;  5U26 A;  4F2V A;  3GG5 A;  4EJ1 A;  1DR7 A;  1DRF A;  1RD7 A;  4G6W X;  3IA5 A;  1FWM A;  2VET A;  1DR2 A;  1RX8 A;  5E8Q A;  4QLE A;  1JOM A;  7DFR A;  3JW5 A;  1TSY A;  1CD2 A;  1RA8 A;  3NZA X;  5FDA A;  3EAW X;  3BZ0 A;  4GD7 A;  5J7W A;  1F4B A;  1JU6 A;  1RA9 A;  3LG4 A;  5H39 A;  2G89 A;  4FGT A;  3GI2 A;  5JG0 X;  3JWK A;  1KZI A;  3FL8 A;  2W9T A;  1AI9 A;  2GD9 A;  1LCB A;  3S3V A;  1TSZ A;  3TQ8 A;  4GEV A;  1HVY A;  3I3R A;  4XSE A;  1E26 A;  3F0V X;  3QLS A;  3SRR X;  2INQ A;  3D80 A;  1TSL A;  3DFR A;  3KY8 A;  3FRE X;  3M08 A;  3NU0 A;  2BL9 A;  3INV A;  3V8H A;  1DG7 A;  1DYJ A;  2FTN A;  3ZPG A;  5HT5 A;  3JVX A;  4KEB A;  1LUD A;  3S7A A;  2KGK A;  3FQ0 A;  5H3A A;  2FTO X;  4O1U A;  1DRB A;  3RO9 A;  1VZE A;  4DP3 A;  5DXV A;  3NZ9 X;  1B5E A;  3NXR A;  2W3M A;  3QLW A;  3BNZ A;  2W9S A;  2TSR A;  3UWL B;  4KM0 A;  3FQF A;  5HQY A;  3HBB A;  2W9H A;  1DAJ A;  1DDS A;  3FY9 X;  4DPD A;  1DYI A;  4FQS A;  2W3V A;  3ED7 A;  1TJS A;  3VCO A;  3IRN A;  3NXO A;  3QLR A;  3NXX A;  3HB8 A;  2QK8 A;  1J3I A;  3B5B A;  4XSC A;  1KMV A;  3F0S X;  1J3I C;  4ISW A;  3FL9 A;  1HW3 A;  3L3R A;  1J3K A;  1RB2 A;  3TQB A;  1U72 A;  3QL3 A;  3EF9 A;  4O1X D;  4XT7 A;  1J3K C;  3BHL A;  3QYO A;  1IA1 A;  4Q0D A;  5CCC A;  3SH2 A;  3OCH A;  1BID A;  3ZPC A;  1U71 A;  4DPH A;  3BFI A;  1TSD A;  3FQV A;  1JMG A;  4XT4 A;  1RA3 A;  3F0U X;  1NJB A;  4H0U A;  2TDD A;  4PTJ A;  3FS6 A;  3FQC A;  4KLX A;  3M09 A;  1RA2 A;  3CD2 A;  4QJC A;  4PSS A;  1IA2 A;  1TIS A;  1LCA A;  2TSC A;  4M6K A;  2HQP A;  3TD8 A;  5H38 A;  5HSR A;  1EV5 A;  4H0R A;  1B5D A;  4LAE X;  1PD9 A;  4CD2 A;  1DRA A;  4KPW A;  4ELF A;  1M7A A;  3K45 A;  3IHI A;  1OHJ A;  1JTQ A;  2C2S A;  2DHF A;  2D5N A;  3NXT A;  2W3B A;  4LEK X;  3EEL A;  3JW3 A;  1HFP A;  4HOG A;  3GHW A;  4G2O X;  1RG7 A;  1TSW A;  3DG8 C;  3IRM A;  4M6J A;  1JUT A;  4X5H A;  5WRN A;  1VZA A;  3SGY A;  1YHO A;  4KAK A;  5HF0 X;  4FGH A;  1M79 A;  1AOB A;  1DG5 A;  1DRH A;  4HA7 A;  1YPV A;  1B02 A;  6DFR A;  1AXW A;  2AZN A;  1BKP A;  1TDC A;  3EEK A;  4H1I A;  1PD8 A;  3F8Z A;  3FQZ A;  4Q0E A;  1TDU A;  2OIP A;  1F4D A;  1HFR A;  4PSY A;  1DR6 A;  1DIU A;  2ANQ A;  1F28 A;  1EVF A;  1JTU A;  3BYX A;  1D1G A;  1AJM A;  4H95 A;  3EDW X;  1AN5 A;  3QJ7 A;  4FHB A;  2C2T A;  3BGX A;  4I13 A;  4ELB A;  4G95 A;  1ZDR A;  1TYS A;  3EGY X;  1DG8 A;  1TLS A;  1BQ2 A;  3UM5 A;  1M78 A;  4FOG A;  8DFR A;  4HOF A;  2W3A A;  3QLX A;  4EIL A;  3TMS A;  1CI7 A;  2ONB A;  1MVS A;  4KFJ A;  2O7P A;  5CC9 A;  2G8D A;  1RC4 A;  1TDB A;  3SA2 A;  3KGB A;  4FOX A;  3OAF A;  1DR5 A;  4H97 A;  1DIS A;  3E0B A;  4XSD A;  3S9U A;  1NJA A;  4P3Q A;  3IK0 A;  5ECC A;  3N5G A;  1HZW A;  4XT6 A;  3JWC A;  1TVV A;  4Q6A A;  1JUJ A;  5HQZ A;  3DL5 A;  3F8Y A;  1DR4 A;  4IXF X;  3QLZ A;  1NCE A;  1TDA A;  3EEM A;  4HA9 A;  1DR3 A;  4LRR A;  1TLC A;  1SYN A;  1DDU A;  1VZD A;  1S3W A;  3F0X X;  2G6V A;  1RX1 A;  4KM2 A;  1KMS A;  3CLB A;  5BY6 A;  3K2H A;  1DRE A;  2FZH A;  1RX2 A;  1TDR A;  3KJS A;  3UM8 A;  3GH2 X;  1F4E A;  4IRR A;  4X5G A;  2TDM A;  3GYF A;  1FFL A;  4IQQ A;  3DL6 A;  5ECX A;  3ROA A;  3H9K A;  4KY4 A;  5HUI A;  4DQ1 A;  1VZC A;  4X5F A;  1DHF A;  3NXV A;  5U27 A;  1LY3 A;  3KJR A;  1RX5 A;  2P4G A;  3HJ3 A;  4KD7 A;  3TQ9 A;  1F4C A;  3DAT A;  4P3R A;  2RDA A;  2DRC A;  3NTZ A;  3IK1 A;  1RX3 A;  5HPB A;  4O7U A;  1RX9 A;  4M7V A;  3SAI A;  3R33 A;  2HM9 A;  3FY8 X;  3FRB X;  3C0A A;  3IJZ A;  4PST A;  5HI6 A;  3SRW X;  1KZJ A;  1RF7 A;  5EAJ A;  4KBN A;  4XE6 X;  3EJL A;  1BO7 A;  3FQO A;  1NJC A;  1RTS A;  4ELG A;  1BZF A;  4KY8 A;  4FGG A;  4NX6 A;  2AAZ A;  3GHV A;  3DG8 A;  4G3M A;  4UP1 A;  2JYB A;  1I00 A;  4KJJ A;  3SRQ X;  1AIQ A;  2XW7 A;  2CIG A;  1JG0 A;  3SRS X;  1TRG A;  1BKO A;  2LF1 A;  1JOL A;  1OHK A;  3IX9 A;  4H96 A;  1BP0 A;  4HOE A;  4EIG A;  4KJL A;  4XT8 A;  3FRD X;  4H98 A;  4X5I A;  3Q1H A;  3NZD A;  1RX4 A;  3QL0 A;  1JUV A;  2H2Q A;  4OR7 A;  1TSV A;  4FOA A;  2BBQ A;  1VJ3 A;  4Q67 A;  4M7U A;  1DYR A;  4KYA A;  4X5J A;  3FRF X;  4NX7 A; 
#chains in the Genus database with same CATH topology
 4E5O A;  4GYH A;  5HSU A;  4P66 A;  1TSM A;  4EZ8 A;  4M6L A;  1U70 A;  1NJE A;  1BPJ A;  2OBC A;  2VF0 A;  2FZJ A;  1DR1 A;  3EX8 A;  4QHV A;  1DLS A;  2KCE A;  1IA3 A;  1TVU A;  1F4G A;  4XT5 A;  3QYL A;  4P68 A;  1QZF A;  4KNZ A;  2A9W A;  3GHC A;  4PTH A;  2ANO A;  3N5E A;  1MVT A;  3K74 A;  4LAG X;  1QQQ A;  4KJK A;  3SA1 A;  2BLC A;  1JMI A;  3I8A X;  3DRC A;  1EV8 A;  3GH0 A;  2BLB A;  4E28 A;  4PDJ A;  2RD8 A;  3OB7 A;  1NJD A;  4XEC X;  3NZ6 X;  1JMF A;  2W9G A;  3FYV X;  3F0B X;  4ISK A;  3FRA X;  1DHJ A;  2ITH A;  3JTW A;  5HS3 A;  1LY4 A;  4KNE A;  3QGT A;  3EHI X;  1KCE A;  4GH8 A;  2G8A A;  3IRO A;  4KL9 A;  1B49 A;  1KLK A;  3SR5 X;  3F91 A;  2FTQ A;  1DYH A;  3N0H A;  2HXV A;  3FYW X;  4IXE D;  1F4F A;  2FZI A;  3JWF A;  1EVG A;  1DF7 A;  1RE7 A;  1ZPR A;  4RGC A;  3EBU A;  1RA1 A;  1DNA A;  5HVE A;  1HW4 A;  2G8X A;  4G8Z X;  4EIZ A;  1BQ1 A;  3D84 X;  1TSX A;  3B9H A;  3NXY A;  1AOE A;  3BHR A;  1RB3 A;  3IA4 A;  4DDR A;  5FCT A;  1IA4 A;  1S3V A;  1JMH A;  4XRB A;  4EIN A;  3KGY A;  4I1N A;  2D0K A;  3JSU A;  1TVW A;  3DAU A;  1HFQ A;  2CD2 A;  3SRU X;  3TQA A;  1RX6 A;  2W3W A;  2L28 A;  5HT4 A;  4O1X A;  1BOZ A;  1BP6 A;  5DFR A;  1J3J A;  4PSG A;  1RH3 A;  4TU5 X;  1J3J C;  3QFX A;  3CSE A;  3QLY A;  4ECK A;  4IXG X;  1VDR A;  1S3Y A;  4IQB A;  4EB4 A;  3QG2 A;  4QI9 A;  3NRR A;  3UM6 A;  4QLF A;  1BSP A;  1LCE A;  3F0Q X;  3K47 A;  4M2X A;  1VZB A;  1AO8 A;  3NZC X;  1SEJ A;  2ZZA A;  3N5E B;  1DHI A;  3RG9 A;  1BJG A;  2G86 A;  2BLA A;  1BO8 A;  5HF2 X;  1BDU A;  1PDB A;  3SQY X;  5JA3 A;  1DLR A;  1TSN A;  2RD8 B;  3KFY A;  2B3Z A;  3DGA A;  3C06 A;  1CZ3 A;  3EIG A;  3CL9 A;  4TMS A;  3UWL A;  3EEJ A;  4QJZ D;  3DGA C;  4QLG A;  4DFR A;  3IX6 A;  1BSF A;  3JWM A;  4ELH A;  5HVB A;  1S3U A;  1DDR A;  1THY A;  4OSG A;  4LAH X;  4JEF A;  1RX7 A;  4ELE A;  3NZB X;  5U26 A;  4F2V A;  3GG5 A;  4EJ1 A;  1DR7 A;  1DRF A;  1RD7 A;  4G6W X;  3IA5 A;  1FWM A;  2VET A;  1DR2 A;  1RX8 A;  5E8Q A;  4QLE A;  1JOM A;  7DFR A;  3JW5 A;  1TSY A;  1CD2 A;  1RA8 A;  3NZA X;  5FDA A;  3EAW X;  3BZ0 A;  4GD7 A;  5J7W A;  1F4B A;  1JU6 A;  1RA9 A;  3LG4 A;  5H39 A;  2G89 A;  4FGT A;  3GI2 A;  5JG0 X;  3JWK A;  1KZI A;  3FL8 A;  2W9T A;  1AI9 A;  2GD9 A;  1LCB A;  3S3V A;  1TSZ A;  3TQ8 A;  4GEV A;  1HVY A;  3I3R A;  4XSE A;  1E26 A;  3F0V X;  3QLS A;  3SRR X;  2INQ A;  3D80 A;  1TSL A;  3DFR A;  3KY8 A;  3FRE X;  3M08 A;  3NU0 A;  2BL9 A;  3INV A;  3V8H A;  1DG7 A;  1DYJ A;  2FTN A;  3ZPG A;  5HT5 A;  3JVX A;  4KEB A;  1LUD A;  3S7A A;  2KGK A;  3FQ0 A;  5H3A A;  2FTO X;  4O1U A;  1DRB A;  3RO9 A;  1VZE A;  4DP3 A;  5DXV A;  3NZ9 X;  1B5E A;  3NXR A;  2W3M A;  3QLW A;  3BNZ A;  2W9S A;  2TSR A;  3UWL B;  4KM0 A;  3FQF A;  5HQY A;  3HBB A;  2W9H A;  1DAJ A;  1DDS A;  3FY9 X;  4DPD A;  1DYI A;  4FQS A;  2W3V A;  3ED7 A;  1TJS A;  3VCO A;  3IRN A;  3NXO A;  3QLR A;  3NXX A;  3HB8 A;  2QK8 A;  1J3I A;  3B5B A;  4XSC A;  1KMV A;  3F0S X;  1J3I C;  4ISW A;  3FL9 A;  1HW3 A;  3L3R A;  1J3K A;  1RB2 A;  3TQB A;  1U72 A;  3QL3 A;  3EF9 A;  4O1X D;  4XT7 A;  1J3K C;  3BHL A;  3QYO A;  1IA1 A;  4Q0D A;  5CCC A;  3SH2 A;  3OCH A;  1BID A;  3ZPC A;  1U71 A;  4DPH A;  3BFI A;  1TSD A;  3FQV A;  1JMG A;  4XT4 A;  1RA3 A;  3F0U X;  1NJB A;  4H0U A;  2TDD A;  4PTJ A;  3FS6 A;  3FQC A;  4KLX A;  3M09 A;  1RA2 A;  3CD2 A;  4QJC A;  4PSS A;  1IA2 A;  1TIS A;  1LCA A;  2TSC A;  4M6K A;  2HQP A;  3TD8 A;  5H38 A;  5HSR A;  1EV5 A;  4H0R A;  1B5D A;  4LAE X;  1PD9 A;  4CD2 A;  1DRA A;  4KPW A;  4ELF A;  1M7A A;  3K45 A;  3IHI A;  1OHJ A;  1JTQ A;  2C2S A;  2DHF A;  2D5N A;  3NXT A;  2W3B A;  4LEK X;  3EEL A;  3JW3 A;  1HFP A;  4HOG A;  3GHW A;  4G2O X;  1RG7 A;  1TSW A;  3DG8 C;  3IRM A;  4M6J A;  1JUT A;  4X5H A;  5WRN A;  1VZA A;  3SGY A;  1YHO A;  4KAK A;  5HF0 X;  4FGH A;  1M79 A;  1AOB A;  1DG5 A;  1DRH A;  4HA7 A;  1YPV A;  1B02 A;  6DFR A;  1AXW A;  2AZN A;  1BKP A;  1TDC A;  3EEK A;  4H1I A;  1PD8 A;  3F8Z A;  3FQZ A;  4Q0E A;  1TDU A;  2OIP A;  1F4D A;  1HFR A;  4PSY A;  1DR6 A;  1DIU A;  2ANQ A;  1F28 A;  1EVF A;  1JTU A;  3BYX A;  1D1G A;  1AJM A;  4H95 A;  3EDW X;  1AN5 A;  3QJ7 A;  4FHB A;  2C2T A;  3BGX A;  4I13 A;  4ELB A;  4G95 A;  1ZDR A;  1TYS A;  3EGY X;  1DG8 A;  1TLS A;  1BQ2 A;  3UM5 A;  1M78 A;  4FOG A;  8DFR A;  4HOF A;  2W3A A;  3QLX A;  4EIL A;  3TMS A;  1CI7 A;  2ONB A;  1MVS A;  4KFJ A;  2O7P A;  5CC9 A;  2G8D A;  1RC4 A;  1TDB A;  3SA2 A;  3KGB A;  4FOX A;  3OAF A;  1DR5 A;  4H97 A;  1DIS A;  3E0B A;  4XSD A;  3S9U A;  1NJA A;  4P3Q A;  3IK0 A;  5ECC A;  3N5G A;  1HZW A;  4XT6 A;  3JWC A;  1TVV A;  4Q6A A;  1JUJ A;  5HQZ A;  3DL5 A;  3F8Y A;  1DR4 A;  4IXF X;  3QLZ A;  1NCE A;  1TDA A;  3EEM A;  4HA9 A;  1DR3 A;  4LRR A;  1TLC A;  1SYN A;  1DDU A;  1VZD A;  1S3W A;  3F0X X;  2G6V A;  1RX1 A;  4KM2 A;  1KMS A;  3CLB A;  5BY6 A;  3K2H A;  1DRE A;  2FZH A;  1RX2 A;  1TDR A;  3KJS A;  3UM8 A;  3GH2 X;  1F4E A;  4IRR A;  4X5G A;  2TDM A;  3GYF A;  1FFL A;  4IQQ A;  3DL6 A;  5ECX A;  3ROA A;  3H9K A;  4KY4 A;  5HUI A;  4DQ1 A;  1VZC A;  4X5F A;  1DHF A;  3NXV A;  5U27 A;  1LY3 A;  3KJR A;  1RX5 A;  2P4G A;  3HJ3 A;  4KD7 A;  3TQ9 A;  1F4C A;  3DAT A;  4P3R A;  2RDA A;  2DRC A;  3NTZ A;  3IK1 A;  1RX3 A;  5HPB A;  4O7U A;  1RX9 A;  4M7V A;  3SAI A;  3R33 A;  2HM9 A;  3FY8 X;  3FRB X;  3C0A A;  3IJZ A;  4PST A;  5HI6 A;  3SRW X;  1KZJ A;  1RF7 A;  5EAJ A;  4KBN A;  4XE6 X;  3EJL A;  1BO7 A;  3FQO A;  1NJC A;  1RTS A;  4ELG A;  1BZF A;  4KY8 A;  4FGG A;  4NX6 A;  2AAZ A;  3GHV A;  3DG8 A;  4G3M A;  4UP1 A;  2JYB A;  1I00 A;  4KJJ A;  3SRQ X;  1AIQ A;  2XW7 A;  2CIG A;  1JG0 A;  3SRS X;  1TRG A;  1BKO A;  2LF1 A;  1JOL A;  1OHK A;  3IX9 A;  4H96 A;  1BP0 A;  4HOE A;  4EIG A;  4KJL A;  4XT8 A;  3FRD X;  4H98 A;  4X5I A;  3Q1H A;  3NZD A;  1RX4 A;  3QL0 A;  1JUV A;  2H2Q A;  4OR7 A;  1TSV A;  4FOA A;  2BBQ A;  1VJ3 A;  4Q67 A;  4M7U A;  1DYR A;  4KYA A;  4X5J A;  3FRF X;  4NX7 A; 
#chains in the Genus database with same CATH homology
 4E5O A;  4GYH A;  5HSU A;  4P66 A;  1TSM A;  4EZ8 A;  4M6L A;  1U70 A;  1NJE A;  1BPJ A;  2OBC A;  2VF0 A;  2FZJ A;  1DR1 A;  3EX8 A;  4QHV A;  1DLS A;  2KCE A;  1IA3 A;  1TVU A;  1F4G A;  4XT5 A;  3QYL A;  4P68 A;  1QZF A;  4KNZ A;  2A9W A;  3GHC A;  4PTH A;  2ANO A;  3N5E A;  1MVT A;  3K74 A;  4LAG X;  1QQQ A;  4KJK A;  3SA1 A;  2BLC A;  1JMI A;  3I8A X;  3DRC A;  1EV8 A;  3GH0 A;  2BLB A;  4E28 A;  4PDJ A;  2RD8 A;  3OB7 A;  1NJD A;  4XEC X;  3NZ6 X;  1JMF A;  2W9G A;  3FYV X;  3F0B X;  4ISK A;  3FRA X;  1DHJ A;  2ITH A;  3JTW A;  5HS3 A;  1LY4 A;  4KNE A;  3QGT A;  3EHI X;  1KCE A;  4GH8 A;  2G8A A;  3IRO A;  4KL9 A;  1B49 A;  1KLK A;  3SR5 X;  3F91 A;  2FTQ A;  1DYH A;  3N0H A;  2HXV A;  3FYW X;  4IXE D;  1F4F A;  2FZI A;  3JWF A;  1EVG A;  1DF7 A;  1RE7 A;  1ZPR A;  4RGC A;  3EBU A;  1RA1 A;  1DNA A;  5HVE A;  1HW4 A;  2G8X A;  4G8Z X;  4EIZ A;  1BQ1 A;  3D84 X;  1TSX A;  3B9H A;  3NXY A;  1AOE A;  3BHR A;  1RB3 A;  3IA4 A;  4DDR A;  5FCT A;  1IA4 A;  1S3V A;  1JMH A;  4XRB A;  4EIN A;  3KGY A;  4I1N A;  2D0K A;  3JSU A;  1TVW A;  3DAU A;  1HFQ A;  2CD2 A;  3SRU X;  3TQA A;  1RX6 A;  2W3W A;  2L28 A;  5HT4 A;  4O1X A;  1BOZ A;  1BP6 A;  5DFR A;  1J3J A;  4PSG A;  1RH3 A;  4TU5 X;  1J3J C;  3QFX A;  3CSE A;  3QLY A;  4ECK A;  4IXG X;  1VDR A;  1S3Y A;  4IQB A;  4EB4 A;  3QG2 A;  4QI9 A;  3NRR A;  3UM6 A;  4QLF A;  1BSP A;  1LCE A;  3F0Q X;  3K47 A;  4M2X A;  1VZB A;  1AO8 A;  3NZC X;  1SEJ A;  2ZZA A;  3N5E B;  1DHI A;  3RG9 A;  1BJG A;  2G86 A;  2BLA A;  1BO8 A;  5HF2 X;  1BDU A;  1PDB A;  3SQY X;  5JA3 A;  1DLR A;  1TSN A;  2RD8 B;  3KFY A;  2B3Z A;  3DGA A;  3C06 A;  1CZ3 A;  3EIG A;  3CL9 A;  4TMS A;  3UWL A;  3EEJ A;  4QJZ D;  3DGA C;  4QLG A;  4DFR A;  3IX6 A;  1BSF A;  3JWM A;  4ELH A;  5HVB A;  1S3U A;  1DDR A;  1THY A;  4OSG A;  4LAH X;  4JEF A;  1RX7 A;  4ELE A;  3NZB X;  5U26 A;  4F2V A;  3GG5 A;  4EJ1 A;  1DR7 A;  1DRF A;  1RD7 A;  4G6W X;  3IA5 A;  1FWM A;  2VET A;  1DR2 A;  1RX8 A;  5E8Q A;  4QLE A;  1JOM A;  7DFR A;  3JW5 A;  1TSY A;  1CD2 A;  1RA8 A;  3NZA X;  5FDA A;  3EAW X;  3BZ0 A;  4GD7 A;  5J7W A;  1F4B A;  1JU6 A;  1RA9 A;  3LG4 A;  5H39 A;  2G89 A;  4FGT A;  3GI2 A;  5JG0 X;  3JWK A;  1KZI A;  3FL8 A;  2W9T A;  1AI9 A;  2GD9 A;  1LCB A;  3S3V A;  1TSZ A;  3TQ8 A;  4GEV A;  1HVY A;  3I3R A;  4XSE A;  1E26 A;  3F0V X;  3QLS A;  3SRR X;  2INQ A;  3D80 A;  1TSL A;  3DFR A;  3KY8 A;  3FRE X;  3M08 A;  3NU0 A;  2BL9 A;  3INV A;  3V8H A;  1DG7 A;  1DYJ A;  2FTN A;  3ZPG A;  5HT5 A;  3JVX A;  4KEB A;  1LUD A;  3S7A A;  2KGK A;  3FQ0 A;  5H3A A;  2FTO X;  4O1U A;  1DRB A;  3RO9 A;  1VZE A;  4DP3 A;  5DXV A;  3NZ9 X;  1B5E A;  3NXR A;  2W3M A;  3QLW A;  3BNZ A;  2W9S A;  2TSR A;  3UWL B;  4KM0 A;  3FQF A;  5HQY A;  3HBB A;  2W9H A;  1DAJ A;  1DDS A;  3FY9 X;  4DPD A;  1DYI A;  4FQS A;  2W3V A;  3ED7 A;  1TJS A;  3VCO A;  3IRN A;  3NXO A;  3QLR A;  3NXX A;  3HB8 A;  2QK8 A;  1J3I A;  3B5B A;  4XSC A;  1KMV A;  3F0S X;  1J3I C;  4ISW A;  3FL9 A;  1HW3 A;  3L3R A;  1J3K A;  1RB2 A;  3TQB A;  1U72 A;  3QL3 A;  3EF9 A;  4O1X D;  4XT7 A;  1J3K C;  3BHL A;  3QYO A;  1IA1 A;  4Q0D A;  5CCC A;  3SH2 A;  3OCH A;  1BID A;  3ZPC A;  1U71 A;  4DPH A;  3BFI A;  1TSD A;  3FQV A;  1JMG A;  4XT4 A;  1RA3 A;  3F0U X;  1NJB A;  4H0U A;  2TDD A;  4PTJ A;  3FS6 A;  3FQC A;  4KLX A;  3M09 A;  1RA2 A;  3CD2 A;  4QJC A;  4PSS A;  1IA2 A;  1TIS A;  1LCA A;  2TSC A;  4M6K A;  2HQP A;  3TD8 A;  5H38 A;  5HSR A;  1EV5 A;  4H0R A;  1B5D A;  4LAE X;  1PD9 A;  4CD2 A;  1DRA A;  4KPW A;  4ELF A;  1M7A A;  3K45 A;  3IHI A;  1OHJ A;  1JTQ A;  2C2S A;  2DHF A;  2D5N A;  3NXT A;  2W3B A;  4LEK X;  3EEL A;  3JW3 A;  1HFP A;  4HOG A;  3GHW A;  4G2O X;  1RG7 A;  1TSW A;  3DG8 C;  3IRM A;  4M6J A;  1JUT A;  4X5H A;  5WRN A;  1VZA A;  3SGY A;  1YHO A;  4KAK A;  5HF0 X;  4FGH A;  1M79 A;  1AOB A;  1DG5 A;  1DRH A;  4HA7 A;  1YPV A;  1B02 A;  6DFR A;  1AXW A;  2AZN A;  1BKP A;  1TDC A;  3EEK A;  4H1I A;  1PD8 A;  3F8Z A;  3FQZ A;  4Q0E A;  1TDU A;  2OIP A;  1F4D A;  1HFR A;  4PSY A;  1DR6 A;  1DIU A;  2ANQ A;  1F28 A;  1EVF A;  1JTU A;  3BYX A;  1D1G A;  1AJM A;  4H95 A;  3EDW X;  1AN5 A;  3QJ7 A;  4FHB A;  2C2T A;  3BGX A;  4I13 A;  4ELB A;  4G95 A;  1ZDR A;  1TYS A;  3EGY X;  1DG8 A;  1TLS A;  1BQ2 A;  3UM5 A;  1M78 A;  4FOG A;  8DFR A;  4HOF A;  2W3A A;  3QLX A;  4EIL A;  3TMS A;  1CI7 A;  2ONB A;  1MVS A;  4KFJ A;  2O7P A;  5CC9 A;  2G8D A;  1RC4 A;  1TDB A;  3SA2 A;  3KGB A;  4FOX A;  3OAF A;  1DR5 A;  4H97 A;  1DIS A;  3E0B A;  4XSD A;  3S9U A;  1NJA A;  4P3Q A;  3IK0 A;  5ECC A;  3N5G A;  1HZW A;  4XT6 A;  3JWC A;  1TVV A;  4Q6A A;  1JUJ A;  5HQZ A;  3DL5 A;  3F8Y A;  1DR4 A;  4IXF X;  3QLZ A;  1NCE A;  1TDA A;  3EEM A;  4HA9 A;  1DR3 A;  4LRR A;  1TLC A;  1SYN A;  1DDU A;  1VZD A;  1S3W A;  3F0X X;  2G6V A;  1RX1 A;  4KM2 A;  1KMS A;  3CLB A;  5BY6 A;  3K2H A;  1DRE A;  2FZH A;  1RX2 A;  1TDR A;  3KJS A;  3UM8 A;  3GH2 X;  1F4E A;  4IRR A;  4X5G A;  2TDM A;  3GYF A;  1FFL A;  4IQQ A;  3DL6 A;  5ECX A;  3ROA A;  3H9K A;  4KY4 A;  5HUI A;  4DQ1 A;  1VZC A;  4X5F A;  1DHF A;  3NXV A;  5U27 A;  1LY3 A;  3KJR A;  1RX5 A;  2P4G A;  3HJ3 A;  4KD7 A;  3TQ9 A;  1F4C A;  3DAT A;  4P3R A;  2RDA A;  2DRC A;  3NTZ A;  3IK1 A;  1RX3 A;  5HPB A;  4O7U A;  1RX9 A;  4M7V A;  3SAI A;  3R33 A;  2HM9 A;  3FY8 X;  3FRB X;  3C0A A;  3IJZ A;  4PST A;  5HI6 A;  3SRW X;  1KZJ A;  1RF7 A;  5EAJ A;  4KBN A;  4XE6 X;  3EJL A;  1BO7 A;  3FQO A;  1NJC A;  1RTS A;  4ELG A;  1BZF A;  4KY8 A;  4FGG A;  4NX6 A;  2AAZ A;  3GHV A;  3DG8 A;  4G3M A;  4UP1 A;  2JYB A;  1I00 A;  4KJJ A;  3SRQ X;  1AIQ A;  2XW7 A;  2CIG A;  1JG0 A;  3SRS X;  1TRG A;  1BKO A;  2LF1 A;  1JOL A;  1OHK A;  3IX9 A;  4H96 A;  1BP0 A;  4HOE A;  4EIG A;  4KJL A;  4XT8 A;  3FRD X;  4H98 A;  4X5I A;  3Q1H A;  3NZD A;  1RX4 A;  3QL0 A;  1JUV A;  2H2Q A;  4OR7 A;  1TSV A;  4FOA A;  2BBQ A;  1VJ3 A;  4Q67 A;  4M7U A;  1DYR A;  4KYA A;  4X5J A;  3FRF X;  4NX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...