4DP3A

Quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with p218 and nadph
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
606
structure length
545
Chain Sequence
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase, transferase/inhibitor
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title Malarial dihydrofolate reductase as a paradigm for drug development against a resistance-compromised target
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 182
structure length 545
sequence length 606
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4dp3A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4dp3A01
2HM9A 3SRRX 5JG0X 3N0HA 3BYXA 2W3WA 1LY3A 4FGGA 4KFJA 3GH2X 3S3VA 4EJ1A 2ITHA 4G6WX 1DRFA 1TVWA 1U70A 3QLRA 3F91A 3SRQX 1J3KA 1TSLA 3FRAX 3FRFX 3TQAA 1JTUA 1D1GA 1PD8A 4XSDA 4FQSA 3KY8A 1KZIA 3I3RA 2XW7A 3FREX 2RD8B 1TSXA 1DR1A 3QLXA 3GHVA 1DLRA 2AZNA 1RX2A 4P66A 4X5FA 4XECX 3TMSA 2W3AA 3SAIA 1FWMA 1NJCA 2W9GA 1TSVA 3SRUX 1NJEA 3FQVA 4FGTA 5BY6A 4KAKA 1BO8A 3QL0A 2W3MA 1ZDRA 4ELHA 3NZAX 1JMFA 4G95A 2G89A 1DR3A 1B5DA 4IQBA 2DRCA 3EELA 4M6JA 2ONBA 1BJGA 4F2VA 1AOBA 1JU6A 1DISA 3EEMA 4H95A 1KMVA 1M7AA 1BKOA 4PDJA 1SEJA 2LF1A 3IX6A 4FOXA 1U71A 5H3AA 4ISKA 3DRCA 1RX8A 2HQPA 1DF7A 4PSYA 3FY9X 2FTNA 4EB4A 3JW3A 1DR4A 4IXGX 1RC4A 5H39A 1RX3A 2W9TA 1AI9A 3OCHA 1RF7A 1RX7A 3FS6A 2INQA 1LCAA 2KGKA 4RGCA 2A9WA 1JMIA 2G8AA 1IA2A 2DHFA 3DG8C 1JOLA 1AIQA 4ELGA 4KYAA 3KJRA 5HI6A 4O1XA 5HS3A 4P3RA 4E5OA 5HQYA 3CL9A 3FQZA 3QYOA 4G3MA 1EVGA 4ISWA 3FYVX 1TSMA 3V8HA 1PDBA 1MVTA 3I8AX 3FYWX 4DDRA 3UM8A 3RG9A 3GHWA 4G8ZX 1S3WA 5HF0X 1DYHA 3TQ8A 4IQQA 3IK1A 3JWCA 2OIPA 3F0SX 3NZCX 1DYJA 2BL9A 1FFLA 3DG8A 1DR7A 4HOFA 1BOZA 1RX4A 1I00A 3QLWA 1YPVA 1DRHA 3NZ6X 4QLFA 3E0BA 1J3KC 1F4GA 4TMSA 1LUDA 1RE7A 1BQ2A 2KCEA 1S3VA 4EIGA 3BHLA 1AN5A 1HZWA 2G8DA 4I13A 4X5GA 2BBQA 4GYHA 3KGYA 1BKPA 1AO8A 4KY8A 4HA9A 1HVYA 3NXXA 1KMSA 3ED7A 3FY8X 3BNZA 3B5BA 4KJKA 3SH2A 1RA2A 1EV8A 1RB3A 4HOGA 6DFRA 3DAUA 2G6VA 3ROAA 1TSNA 3TQ9A 1VZCA 1TSWA 4OSGA 1DYRA 3Q1HA 4H0RA 1BZFA 1AXWA 3BGXA 1PD9A 1BO7A 3K45A 1TISA 2W3BA 1F4CA 3EF9A 3OAFA 1SYNA 3UM5A 1RA9A 2VF0A 2L28A 4LRRA 2TSCA 2G86A 4PTJA 5JA3A 3IRNA 4EILA 3EDWX 4QJCA 4KJJA 3NXRA 4DFRA 4FGHA 3DL5A 5H38A 1DREA 4IXFX 1TRGA 4HA7A 1F28A 4KNZA 2W9SA 1DYIA 3JSUA 1B5EA 3GI2A 1TLCA 1VZAA 3CLBA 3ZPCA 4LAGX 4XT4A 1BP6A 3NTZA 4GH8A 4EZ8A 1JMHA 5ECCA 1DNAA 4XE6X 4M7UA 1RTSA 1TDCA 3TQBA 1RG7A 2CD2A 1IA1A 4KD7A 1F4FA 1TLSA 5ECXA 1JUTA 2C2SA 1TSDA 3UM6A 3NXTA 4PTHA 1AOEA 1IA3A 4XT7A 3NXVA 4M6LA 3C06A 4LAHX 2O7PA 3M08A 3H9KA 4KY4A 4ELEA 4EIZA 4O1UA 4UP1A 1TVVA 1BP0A 3JWMA 3NZBX 2BLBA 3JWFA 2TDDA 3K74A 3IJZA 1ZPRA 1JTQA 4JEFA 3N5EA 1NJBA 4KM2A 1DR6A 4DPHA 3F0UX 4DPDA 3QL3A 3SA2A 4X5HA 3IX9A 1J3JC 4KM0A 1EV5A 3FQCA 3FQFA 4DQ1A 4KBNA 1QZFA 1MVSA 1S3UA 3LG4A 3K47A 1YHOA 3EAWX 1VZEA 2FTQA 5DFRA 1E26A 1TDAA 5HT4A 5HSUA 2HXVA 3K2HA 1BSPA 3SR5X 4ECKA 1DAJA 1HFQA 2W3VA 5HF2X 1DHJA 2ZZAA 1BIDA 1TYSA 1LY4A 2D0KA 1HFRA 3JTWA 3L3RA 1CI7A 4M7VA 1HW3A 5CC9A 5FCTA 1J3JA 3IA4A 1BDUA 2C2TA 2FZHA 1JMGA 3C0AA 4TU5X 1DDUA 4NX7A 1KZJA 4O7UA 3VCOA 4KJLA 4LEKX 1BQ1A 3B9HA 1DG7A 2FZJA 3DATA 3NRRA 1CD2A 1RH3A 1B02A 3QFXA 1BSFA 4H98A 2H2QA 4GEVA 3M09A 4X5IA 3R33A 4FHBA 5HVEA 4DP3A 1DDRA 1VDRA 3JW5A 3NU0A 3HJ3A 3JVXA 3NZ9X 4XT6A 4QLEA 3SGYA 3OB7A 4H1IA 3S7AA 3QJ7A 3HBBA 3GG5A 4KPWA 1RX6A 3N5EB 4IXED 4ELBA 1RA3A 1TJSA 5U26A 1JUJA 4QLGA 4H96A 1DG5A 4KLXA 1DHFA 3S9UA 1QQQA 3FQ0A 5HUIA 4X5JA 5WRNA 3UWLA 2BLCA 1TVUA 1TDUA 4I1NA 4IRRA 3F8ZA 3D80A 1IA4A 1DG8A 4G2OX 1TDRA 1JOMA 3CD2A 3D84X 3JWKA 3DGAA 3EGYX 4E28A 1DR5A 1VJ3A 3F8YA 4Q67A 5J7WA 4QI9A 8DFRA 3CSEA 3KJSA 4XSCA 5HSRA 3BFIA 3DFRA 1AJMA 4QJZD 4NX6A 5EAJA 3FRDX 3NXYA 3F0QX 1TDBA 3QLSA 3EX8A 4XRBA 1KCEA 3IK0A 1DRAA 1M79A 1J3IC 2ANQA 3FRBX 7DFRA 4QHVA 1OHKA 5U27A 1RB2A 1U72A 2G8XA 1KLKA 4KL9A 4EINA 4ELFA 4KEBA 3BZ0A 2BLAA 3EHIX 3GYFA 5CCCA 4LAEX 4H97A 1BPJA 3HB8A 1DDSA 4OR7A 1RA8A 3QLZA 2AAZA 5HVBA 1F4EA 1NCEA 2ANOA 3IROA 3NXOA 4XSEA 1CZ3A 1NJDA 1J3IA 4FOAA 3NZDA 5E8QA 3IA5A 4HOEA 1JUVA 1DHIA 2TDMA 3KFYA 1DLSA 2B3ZA 5HT5A 2RD8A 5FDAA 3IRMA 4Q0EA 2RDAA 1DIUA 4O1XD 4P68A 4M2XA 1VZBA 3FL9A 3FL8A 1DRBA 2FZIA 1LCBA 3SRSX 1HW4A 3N5GA 4PSSA 3DL6A 2VETA 3ZPGA 4CD2A 4Q6AA 3EIGA 3INVA 3UWLB 4XT5A 1B49A 3SRWX 5HPBA 3GH0A 1S3YA 3F0VX 1TSZA 2GD9A 1OHJA 3F0BX 1RA1A 1DR2A 5DXVA 1TSYA 4M6KA 4PSTA 1NJAA 4PSGA 3QYLA 3F0XX 3RO9A 2TSRA 2W9HA 5HQZA 2FTOX 1LCEA 3FQOA 3EEKA 4XT8A 2CIGA 3SQYX 3EJLA 1RX1A 1EVFA 1VZDA 2P4GA 4KNEA 4Q0DA 3GHCA 1M78A 3TD8A 1RD7A 3EEJA 2JYBA 3QG2A 1F4BA 4GD7A 2QK8A 1HFPA 2D5NA 3SA1A 3EBUA 1JG0A 2OBCA 4P3QA 3QGTA 1F4DA 3KGBA 4H0UA 3QLYA 4FOGA 1RX5A 3BHRA 1RX9A 3IHIA 3DGAC 1THYA
chains in the Genus database with same CATH superfamily
2HM9A 3SRRX 5JG0X 3N0HA 3BYXA 2W3WA 1LY3A 4FGGA 4KFJA 3GH2X 3S3VA 4EJ1A 2ITHA 4G6WX 1DRFA 1TVWA 1U70A 3QLRA 3F91A 3SRQX 1J3KA 1TSLA 3FRAX 3FRFX 3TQAA 1JTUA 1D1GA 1PD8A 4XSDA 4FQSA 3KY8A 1KZIA 3I3RA 2XW7A 3FREX 2RD8B 1TSXA 1DR1A 3QLXA 3GHVA 1DLRA 2AZNA 1RX2A 4P66A 4X5FA 4XECX 3TMSA 2W3AA 3SAIA 1FWMA 1NJCA 2W9GA 1TSVA 3SRUX 1NJEA 3FQVA 4FGTA 5BY6A 4KAKA 1BO8A 3QL0A 2W3MA 1ZDRA 4ELHA 3NZAX 1JMFA 4G95A 2G89A 1DR3A 1B5DA 4IQBA 2DRCA 3EELA 4M6JA 2ONBA 1BJGA 4F2VA 1AOBA 1JU6A 1DISA 3EEMA 4H95A 1KMVA 1M7AA 1BKOA 4PDJA 1SEJA 2LF1A 3IX6A 4FOXA 1U71A 5H3AA 4ISKA 3DRCA 1RX8A 2HQPA 1DF7A 4PSYA 3FY9X 2FTNA 4EB4A 3JW3A 1DR4A 4IXGX 1RC4A 5H39A 1RX3A 2W9TA 1AI9A 3OCHA 1RF7A 1RX7A 3FS6A 2INQA 1LCAA 2KGKA 4RGCA 2A9WA 1JMIA 2G8AA 1IA2A 2DHFA 3DG8C 1JOLA 1AIQA 4ELGA 4KYAA 3KJRA 5HI6A 4O1XA 5HS3A 4P3RA 4E5OA 5HQYA 3CL9A 3FQZA 3QYOA 4G3MA 1EVGA 4ISWA 3FYVX 1TSMA 3V8HA 1PDBA 1MVTA 3I8AX 3FYWX 4DDRA 3UM8A 3RG9A 3GHWA 4G8ZX 1S3WA 5HF0X 1DYHA 3TQ8A 4IQQA 3IK1A 3JWCA 2OIPA 3F0SX 3NZCX 1DYJA 2BL9A 1FFLA 3DG8A 1DR7A 4HOFA 1BOZA 1RX4A 1I00A 3QLWA 1YPVA 1DRHA 3NZ6X 4QLFA 3E0BA 1J3KC 1F4GA 4TMSA 1LUDA 1RE7A 1BQ2A 2KCEA 1S3VA 4EIGA 3BHLA 1AN5A 1HZWA 2G8DA 4I13A 4X5GA 2BBQA 4GYHA 3KGYA 1BKPA 1AO8A 4KY8A 4HA9A 1HVYA 3NXXA 1KMSA 3ED7A 3FY8X 3BNZA 3B5BA 4KJKA 3SH2A 1RA2A 1EV8A 1RB3A 4HOGA 6DFRA 3DAUA 2G6VA 3ROAA 1TSNA 3TQ9A 1VZCA 1TSWA 4OSGA 1DYRA 3Q1HA 4H0RA 1BZFA 1AXWA 3BGXA 1PD9A 1BO7A 3K45A 1TISA 2W3BA 1F4CA 3EF9A 3OAFA 1SYNA 3UM5A 1RA9A 2VF0A 2L28A 4LRRA 2TSCA 2G86A 4PTJA 5JA3A 3IRNA 4EILA 3EDWX 4QJCA 4KJJA 3NXRA 4DFRA 4FGHA 3DL5A 5H38A 1DREA 4IXFX 1TRGA 4HA7A 1F28A 4KNZA 2W9SA 1DYIA 3JSUA 1B5EA 3GI2A 1TLCA 1VZAA 3CLBA 3ZPCA 4LAGX 4XT4A 1BP6A 3NTZA 4GH8A 4EZ8A 1JMHA 5ECCA 1DNAA 4XE6X 4M7UA 1RTSA 1TDCA 3TQBA 1RG7A 2CD2A 1IA1A 4KD7A 1F4FA 1TLSA 5ECXA 1JUTA 2C2SA 1TSDA 3UM6A 3NXTA 4PTHA 1AOEA 1IA3A 4XT7A 3NXVA 4M6LA 3C06A 4LAHX 2O7PA 3M08A 3H9KA 4KY4A 4ELEA 4EIZA 4O1UA 4UP1A 1TVVA 1BP0A 3JWMA 3NZBX 2BLBA 3JWFA 2TDDA 3K74A 3IJZA 1ZPRA 1JTQA 4JEFA 3N5EA 1NJBA 4KM2A 1DR6A 4DPHA 3F0UX 4DPDA 3QL3A 3SA2A 4X5HA 3IX9A 1J3JC 4KM0A 1EV5A 3FQCA 3FQFA 4DQ1A 4KBNA 1QZFA 1MVSA 1S3UA 3LG4A 3K47A 1YHOA 3EAWX 1VZEA 2FTQA 5DFRA 1E26A 1TDAA 5HT4A 5HSUA 2HXVA 3K2HA 1BSPA 3SR5X 4ECKA 1DAJA 1HFQA 2W3VA 5HF2X 1DHJA 2ZZAA 1BIDA 1TYSA 1LY4A 2D0KA 1HFRA 3JTWA 3L3RA 1CI7A 4M7VA 1HW3A 5CC9A 5FCTA 1J3JA 3IA4A 1BDUA 2C2TA 2FZHA 1JMGA 3C0AA 4TU5X 1DDUA 4NX7A 1KZJA 4O7UA 3VCOA 4KJLA 4LEKX 1BQ1A 3B9HA 1DG7A 2FZJA 3DATA 3NRRA 1CD2A 1RH3A 1B02A 3QFXA 1BSFA 4H98A 2H2QA 4GEVA 3M09A 4X5IA 3R33A 4FHBA 5HVEA 4DP3A 1DDRA 1VDRA 3JW5A 3NU0A 3HJ3A 3JVXA 3NZ9X 4XT6A 4QLEA 3SGYA 3OB7A 4H1IA 3S7AA 3QJ7A 3HBBA 3GG5A 4KPWA 1RX6A 3N5EB 4IXED 4ELBA 1RA3A 1TJSA 5U26A 1JUJA 4QLGA 4H96A 1DG5A 4KLXA 1DHFA 3S9UA 1QQQA 3FQ0A 5HUIA 4X5JA 5WRNA 3UWLA 2BLCA 1TVUA 1TDUA 4I1NA 4IRRA 3F8ZA 3D80A 1IA4A 1DG8A 4G2OX 1TDRA 1JOMA 3CD2A 3D84X 3JWKA 3DGAA 3EGYX 4E28A 1DR5A 1VJ3A 3F8YA 4Q67A 5J7WA 4QI9A 8DFRA 3CSEA 3KJSA 4XSCA 5HSRA 3BFIA 3DFRA 1AJMA 4QJZD 4NX6A 5EAJA 3FRDX 3NXYA 3F0QX 1TDBA 3QLSA 3EX8A 4XRBA 1KCEA 3IK0A 1DRAA 1M79A 1J3IC 2ANQA 3FRBX 7DFRA 4QHVA 1OHKA 5U27A 1RB2A 1U72A 2G8XA 1KLKA 4KL9A 4EINA 4ELFA 4KEBA 3BZ0A 2BLAA 3EHIX 3GYFA 5CCCA 4LAEX 4H97A 1BPJA 3HB8A 1DDSA 4OR7A 1RA8A 3QLZA 2AAZA 5HVBA 1F4EA 1NCEA 2ANOA 3IROA 3NXOA 4XSEA 1CZ3A 1NJDA 1J3IA 4FOAA 3NZDA 5E8QA 3IA5A 4HOEA 1JUVA 1DHIA 2TDMA 3KFYA 1DLSA 2B3ZA 5HT5A 2RD8A 5FDAA 3IRMA 4Q0EA 2RDAA 1DIUA 4O1XD 4P68A 4M2XA 1VZBA 3FL9A 3FL8A 1DRBA 2FZIA 1LCBA 3SRSX 1HW4A 3N5GA 4PSSA 3DL6A 2VETA 3ZPGA 4CD2A 4Q6AA 3EIGA 3INVA 3UWLB 4XT5A 1B49A 3SRWX 5HPBA 3GH0A 1S3YA 3F0VX 1TSZA 2GD9A 1OHJA 3F0BX 1RA1A 1DR2A 5DXVA 1TSYA 4M6KA 4PSTA 1NJAA 4PSGA 3QYLA 3F0XX 3RO9A 2TSRA 2W9HA 5HQZA 2FTOX 1LCEA 3FQOA 3EEKA 4XT8A 2CIGA 3SQYX 3EJLA 1RX1A 1EVFA 1VZDA 2P4GA 4KNEA 4Q0DA 3GHCA 1M78A 3TD8A 1RD7A 3EEJA 2JYBA 3QG2A 1F4BA 4GD7A 2QK8A 1HFPA 2D5NA 3SA1A 3EBUA 1JG0A 2OBCA 4P3QA 3QGTA 1F4DA 3KGBA 4H0UA 3QLYA 4FOGA 1RX5A 3BHRA 1RX9A 3IHIA 3DGAC 1THYA
chains in the Genus database with same CATH topology
2HM9A 3SRRX 5JG0X 3N0HA 3BYXA 2W3WA 1LY3A 4FGGA 4KFJA 3GH2X 3S3VA 4EJ1A 2ITHA 4G6WX 1DRFA 1TVWA 1U70A 3QLRA 3F91A 3SRQX 1J3KA 1TSLA 3FRAX 3FRFX 3TQAA 1JTUA 1D1GA 1PD8A 4XSDA 4FQSA 3KY8A 1KZIA 3I3RA 2XW7A 3FREX 2RD8B 1TSXA 1DR1A 3QLXA 3GHVA 1DLRA 2AZNA 1RX2A 4P66A 4X5FA 4XECX 3TMSA 2W3AA 3SAIA 1FWMA 1NJCA 2W9GA 1TSVA 3SRUX 1NJEA 3FQVA 4FGTA 5BY6A 4KAKA 1BO8A 3QL0A 2W3MA 1ZDRA 4ELHA 3NZAX 1JMFA 4G95A 2G89A 1DR3A 1B5DA 4IQBA 2DRCA 3EELA 4M6JA 2ONBA 1BJGA 4F2VA 1AOBA 1JU6A 1DISA 3EEMA 4H95A 1KMVA 1M7AA 1BKOA 4PDJA 1SEJA 2LF1A 3IX6A 4FOXA 1U71A 5H3AA 4ISKA 3DRCA 1RX8A 2HQPA 1DF7A 4PSYA 3FY9X 2FTNA 4EB4A 3JW3A 1DR4A 4IXGX 1RC4A 5H39A 1RX3A 2W9TA 1AI9A 3OCHA 1RF7A 1RX7A 3FS6A 2INQA 1LCAA 2KGKA 4RGCA 2A9WA 1JMIA 2G8AA 1IA2A 2DHFA 3DG8C 1JOLA 1AIQA 4ELGA 4KYAA 3KJRA 5HI6A 4O1XA 5HS3A 4P3RA 4E5OA 5HQYA 3CL9A 3FQZA 3QYOA 4G3MA 1EVGA 4ISWA 3FYVX 1TSMA 3V8HA 1PDBA 1MVTA 3I8AX 3FYWX 4DDRA 3UM8A 3RG9A 3GHWA 4G8ZX 1S3WA 5HF0X 1DYHA 3TQ8A 4IQQA 3IK1A 3JWCA 2OIPA 3F0SX 3NZCX 1DYJA 2BL9A 1FFLA 3DG8A 1DR7A 4HOFA 1BOZA 1RX4A 1I00A 3QLWA 1YPVA 1DRHA 3NZ6X 4QLFA 3E0BA 1J3KC 1F4GA 4TMSA 1LUDA 1RE7A 1BQ2A 2KCEA 1S3VA 4EIGA 3BHLA 1AN5A 1HZWA 2G8DA 4I13A 4X5GA 2BBQA 4GYHA 3KGYA 1BKPA 1AO8A 4KY8A 4HA9A 1HVYA 3NXXA 1KMSA 3ED7A 3FY8X 3BNZA 3B5BA 4KJKA 3SH2A 1RA2A 1EV8A 1RB3A 4HOGA 6DFRA 3DAUA 2G6VA 3ROAA 1TSNA 3TQ9A 1VZCA 1TSWA 4OSGA 1DYRA 3Q1HA 4H0RA 1BZFA 1AXWA 3BGXA 1PD9A 1BO7A 3K45A 1TISA 2W3BA 1F4CA 3EF9A 3OAFA 1SYNA 3UM5A 1RA9A 2VF0A 2L28A 4LRRA 2TSCA 2G86A 4PTJA 5JA3A 3IRNA 4EILA 3EDWX 4QJCA 4KJJA 3NXRA 4DFRA 4FGHA 3DL5A 5H38A 1DREA 4IXFX 1TRGA 4HA7A 1F28A 4KNZA 2W9SA 1DYIA 3JSUA 1B5EA 3GI2A 1TLCA 1VZAA 3CLBA 3ZPCA 4LAGX 4XT4A 1BP6A 3NTZA 4GH8A 4EZ8A 1JMHA 5ECCA 1DNAA 4XE6X 4M7UA 1RTSA 1TDCA 3TQBA 1RG7A 2CD2A 1IA1A 4KD7A 1F4FA 1TLSA 5ECXA 1JUTA 2C2SA 1TSDA 3UM6A 3NXTA 4PTHA 1AOEA 1IA3A 4XT7A 3NXVA 4M6LA 3C06A 4LAHX 2O7PA 3M08A 3H9KA 4KY4A 4ELEA 4EIZA 4O1UA 4UP1A 1TVVA 1BP0A 3JWMA 3NZBX 2BLBA 3JWFA 2TDDA 3K74A 3IJZA 1ZPRA 1JTQA 4JEFA 3N5EA 1NJBA 4KM2A 1DR6A 4DPHA 3F0UX 4DPDA 3QL3A 3SA2A 4X5HA 3IX9A 1J3JC 4KM0A 1EV5A 3FQCA 3FQFA 4DQ1A 4KBNA 1QZFA 1MVSA 1S3UA 3LG4A 3K47A 1YHOA 3EAWX 1VZEA 2FTQA 5DFRA 1E26A 1TDAA 5HT4A 5HSUA 2HXVA 3K2HA 1BSPA 3SR5X 4ECKA 1DAJA 1HFQA 2W3VA 5HF2X 1DHJA 2ZZAA 1BIDA 1TYSA 1LY4A 2D0KA 1HFRA 3JTWA 3L3RA 1CI7A 4M7VA 1HW3A 5CC9A 5FCTA 1J3JA 3IA4A 1BDUA 2C2TA 2FZHA 1JMGA 3C0AA 4TU5X 1DDUA 4NX7A 1KZJA 4O7UA 3VCOA 4KJLA 4LEKX 1BQ1A 3B9HA 1DG7A 2FZJA 3DATA 3NRRA 1CD2A 1RH3A 1B02A 3QFXA 1BSFA 4H98A 2H2QA 4GEVA 3M09A 4X5IA 3R33A 4FHBA 5HVEA 4DP3A 1DDRA 1VDRA 3JW5A 3NU0A 3HJ3A 3JVXA 3NZ9X 4XT6A 4QLEA 3SGYA 3OB7A 4H1IA 3S7AA 3QJ7A 3HBBA 3GG5A 4KPWA 1RX6A 3N5EB 4IXED 4ELBA 1RA3A 1TJSA 5U26A 1JUJA 4QLGA 4H96A 1DG5A 4KLXA 1DHFA 3S9UA 1QQQA 3FQ0A 5HUIA 4X5JA 5WRNA 3UWLA 2BLCA 1TVUA 1TDUA 4I1NA 4IRRA 3F8ZA 3D80A 1IA4A 1DG8A 4G2OX 1TDRA 1JOMA 3CD2A 3D84X 3JWKA 3DGAA 3EGYX 4E28A 1DR5A 1VJ3A 3F8YA 4Q67A 5J7WA 4QI9A 8DFRA 3CSEA 3KJSA 4XSCA 5HSRA 3BFIA 3DFRA 1AJMA 4QJZD 4NX6A 5EAJA 3FRDX 3NXYA 3F0QX 1TDBA 3QLSA 3EX8A 4XRBA 1KCEA 3IK0A 1DRAA 1M79A 1J3IC 2ANQA 3FRBX 7DFRA 4QHVA 1OHKA 5U27A 1RB2A 1U72A 2G8XA 1KLKA 4KL9A 4EINA 4ELFA 4KEBA 3BZ0A 2BLAA 3EHIX 3GYFA 5CCCA 4LAEX 4H97A 1BPJA 3HB8A 1DDSA 4OR7A 1RA8A 3QLZA 2AAZA 5HVBA 1F4EA 1NCEA 2ANOA 3IROA 3NXOA 4XSEA 1CZ3A 1NJDA 1J3IA 4FOAA 3NZDA 5E8QA 3IA5A 4HOEA 1JUVA 1DHIA 2TDMA 3KFYA 1DLSA 2B3ZA 5HT5A 2RD8A 5FDAA 3IRMA 4Q0EA 2RDAA 1DIUA 4O1XD 4P68A 4M2XA 1VZBA 3FL9A 3FL8A 1DRBA 2FZIA 1LCBA 3SRSX 1HW4A 3N5GA 4PSSA 3DL6A 2VETA 3ZPGA 4CD2A 4Q6AA 3EIGA 3INVA 3UWLB 4XT5A 1B49A 3SRWX 5HPBA 3GH0A 1S3YA 3F0VX 1TSZA 2GD9A 1OHJA 3F0BX 1RA1A 1DR2A 5DXVA 1TSYA 4M6KA 4PSTA 1NJAA 4PSGA 3QYLA 3F0XX 3RO9A 2TSRA 2W9HA 5HQZA 2FTOX 1LCEA 3FQOA 3EEKA 4XT8A 2CIGA 3SQYX 3EJLA 1RX1A 1EVFA 1VZDA 2P4GA 4KNEA 4Q0DA 3GHCA 1M78A 3TD8A 1RD7A 3EEJA 2JYBA 3QG2A 1F4BA 4GD7A 2QK8A 1HFPA 2D5NA 3SA1A 3EBUA 1JG0A 2OBCA 4P3QA 3QGTA 1F4DA 3KGBA 4H0UA 3QLYA 4FOGA 1RX5A 3BHRA 1RX9A 3IHIA 3DGAC 1THYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HM9 A;  3SRR X;  5JG0 X;  3N0H A;  3BYX A;  2W3W A;  1LY3 A;  4FGG A;  4KFJ A;  3GH2 X;  3S3V A;  4EJ1 A;  2ITH A;  4G6W X;  1DRF A;  1TVW A;  1U70 A;  3QLR A;  3F91 A;  3SRQ X;  1J3K A;  1TSL A;  3FRA X;  3FRF X;  3TQA A;  1JTU A;  1D1G A;  1PD8 A;  4XSD A;  4FQS A;  3KY8 A;  1KZI A;  3I3R A;  2XW7 A;  3FRE X;  2RD8 B;  1TSX A;  1DR1 A;  3QLX A;  3GHV A;  1DLR A;  2AZN A;  1RX2 A;  4P66 A;  4X5F A;  4XEC X;  3TMS A;  2W3A A;  3SAI A;  1FWM A;  1NJC A;  2W9G A;  1TSV A;  3SRU X;  1NJE A;  3FQV A;  4FGT A;  5BY6 A;  4KAK A;  1BO8 A;  3QL0 A;  2W3M A;  1ZDR A;  4ELH A;  3NZA X;  1JMF A;  4G95 A;  2G89 A;  1DR3 A;  1B5D A;  4IQB A;  2DRC A;  3EEL A;  4M6J A;  2ONB A;  1BJG A;  4F2V A;  1AOB A;  1JU6 A;  1DIS A;  3EEM A;  4H95 A;  1KMV A;  1M7A A;  1BKO A;  4PDJ A;  1SEJ A;  2LF1 A;  3IX6 A;  4FOX A;  1U71 A;  5H3A A;  4ISK A;  3DRC A;  1RX8 A;  2HQP A;  1DF7 A;  4PSY A;  3FY9 X;  2FTN A;  4EB4 A;  3JW3 A;  1DR4 A;  4IXG X;  1RC4 A;  5H39 A;  1RX3 A;  2W9T A;  1AI9 A;  3OCH A;  1RF7 A;  1RX7 A;  3FS6 A;  2INQ A;  1LCA A;  2KGK A;  4RGC A;  2A9W A;  1JMI A;  2G8A A;  1IA2 A;  2DHF A;  3DG8 C;  1JOL A;  1AIQ A;  4ELG A;  4KYA A;  3KJR A;  5HI6 A;  4O1X A;  5HS3 A;  4P3R A;  4E5O A;  5HQY A;  3CL9 A;  3FQZ A;  3QYO A;  4G3M A;  1EVG A;  4ISW A;  3FYV X;  1TSM A;  3V8H A;  1PDB A;  1MVT A;  3I8A X;  3FYW X;  4DDR A;  3UM8 A;  3RG9 A;  3GHW A;  4G8Z X;  1S3W A;  5HF0 X;  1DYH A;  3TQ8 A;  4IQQ A;  3IK1 A;  3JWC A;  2OIP A;  3F0S X;  3NZC X;  1DYJ A;  2BL9 A;  1FFL A;  3DG8 A;  1DR7 A;  4HOF A;  1BOZ A;  1RX4 A;  1I00 A;  3QLW A;  1YPV A;  1DRH A;  3NZ6 X;  4QLF A;  3E0B A;  1J3K C;  1F4G A;  4TMS A;  1LUD A;  1RE7 A;  1BQ2 A;  2KCE A;  1S3V A;  4EIG A;  3BHL A;  1AN5 A;  1HZW A;  2G8D A;  4I13 A;  4X5G A;  2BBQ A;  4GYH A;  3KGY A;  1BKP A;  1AO8 A;  4KY8 A;  4HA9 A;  1HVY A;  3NXX A;  1KMS A;  3ED7 A;  3FY8 X;  3BNZ A;  3B5B A;  4KJK A;  3SH2 A;  1RA2 A;  1EV8 A;  1RB3 A;  4HOG A;  6DFR A;  3DAU A;  2G6V A;  3ROA A;  1TSN A;  3TQ9 A;  1VZC A;  1TSW A;  4OSG A;  1DYR A;  3Q1H A;  4H0R A;  1BZF A;  1AXW A;  3BGX A;  1PD9 A;  1BO7 A;  3K45 A;  1TIS A;  2W3B A;  1F4C A;  3EF9 A;  3OAF A;  1SYN A;  3UM5 A;  1RA9 A;  2VF0 A;  2L28 A;  4LRR A;  2TSC A;  2G86 A;  4PTJ A;  5JA3 A;  3IRN A;  4EIL A;  3EDW X;  4QJC A;  4KJJ A;  3NXR A;  4DFR A;  4FGH A;  3DL5 A;  5H38 A;  1DRE A;  4IXF X;  1TRG A;  4HA7 A;  1F28 A;  4KNZ A;  2W9S A;  1DYI A;  3JSU A;  1B5E A;  3GI2 A;  1TLC A;  1VZA A;  3CLB A;  3ZPC A;  4LAG X;  4XT4 A;  1BP6 A;  3NTZ A;  4GH8 A;  4EZ8 A;  1JMH A;  5ECC A;  1DNA A;  4XE6 X;  4M7U A;  1RTS A;  1TDC A;  3TQB A;  1RG7 A;  2CD2 A;  1IA1 A;  4KD7 A;  1F4F A;  1TLS A;  5ECX A;  1JUT A;  2C2S A;  1TSD A;  3UM6 A;  3NXT A;  4PTH A;  1AOE A;  1IA3 A;  4XT7 A;  3NXV A;  4M6L A;  3C06 A;  4LAH X;  2O7P A;  3M08 A;  3H9K A;  4KY4 A;  4ELE A;  4EIZ A;  4O1U A;  4UP1 A;  1TVV A;  1BP0 A;  3JWM A;  3NZB X;  2BLB A;  3JWF A;  2TDD A;  3K74 A;  3IJZ A;  1ZPR A;  1JTQ A;  4JEF A;  3N5E A;  1NJB A;  4KM2 A;  1DR6 A;  4DPH A;  3F0U X;  4DPD A;  3QL3 A;  3SA2 A;  4X5H A;  3IX9 A;  1J3J C;  4KM0 A;  1EV5 A;  3FQC A;  3FQF A;  4DQ1 A;  4KBN A;  1QZF A;  1MVS A;  1S3U A;  3LG4 A;  3K47 A;  1YHO A;  3EAW X;  1VZE A;  2FTQ A;  5DFR A;  1E26 A;  1TDA A;  5HT4 A;  5HSU A;  2HXV A;  3K2H A;  1BSP A;  3SR5 X;  4ECK A;  1DAJ A;  1HFQ A;  2W3V A;  5HF2 X;  1DHJ A;  2ZZA A;  1BID A;  1TYS A;  1LY4 A;  2D0K A;  1HFR A;  3JTW A;  3L3R A;  1CI7 A;  4M7V A;  1HW3 A;  5CC9 A;  5FCT A;  1J3J A;  3IA4 A;  1BDU A;  2C2T A;  2FZH A;  1JMG A;  3C0A A;  4TU5 X;  1DDU A;  4NX7 A;  1KZJ A;  4O7U A;  3VCO A;  4KJL A;  4LEK X;  1BQ1 A;  3B9H A;  1DG7 A;  2FZJ A;  3DAT A;  3NRR A;  1CD2 A;  1RH3 A;  1B02 A;  3QFX A;  1BSF A;  4H98 A;  2H2Q A;  4GEV A;  3M09 A;  4X5I A;  3R33 A;  4FHB A;  5HVE A;  4DP3 A;  1DDR A;  1VDR A;  3JW5 A;  3NU0 A;  3HJ3 A;  3JVX A;  3NZ9 X;  4XT6 A;  4QLE A;  3SGY A;  3OB7 A;  4H1I A;  3S7A A;  3QJ7 A;  3HBB A;  3GG5 A;  4KPW A;  1RX6 A;  3N5E B;  4IXE D;  4ELB A;  1RA3 A;  1TJS A;  5U26 A;  1JUJ A;  4QLG A;  4H96 A;  1DG5 A;  4KLX A;  1DHF A;  3S9U A;  1QQQ A;  3FQ0 A;  5HUI A;  4X5J A;  5WRN A;  3UWL A;  2BLC A;  1TVU A;  1TDU A;  4I1N A;  4IRR A;  3F8Z A;  3D80 A;  1IA4 A;  1DG8 A;  4G2O X;  1TDR A;  1JOM A;  3CD2 A;  3D84 X;  3JWK A;  3DGA A;  3EGY X;  4E28 A;  1DR5 A;  1VJ3 A;  3F8Y A;  4Q67 A;  5J7W A;  4QI9 A;  8DFR A;  3CSE A;  3KJS A;  4XSC A;  5HSR A;  3BFI A;  3DFR A;  1AJM A;  4QJZ D;  4NX6 A;  5EAJ A;  3FRD X;  3NXY A;  3F0Q X;  1TDB A;  3QLS A;  3EX8 A;  4XRB A;  1KCE A;  3IK0 A;  1DRA A;  1M79 A;  1J3I C;  2ANQ A;  3FRB X;  7DFR A;  4QHV A;  1OHK A;  5U27 A;  1RB2 A;  1U72 A;  2G8X A;  1KLK A;  4KL9 A;  4EIN A;  4ELF A;  4KEB A;  3BZ0 A;  2BLA A;  3EHI X;  3GYF A;  5CCC A;  4LAE X;  4H97 A;  1BPJ A;  3HB8 A;  1DDS A;  4OR7 A;  1RA8 A;  3QLZ A;  2AAZ A;  5HVB A;  1F4E A;  1NCE A;  2ANO A;  3IRO A;  3NXO A;  4XSE A;  1CZ3 A;  1NJD A;  1J3I A;  4FOA A;  3NZD A;  5E8Q A;  3IA5 A;  4HOE A;  1JUV A;  1DHI A;  2TDM A;  3KFY A;  1DLS A;  2B3Z A;  5HT5 A;  2RD8 A;  5FDA A;  3IRM A;  4Q0E A;  2RDA A;  1DIU A;  4O1X D;  4P68 A;  4M2X A;  1VZB A;  3FL9 A;  3FL8 A;  1DRB A;  2FZI A;  1LCB A;  3SRS X;  1HW4 A;  3N5G A;  4PSS A;  3DL6 A;  2VET A;  3ZPG A;  4CD2 A;  4Q6A A;  3EIG A;  3INV A;  3UWL B;  4XT5 A;  1B49 A;  3SRW X;  5HPB A;  3GH0 A;  1S3Y A;  3F0V X;  1TSZ A;  2GD9 A;  1OHJ A;  3F0B X;  1RA1 A;  1DR2 A;  5DXV A;  1TSY A;  4M6K A;  4PST A;  1NJA A;  4PSG A;  3QYL A;  3F0X X;  3RO9 A;  2TSR A;  2W9H A;  5HQZ A;  2FTO X;  1LCE A;  3FQO A;  3EEK A;  4XT8 A;  2CIG A;  3SQY X;  3EJL A;  1RX1 A;  1EVF A;  1VZD A;  2P4G A;  4KNE A;  4Q0D A;  3GHC A;  1M78 A;  3TD8 A;  1RD7 A;  3EEJ A;  2JYB A;  3QG2 A;  1F4B A;  4GD7 A;  2QK8 A;  1HFP A;  2D5N A;  3SA1 A;  3EBU A;  1JG0 A;  2OBC A;  4P3Q A;  3QGT A;  1F4D A;  3KGB A;  4H0U A;  3QLY A;  4FOG A;  1RX5 A;  3BHR A;  1RX9 A;  3IHI A;  3DGA C;  1THY A; 
#chains in the Genus database with same CATH topology
 2HM9 A;  3SRR X;  5JG0 X;  3N0H A;  3BYX A;  2W3W A;  1LY3 A;  4FGG A;  4KFJ A;  3GH2 X;  3S3V A;  4EJ1 A;  2ITH A;  4G6W X;  1DRF A;  1TVW A;  1U70 A;  3QLR A;  3F91 A;  3SRQ X;  1J3K A;  1TSL A;  3FRA X;  3FRF X;  3TQA A;  1JTU A;  1D1G A;  1PD8 A;  4XSD A;  4FQS A;  3KY8 A;  1KZI A;  3I3R A;  2XW7 A;  3FRE X;  2RD8 B;  1TSX A;  1DR1 A;  3QLX A;  3GHV A;  1DLR A;  2AZN A;  1RX2 A;  4P66 A;  4X5F A;  4XEC X;  3TMS A;  2W3A A;  3SAI A;  1FWM A;  1NJC A;  2W9G A;  1TSV A;  3SRU X;  1NJE A;  3FQV A;  4FGT A;  5BY6 A;  4KAK A;  1BO8 A;  3QL0 A;  2W3M A;  1ZDR A;  4ELH A;  3NZA X;  1JMF A;  4G95 A;  2G89 A;  1DR3 A;  1B5D A;  4IQB A;  2DRC A;  3EEL A;  4M6J A;  2ONB A;  1BJG A;  4F2V A;  1AOB A;  1JU6 A;  1DIS A;  3EEM A;  4H95 A;  1KMV A;  1M7A A;  1BKO A;  4PDJ A;  1SEJ A;  2LF1 A;  3IX6 A;  4FOX A;  1U71 A;  5H3A A;  4ISK A;  3DRC A;  1RX8 A;  2HQP A;  1DF7 A;  4PSY A;  3FY9 X;  2FTN A;  4EB4 A;  3JW3 A;  1DR4 A;  4IXG X;  1RC4 A;  5H39 A;  1RX3 A;  2W9T A;  1AI9 A;  3OCH A;  1RF7 A;  1RX7 A;  3FS6 A;  2INQ A;  1LCA A;  2KGK A;  4RGC A;  2A9W A;  1JMI A;  2G8A A;  1IA2 A;  2DHF A;  3DG8 C;  1JOL A;  1AIQ A;  4ELG A;  4KYA A;  3KJR A;  5HI6 A;  4O1X A;  5HS3 A;  4P3R A;  4E5O A;  5HQY A;  3CL9 A;  3FQZ A;  3QYO A;  4G3M A;  1EVG A;  4ISW A;  3FYV X;  1TSM A;  3V8H A;  1PDB A;  1MVT A;  3I8A X;  3FYW X;  4DDR A;  3UM8 A;  3RG9 A;  3GHW A;  4G8Z X;  1S3W A;  5HF0 X;  1DYH A;  3TQ8 A;  4IQQ A;  3IK1 A;  3JWC A;  2OIP A;  3F0S X;  3NZC X;  1DYJ A;  2BL9 A;  1FFL A;  3DG8 A;  1DR7 A;  4HOF A;  1BOZ A;  1RX4 A;  1I00 A;  3QLW A;  1YPV A;  1DRH A;  3NZ6 X;  4QLF A;  3E0B A;  1J3K C;  1F4G A;  4TMS A;  1LUD A;  1RE7 A;  1BQ2 A;  2KCE A;  1S3V A;  4EIG A;  3BHL A;  1AN5 A;  1HZW A;  2G8D A;  4I13 A;  4X5G A;  2BBQ A;  4GYH A;  3KGY A;  1BKP A;  1AO8 A;  4KY8 A;  4HA9 A;  1HVY A;  3NXX A;  1KMS A;  3ED7 A;  3FY8 X;  3BNZ A;  3B5B A;  4KJK A;  3SH2 A;  1RA2 A;  1EV8 A;  1RB3 A;  4HOG A;  6DFR A;  3DAU A;  2G6V A;  3ROA A;  1TSN A;  3TQ9 A;  1VZC A;  1TSW A;  4OSG A;  1DYR A;  3Q1H A;  4H0R A;  1BZF A;  1AXW A;  3BGX A;  1PD9 A;  1BO7 A;  3K45 A;  1TIS A;  2W3B A;  1F4C A;  3EF9 A;  3OAF A;  1SYN A;  3UM5 A;  1RA9 A;  2VF0 A;  2L28 A;  4LRR A;  2TSC A;  2G86 A;  4PTJ A;  5JA3 A;  3IRN A;  4EIL A;  3EDW X;  4QJC A;  4KJJ A;  3NXR A;  4DFR A;  4FGH A;  3DL5 A;  5H38 A;  1DRE A;  4IXF X;  1TRG A;  4HA7 A;  1F28 A;  4KNZ A;  2W9S A;  1DYI A;  3JSU A;  1B5E A;  3GI2 A;  1TLC A;  1VZA A;  3CLB A;  3ZPC A;  4LAG X;  4XT4 A;  1BP6 A;  3NTZ A;  4GH8 A;  4EZ8 A;  1JMH A;  5ECC A;  1DNA A;  4XE6 X;  4M7U A;  1RTS A;  1TDC A;  3TQB A;  1RG7 A;  2CD2 A;  1IA1 A;  4KD7 A;  1F4F A;  1TLS A;  5ECX A;  1JUT A;  2C2S A;  1TSD A;  3UM6 A;  3NXT A;  4PTH A;  1AOE A;  1IA3 A;  4XT7 A;  3NXV A;  4M6L A;  3C06 A;  4LAH X;  2O7P A;  3M08 A;  3H9K A;  4KY4 A;  4ELE A;  4EIZ A;  4O1U A;  4UP1 A;  1TVV A;  1BP0 A;  3JWM A;  3NZB X;  2BLB A;  3JWF A;  2TDD A;  3K74 A;  3IJZ A;  1ZPR A;  1JTQ A;  4JEF A;  3N5E A;  1NJB A;  4KM2 A;  1DR6 A;  4DPH A;  3F0U X;  4DPD A;  3QL3 A;  3SA2 A;  4X5H A;  3IX9 A;  1J3J C;  4KM0 A;  1EV5 A;  3FQC A;  3FQF A;  4DQ1 A;  4KBN A;  1QZF A;  1MVS A;  1S3U A;  3LG4 A;  3K47 A;  1YHO A;  3EAW X;  1VZE A;  2FTQ A;  5DFR A;  1E26 A;  1TDA A;  5HT4 A;  5HSU A;  2HXV A;  3K2H A;  1BSP A;  3SR5 X;  4ECK A;  1DAJ A;  1HFQ A;  2W3V A;  5HF2 X;  1DHJ A;  2ZZA A;  1BID A;  1TYS A;  1LY4 A;  2D0K A;  1HFR A;  3JTW A;  3L3R A;  1CI7 A;  4M7V A;  1HW3 A;  5CC9 A;  5FCT A;  1J3J A;  3IA4 A;  1BDU A;  2C2T A;  2FZH A;  1JMG A;  3C0A A;  4TU5 X;  1DDU A;  4NX7 A;  1KZJ A;  4O7U A;  3VCO A;  4KJL A;  4LEK X;  1BQ1 A;  3B9H A;  1DG7 A;  2FZJ A;  3DAT A;  3NRR A;  1CD2 A;  1RH3 A;  1B02 A;  3QFX A;  1BSF A;  4H98 A;  2H2Q A;  4GEV A;  3M09 A;  4X5I A;  3R33 A;  4FHB A;  5HVE A;  4DP3 A;  1DDR A;  1VDR A;  3JW5 A;  3NU0 A;  3HJ3 A;  3JVX A;  3NZ9 X;  4XT6 A;  4QLE A;  3SGY A;  3OB7 A;  4H1I A;  3S7A A;  3QJ7 A;  3HBB A;  3GG5 A;  4KPW A;  1RX6 A;  3N5E B;  4IXE D;  4ELB A;  1RA3 A;  1TJS A;  5U26 A;  1JUJ A;  4QLG A;  4H96 A;  1DG5 A;  4KLX A;  1DHF A;  3S9U A;  1QQQ A;  3FQ0 A;  5HUI A;  4X5J A;  5WRN A;  3UWL A;  2BLC A;  1TVU A;  1TDU A;  4I1N A;  4IRR A;  3F8Z A;  3D80 A;  1IA4 A;  1DG8 A;  4G2O X;  1TDR A;  1JOM A;  3CD2 A;  3D84 X;  3JWK A;  3DGA A;  3EGY X;  4E28 A;  1DR5 A;  1VJ3 A;  3F8Y A;  4Q67 A;  5J7W A;  4QI9 A;  8DFR A;  3CSE A;  3KJS A;  4XSC A;  5HSR A;  3BFI A;  3DFR A;  1AJM A;  4QJZ D;  4NX6 A;  5EAJ A;  3FRD X;  3NXY A;  3F0Q X;  1TDB A;  3QLS A;  3EX8 A;  4XRB A;  1KCE A;  3IK0 A;  1DRA A;  1M79 A;  1J3I C;  2ANQ A;  3FRB X;  7DFR A;  4QHV A;  1OHK A;  5U27 A;  1RB2 A;  1U72 A;  2G8X A;  1KLK A;  4KL9 A;  4EIN A;  4ELF A;  4KEB A;  3BZ0 A;  2BLA A;  3EHI X;  3GYF A;  5CCC A;  4LAE X;  4H97 A;  1BPJ A;  3HB8 A;  1DDS A;  4OR7 A;  1RA8 A;  3QLZ A;  2AAZ A;  5HVB A;  1F4E A;  1NCE A;  2ANO A;  3IRO A;  3NXO A;  4XSE A;  1CZ3 A;  1NJD A;  1J3I A;  4FOA A;  3NZD A;  5E8Q A;  3IA5 A;  4HOE A;  1JUV A;  1DHI A;  2TDM A;  3KFY A;  1DLS A;  2B3Z A;  5HT5 A;  2RD8 A;  5FDA A;  3IRM A;  4Q0E A;  2RDA A;  1DIU A;  4O1X D;  4P68 A;  4M2X A;  1VZB A;  3FL9 A;  3FL8 A;  1DRB A;  2FZI A;  1LCB A;  3SRS X;  1HW4 A;  3N5G A;  4PSS A;  3DL6 A;  2VET A;  3ZPG A;  4CD2 A;  4Q6A A;  3EIG A;  3INV A;  3UWL B;  4XT5 A;  1B49 A;  3SRW X;  5HPB A;  3GH0 A;  1S3Y A;  3F0V X;  1TSZ A;  2GD9 A;  1OHJ A;  3F0B X;  1RA1 A;  1DR2 A;  5DXV A;  1TSY A;  4M6K A;  4PST A;  1NJA A;  4PSG A;  3QYL A;  3F0X X;  3RO9 A;  2TSR A;  2W9H A;  5HQZ A;  2FTO X;  1LCE A;  3FQO A;  3EEK A;  4XT8 A;  2CIG A;  3SQY X;  3EJL A;  1RX1 A;  1EVF A;  1VZD A;  2P4G A;  4KNE A;  4Q0D A;  3GHC A;  1M78 A;  3TD8 A;  1RD7 A;  3EEJ A;  2JYB A;  3QG2 A;  1F4B A;  4GD7 A;  2QK8 A;  1HFP A;  2D5N A;  3SA1 A;  3EBU A;  1JG0 A;  2OBC A;  4P3Q A;  3QGT A;  1F4D A;  3KGB A;  4H0U A;  3QLY A;  4FOG A;  1RX5 A;  3BHR A;  1RX9 A;  3IHI A;  3DGA C;  1THY A; 
#chains in the Genus database with same CATH homology
 2HM9 A;  3SRR X;  5JG0 X;  3N0H A;  3BYX A;  2W3W A;  1LY3 A;  4FGG A;  4KFJ A;  3GH2 X;  3S3V A;  4EJ1 A;  2ITH A;  4G6W X;  1DRF A;  1TVW A;  1U70 A;  3QLR A;  3F91 A;  3SRQ X;  1J3K A;  1TSL A;  3FRA X;  3FRF X;  3TQA A;  1JTU A;  1D1G A;  1PD8 A;  4XSD A;  4FQS A;  3KY8 A;  1KZI A;  3I3R A;  2XW7 A;  3FRE X;  2RD8 B;  1TSX A;  1DR1 A;  3QLX A;  3GHV A;  1DLR A;  2AZN A;  1RX2 A;  4P66 A;  4X5F A;  4XEC X;  3TMS A;  2W3A A;  3SAI A;  1FWM A;  1NJC A;  2W9G A;  1TSV A;  3SRU X;  1NJE A;  3FQV A;  4FGT A;  5BY6 A;  4KAK A;  1BO8 A;  3QL0 A;  2W3M A;  1ZDR A;  4ELH A;  3NZA X;  1JMF A;  4G95 A;  2G89 A;  1DR3 A;  1B5D A;  4IQB A;  2DRC A;  3EEL A;  4M6J A;  2ONB A;  1BJG A;  4F2V A;  1AOB A;  1JU6 A;  1DIS A;  3EEM A;  4H95 A;  1KMV A;  1M7A A;  1BKO A;  4PDJ A;  1SEJ A;  2LF1 A;  3IX6 A;  4FOX A;  1U71 A;  5H3A A;  4ISK A;  3DRC A;  1RX8 A;  2HQP A;  1DF7 A;  4PSY A;  3FY9 X;  2FTN A;  4EB4 A;  3JW3 A;  1DR4 A;  4IXG X;  1RC4 A;  5H39 A;  1RX3 A;  2W9T A;  1AI9 A;  3OCH A;  1RF7 A;  1RX7 A;  3FS6 A;  2INQ A;  1LCA A;  2KGK A;  4RGC A;  2A9W A;  1JMI A;  2G8A A;  1IA2 A;  2DHF A;  3DG8 C;  1JOL A;  1AIQ A;  4ELG A;  4KYA A;  3KJR A;  5HI6 A;  4O1X A;  5HS3 A;  4P3R A;  4E5O A;  5HQY A;  3CL9 A;  3FQZ A;  3QYO A;  4G3M A;  1EVG A;  4ISW A;  3FYV X;  1TSM A;  3V8H A;  1PDB A;  1MVT A;  3I8A X;  3FYW X;  4DDR A;  3UM8 A;  3RG9 A;  3GHW A;  4G8Z X;  1S3W A;  5HF0 X;  1DYH A;  3TQ8 A;  4IQQ A;  3IK1 A;  3JWC A;  2OIP A;  3F0S X;  3NZC X;  1DYJ A;  2BL9 A;  1FFL A;  3DG8 A;  1DR7 A;  4HOF A;  1BOZ A;  1RX4 A;  1I00 A;  3QLW A;  1YPV A;  1DRH A;  3NZ6 X;  4QLF A;  3E0B A;  1J3K C;  1F4G A;  4TMS A;  1LUD A;  1RE7 A;  1BQ2 A;  2KCE A;  1S3V A;  4EIG A;  3BHL A;  1AN5 A;  1HZW A;  2G8D A;  4I13 A;  4X5G A;  2BBQ A;  4GYH A;  3KGY A;  1BKP A;  1AO8 A;  4KY8 A;  4HA9 A;  1HVY A;  3NXX A;  1KMS A;  3ED7 A;  3FY8 X;  3BNZ A;  3B5B A;  4KJK A;  3SH2 A;  1RA2 A;  1EV8 A;  1RB3 A;  4HOG A;  6DFR A;  3DAU A;  2G6V A;  3ROA A;  1TSN A;  3TQ9 A;  1VZC A;  1TSW A;  4OSG A;  1DYR A;  3Q1H A;  4H0R A;  1BZF A;  1AXW A;  3BGX A;  1PD9 A;  1BO7 A;  3K45 A;  1TIS A;  2W3B A;  1F4C A;  3EF9 A;  3OAF A;  1SYN A;  3UM5 A;  1RA9 A;  2VF0 A;  2L28 A;  4LRR A;  2TSC A;  2G86 A;  4PTJ A;  5JA3 A;  3IRN A;  4EIL A;  3EDW X;  4QJC A;  4KJJ A;  3NXR A;  4DFR A;  4FGH A;  3DL5 A;  5H38 A;  1DRE A;  4IXF X;  1TRG A;  4HA7 A;  1F28 A;  4KNZ A;  2W9S A;  1DYI A;  3JSU A;  1B5E A;  3GI2 A;  1TLC A;  1VZA A;  3CLB A;  3ZPC A;  4LAG X;  4XT4 A;  1BP6 A;  3NTZ A;  4GH8 A;  4EZ8 A;  1JMH A;  5ECC A;  1DNA A;  4XE6 X;  4M7U A;  1RTS A;  1TDC A;  3TQB A;  1RG7 A;  2CD2 A;  1IA1 A;  4KD7 A;  1F4F A;  1TLS A;  5ECX A;  1JUT A;  2C2S A;  1TSD A;  3UM6 A;  3NXT A;  4PTH A;  1AOE A;  1IA3 A;  4XT7 A;  3NXV A;  4M6L A;  3C06 A;  4LAH X;  2O7P A;  3M08 A;  3H9K A;  4KY4 A;  4ELE A;  4EIZ A;  4O1U A;  4UP1 A;  1TVV A;  1BP0 A;  3JWM A;  3NZB X;  2BLB A;  3JWF A;  2TDD A;  3K74 A;  3IJZ A;  1ZPR A;  1JTQ A;  4JEF A;  3N5E A;  1NJB A;  4KM2 A;  1DR6 A;  4DPH A;  3F0U X;  4DPD A;  3QL3 A;  3SA2 A;  4X5H A;  3IX9 A;  1J3J C;  4KM0 A;  1EV5 A;  3FQC A;  3FQF A;  4DQ1 A;  4KBN A;  1QZF A;  1MVS A;  1S3U A;  3LG4 A;  3K47 A;  1YHO A;  3EAW X;  1VZE A;  2FTQ A;  5DFR A;  1E26 A;  1TDA A;  5HT4 A;  5HSU A;  2HXV A;  3K2H A;  1BSP A;  3SR5 X;  4ECK A;  1DAJ A;  1HFQ A;  2W3V A;  5HF2 X;  1DHJ A;  2ZZA A;  1BID A;  1TYS A;  1LY4 A;  2D0K A;  1HFR A;  3JTW A;  3L3R A;  1CI7 A;  4M7V A;  1HW3 A;  5CC9 A;  5FCT A;  1J3J A;  3IA4 A;  1BDU A;  2C2T A;  2FZH A;  1JMG A;  3C0A A;  4TU5 X;  1DDU A;  4NX7 A;  1KZJ A;  4O7U A;  3VCO A;  4KJL A;  4LEK X;  1BQ1 A;  3B9H A;  1DG7 A;  2FZJ A;  3DAT A;  3NRR A;  1CD2 A;  1RH3 A;  1B02 A;  3QFX A;  1BSF A;  4H98 A;  2H2Q A;  4GEV A;  3M09 A;  4X5I A;  3R33 A;  4FHB A;  5HVE A;  4DP3 A;  1DDR A;  1VDR A;  3JW5 A;  3NU0 A;  3HJ3 A;  3JVX A;  3NZ9 X;  4XT6 A;  4QLE A;  3SGY A;  3OB7 A;  4H1I A;  3S7A A;  3QJ7 A;  3HBB A;  3GG5 A;  4KPW A;  1RX6 A;  3N5E B;  4IXE D;  4ELB A;  1RA3 A;  1TJS A;  5U26 A;  1JUJ A;  4QLG A;  4H96 A;  1DG5 A;  4KLX A;  1DHF A;  3S9U A;  1QQQ A;  3FQ0 A;  5HUI A;  4X5J A;  5WRN A;  3UWL A;  2BLC A;  1TVU A;  1TDU A;  4I1N A;  4IRR A;  3F8Z A;  3D80 A;  1IA4 A;  1DG8 A;  4G2O X;  1TDR A;  1JOM A;  3CD2 A;  3D84 X;  3JWK A;  3DGA A;  3EGY X;  4E28 A;  1DR5 A;  1VJ3 A;  3F8Y A;  4Q67 A;  5J7W A;  4QI9 A;  8DFR A;  3CSE A;  3KJS A;  4XSC A;  5HSR A;  3BFI A;  3DFR A;  1AJM A;  4QJZ D;  4NX6 A;  5EAJ A;  3FRD X;  3NXY A;  3F0Q X;  1TDB A;  3QLS A;  3EX8 A;  4XRB A;  1KCE A;  3IK0 A;  1DRA A;  1M79 A;  1J3I C;  2ANQ A;  3FRB X;  7DFR A;  4QHV A;  1OHK A;  5U27 A;  1RB2 A;  1U72 A;  2G8X A;  1KLK A;  4KL9 A;  4EIN A;  4ELF A;  4KEB A;  3BZ0 A;  2BLA A;  3EHI X;  3GYF A;  5CCC A;  4LAE X;  4H97 A;  1BPJ A;  3HB8 A;  1DDS A;  4OR7 A;  1RA8 A;  3QLZ A;  2AAZ A;  5HVB A;  1F4E A;  1NCE A;  2ANO A;  3IRO A;  3NXO A;  4XSE A;  1CZ3 A;  1NJD A;  1J3I A;  4FOA A;  3NZD A;  5E8Q A;  3IA5 A;  4HOE A;  1JUV A;  1DHI A;  2TDM A;  3KFY A;  1DLS A;  2B3Z A;  5HT5 A;  2RD8 A;  5FDA A;  3IRM A;  4Q0E A;  2RDA A;  1DIU A;  4O1X D;  4P68 A;  4M2X A;  1VZB A;  3FL9 A;  3FL8 A;  1DRB A;  2FZI A;  1LCB A;  3SRS X;  1HW4 A;  3N5G A;  4PSS A;  3DL6 A;  2VET A;  3ZPG A;  4CD2 A;  4Q6A A;  3EIG A;  3INV A;  3UWL B;  4XT5 A;  1B49 A;  3SRW X;  5HPB A;  3GH0 A;  1S3Y A;  3F0V X;  1TSZ A;  2GD9 A;  1OHJ A;  3F0B X;  1RA1 A;  1DR2 A;  5DXV A;  1TSY A;  4M6K A;  4PST A;  1NJA A;  4PSG A;  3QYL A;  3F0X X;  3RO9 A;  2TSR A;  2W9H A;  5HQZ A;  2FTO X;  1LCE A;  3FQO A;  3EEK A;  4XT8 A;  2CIG A;  3SQY X;  3EJL A;  1RX1 A;  1EVF A;  1VZD A;  2P4G A;  4KNE A;  4Q0D A;  3GHC A;  1M78 A;  3TD8 A;  1RD7 A;  3EEJ A;  2JYB A;  3QG2 A;  1F4B A;  4GD7 A;  2QK8 A;  1HFP A;  2D5N A;  3SA1 A;  3EBU A;  1JG0 A;  2OBC A;  4P3Q A;  3QGT A;  1F4D A;  3KGB A;  4H0U A;  3QLY A;  4FOG A;  1RX5 A;  3BHR A;  1RX9 A;  3IHI A;  3DGA C;  1THY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...