4DPDA

Wild type plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts), dhf complex, nadp+, dump
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
605
structure length
530
Chain Sequence
MMEQVCDVFDIYAICACCKVEEVFNNYTFRGLGNKGVLPWKCNSLDMKYFCAVTTYVNESKYEKLKYKRCKYLNKKLQNVVVMGRTSWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase, transferase
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title Malarial dihydrofolate reductase as a paradigm for drug development against a resistance-compromised target
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 174
structure length 530
sequence length 605
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4dpdA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4dpdA01
4H96A 1RA3A 1DR7A 1IA1A 4M6JA 4PTHA 1RX9A 1VZBA 1TLCA 3C06A 1DYRA 3DRCA 3UM5A 1TSWA 1D1GA 3K74A 4GD7A 1IA3A 1DDSA 1DR2A 1IA4A 3BHLA 4ELFA 1F4DA 1SYNA 3F8YA 2G89A 3NU0A 1AXWA 1M78A 4QLGA 3TQAA 4ELBA 1AO8A 1DRFA 1RG7A 1MVSA 2D0KA 1JMFA 2P4GA 4H97A 4KFJA 3N5EA 1TDAA 1S3UA 3QLRA 2FTOX 5HVEA 4HOFA 1B5DA 3KGBA 5ECCA 1DYJA 3SGYA 1HZWA 2W3MA 4I13A 4X5GA 2W3AA 3OAFA 3IRNA 1VZEA 1TRGA 3ED7A 1RX2A 3R33A 4LAEX 4LAHX 3GHVA 4OR7A 4XT4A 3GYFA 1E26A 1RX7A 3RO9A 1TVWA 1DG5A 4FOXA 4ISWA 3L3RA 4M2XA 4DFRA 1S3WA 1LCAA 4EILA 3FQFA 1OHKA 4FHBA 4GEVA 1AN5A 4LRRA 4EIZA 3NZAX 1TYSA 2OIPA 1JUVA 1NJDA 1BKPA 3SRQX 3CL9A 1AI9A 3FYWX 3H9KA 3GI2A 4TU5X 4H95A 5E8QA 2HQPA 4KYAA 4P68A 3INVA 2JYBA 1KMSA 3NZCX 4KBNA 4XT5A 1RX5A 1RX6A 4XT8A 1LY3A 3LG4A 5HT4A 4M7UA 2G8AA 3HB8A 1TSZA 3NXRA 1RA8A 3BZ0A 5FCTA 3N0HA 4KJLA 3SQYX 1VZCA 4XSEA 3FL9A 3B5BA 4PSSA 4QHVA 3KY8A 4FGGA 1U70A 4F2VA 4KAKA 1TJSA 1BSPA 5DXVA 3ZPCA 1J3IA 1BJGA 3BNZA 3JWCA 4NX6A 1LCEA 3JVXA 4KLXA 2TSCA 4DPHA 3JWFA 4LAGX 1JMGA 3BYXA 1BOZA 1VJ3A 4IXED 2INQA 1DRBA 1MVTA 3N5EB 3F0UX 3F0VX 1J3KA 5ECXA 4QLEA 4XSCA 4EJ1A 1KMVA 4FOAA 3NZ9X 3SRSX 3SA2A 2FTQA 3EIGA 1KZIA 3NRRA 1TDCA 1F4FA 1TLSA 3JW5A 5DFRA 3HJ3A 3DFRA 5BY6A 5U27A 3F91A 4X5IA 3IK0A 2W9SA 1YHOA 3QLXA 1DG8A 2G8XA 4IQQA 5HQZA 3TMSA 4KM0A 5HS3A 4XECX 2G86A 4M7VA 1TDRA 2ITHA 1HW3A 3K45A 3NXVA 4KD7A 3FRAX 4QJCA 4ELHA 1RA2A 4GH8A 3K47A 4X5JA 1BO8A 2OBCA 4KEBA 1BZFA 1RE7A 1LUDA 1TSVA 2KCEA 1JOLA 1PD8A 1F4CA 4H1IA 3QL0A 4RGCA 2ONBA 1RTSA 4HOEA 3IX9A 3EF9A 1DR6A 4QI9A 3B9HA 3N5GA 1JUJA 2HXVA 3SA1A 1BIDA 3FS6A 5HSUA 1TSDA 5HI6A 2RDAA 3DGAA 3IA5A 2C2TA 5HSRA 1AJMA 4Q0EA 3S7AA 1BQ1A 3F0XX 7DFRA 1TDUA 1RH3A 1RB2A 2ANQA 1F4EA 4X5HA 2TDDA 1DHJA 3QYLA 1DDRA 3CLBA 4KNZA 4CD2A 4G8ZX 3GHWA 4QLFA 1ZPRA 4XRBA 3EEJA 3D80A 3ZPGA 2A9WA 2BLAA 1DISA 1BKOA 1DRHA 5CCCA 3QLYA 1B5EA 8DFRA 1NJCA 1DF7A 3M09A 4EIGA 1JOMA 4JEFA 1J3JA 5H39A 1I00A 3TQ8A 1JMHA 2G6VA 1JU6A 3EX8A 4O1XD 3GG5A 1DDUA 1DR5A 4H0UA 1S3VA 1M7AA 3DATA 3I8AX 3M08A 1RF7A 1TISA 1RX4A 3EJLA 2FZIA 3FQOA 1S3YA 4XT6A 4KM2A 1LY4A 1U71A 4Q67A 5HF2X 2TDMA 2VF0A 3EAWX 2BLBA 3TQ9A 1PDBA 3DL6A 1QZFA 3IK1A 4O7UA 1BO7A 1BPJA 3KGYA 2L28A 4NX7A 1DYIA 1HFPA 4PSYA 4E28A 1FWMA 1TSLA 4KY4A 4IRRA 3FREX 2KGKA 1VZAA 4O1XA 4FQSA 4XE6X 1KZJA 1DLRA 4PTJA 2BBQA 3V8HA 1EV5A 3FRFX 4H98A 5HF0X 4G6WX 3DAUA 4H0RA 2CD2A 1TSMA 4DP3A 3IJZA 3DG8A 3EGYX 1F4GA 3F0SX 4PSTA 4O1UA 5H3AA 1FFLA 1CD2A 1NJBA 1CZ3A 2BLCA 3EDWX 2CIGA 4P3QA 1HFQA 3FQVA 2HM9A 6DFRA 1F4BA 4X5FA 3DL5A 3K2HA 3JWKA 3KFYA 3GH0A 5WRNA 2DRCA 1BP6A 4IXGX 3SH2A 3NZDA 3IROA 4M6LA 2LF1A 4M6KA 3FRDX 4OSGA 2W3BA 3I3RA 2H2QA 3JW3A 4QJZD 1JUTA 2QK8A 3FQ0A 2W9TA 1CI7A 1TVVA 1DYHA 3QYOA 3QLSA 5FDAA 1EV8A 3IHIA 3UWLA 2ZZAA 1DR4A 1ZDRA 1KLKA 2XW7A 3QFXA 2W9HA 2O7PA 4KJKA 3C0AA 4DDRA 4ECKA 3OB7A 3CSEA 4I1NA 4LEKX 1AIQA 3HBBA 3SR5X 4ELEA 1B49A 3E0BA 4HOGA 1U72A 3IA4A 2TSRA 3BHRA 1DLSA 1J3IC 1LCBA 3FRBX 3NTZA 3JSUA 3NXTA 1DNAA 1HFRA 3OCHA 2D5NA 3TQBA 4XT7A 4KY8A 1RX1A 3IRMA 4FOGA 1RX8A 3SRUX 1J3KC 1HW4A 3GH2X 4Q6AA 1RA1A 3S9UA 1AOEA 1KCEA 3Q1HA 3SRWX 1VDRA 1DHFA 5HUIA 4PSGA 1RA9A 3SAIA 1TDBA 1OHJA 3RG9A 3DG8C 5HPBA 1JMIA 2AAZA 2G8DA 3S3VA 2VETA 4DPDA 2FZHA 4XSDA 4KL9A 5CC9A 1NJEA 3QGTA 4FGHA 3QG2A 1DRAA 1DR1A 1AOBA 3EELA 1JTQA 3ROAA 4P3RA 3F0BX 3D84X 2B3ZA 3VCOA 3NXOA 2FZJA 1NJAA 1EVFA 1HVYA 4DQ1A 4EZ8A 2GD9A 2C2SA 4IXFX 5HQYA 1F28A 1RD7A 1SEJA 3EEKA 2AZNA 3BGXA 2RD8B 3FY9X 1RC4A 2DHFA 1DR3A 4E5OA 3SRRX 3UWLB 1BP0A 3IX6A 1JG0A 1JTUA 3DGAC 4P66A 1DAJA 1DG7A 1QQQA 1PD9A 3UM8A 2BL9A 4KJJA 3KJRA 5HVBA 4Q0DA 1RB3A 3JWMA 1BDUA 4EB4A 1DIUA 3NZ6X 3CD2A 1TSXA 4ELGA 4HA7A 4G2OX 1DREA 4HA9A 3JTWA 5JG0X 3FQCA 1RX3A 1BSFA 1M79A 1IA2A 3FY8X 1NCEA 3KJSA 1EVGA 3GHCA 3EHIX 3NXYA 4EINA 4PDJA 2FTNA 1TVUA 3EBUA 3QL3A 2W9GA 4KNEA 5HT5A 3F8ZA 2W3WA 5EAJA 2W3VA 1THYA 5U26A 1BQ2A 3NXXA 4G95A 1TSYA 5J7WA 1B02A 4GYHA 4IQBA 3QJ7A 3FYVX 4KPWA 3QLWA 3BFIA 4UP1A 4ISKA 3EEMA 5JA3A 3F0QX 1J3JC 1TSNA 3FL8A 4FGTA 1YPVA 3FQZA 1VZDA 3NZBX 4G3MA 3UM6A 2RD8A 1DHIA 3TD8A 4TMSA 3QLZA 5H38A 2ANOA
chains in the Genus database with same CATH superfamily
4H96A 1RA3A 1DR7A 1IA1A 4M6JA 4PTHA 1RX9A 1VZBA 1TLCA 3C06A 1DYRA 3DRCA 3UM5A 1TSWA 1D1GA 3K74A 4GD7A 1IA3A 1DDSA 1DR2A 1IA4A 3BHLA 4ELFA 1F4DA 1SYNA 3F8YA 2G89A 3NU0A 1AXWA 1M78A 4QLGA 3TQAA 4ELBA 1AO8A 1DRFA 1RG7A 1MVSA 2D0KA 1JMFA 2P4GA 4H97A 4KFJA 3N5EA 1TDAA 1S3UA 3QLRA 2FTOX 5HVEA 4HOFA 1B5DA 3KGBA 5ECCA 1DYJA 3SGYA 1HZWA 2W3MA 4I13A 4X5GA 2W3AA 3OAFA 3IRNA 1VZEA 1TRGA 3ED7A 1RX2A 3R33A 4LAEX 4LAHX 3GHVA 4OR7A 4XT4A 3GYFA 1E26A 1RX7A 3RO9A 1TVWA 1DG5A 4FOXA 4ISWA 3L3RA 4M2XA 4DFRA 1S3WA 1LCAA 4EILA 3FQFA 1OHKA 4FHBA 4GEVA 1AN5A 4LRRA 4EIZA 3NZAX 1TYSA 2OIPA 1JUVA 1NJDA 1BKPA 3SRQX 3CL9A 1AI9A 3FYWX 3H9KA 3GI2A 4TU5X 4H95A 5E8QA 2HQPA 4KYAA 4P68A 3INVA 2JYBA 1KMSA 3NZCX 4KBNA 4XT5A 1RX5A 1RX6A 4XT8A 1LY3A 3LG4A 5HT4A 4M7UA 2G8AA 3HB8A 1TSZA 3NXRA 1RA8A 3BZ0A 5FCTA 3N0HA 4KJLA 3SQYX 1VZCA 4XSEA 3FL9A 3B5BA 4PSSA 4QHVA 3KY8A 4FGGA 1U70A 4F2VA 4KAKA 1TJSA 1BSPA 5DXVA 3ZPCA 1J3IA 1BJGA 3BNZA 3JWCA 4NX6A 1LCEA 3JVXA 4KLXA 2TSCA 4DPHA 3JWFA 4LAGX 1JMGA 3BYXA 1BOZA 1VJ3A 4IXED 2INQA 1DRBA 1MVTA 3N5EB 3F0UX 3F0VX 1J3KA 5ECXA 4QLEA 4XSCA 4EJ1A 1KMVA 4FOAA 3NZ9X 3SRSX 3SA2A 2FTQA 3EIGA 1KZIA 3NRRA 1TDCA 1F4FA 1TLSA 3JW5A 5DFRA 3HJ3A 3DFRA 5BY6A 5U27A 3F91A 4X5IA 3IK0A 2W9SA 1YHOA 3QLXA 1DG8A 2G8XA 4IQQA 5HQZA 3TMSA 4KM0A 5HS3A 4XECX 2G86A 4M7VA 1TDRA 2ITHA 1HW3A 3K45A 3NXVA 4KD7A 3FRAX 4QJCA 4ELHA 1RA2A 4GH8A 3K47A 4X5JA 1BO8A 2OBCA 4KEBA 1BZFA 1RE7A 1LUDA 1TSVA 2KCEA 1JOLA 1PD8A 1F4CA 4H1IA 3QL0A 4RGCA 2ONBA 1RTSA 4HOEA 3IX9A 3EF9A 1DR6A 4QI9A 3B9HA 3N5GA 1JUJA 2HXVA 3SA1A 1BIDA 3FS6A 5HSUA 1TSDA 5HI6A 2RDAA 3DGAA 3IA5A 2C2TA 5HSRA 1AJMA 4Q0EA 3S7AA 1BQ1A 3F0XX 7DFRA 1TDUA 1RH3A 1RB2A 2ANQA 1F4EA 4X5HA 2TDDA 1DHJA 3QYLA 1DDRA 3CLBA 4KNZA 4CD2A 4G8ZX 3GHWA 4QLFA 1ZPRA 4XRBA 3EEJA 3D80A 3ZPGA 2A9WA 2BLAA 1DISA 1BKOA 1DRHA 5CCCA 3QLYA 1B5EA 8DFRA 1NJCA 1DF7A 3M09A 4EIGA 1JOMA 4JEFA 1J3JA 5H39A 1I00A 3TQ8A 1JMHA 2G6VA 1JU6A 3EX8A 4O1XD 3GG5A 1DDUA 1DR5A 4H0UA 1S3VA 1M7AA 3DATA 3I8AX 3M08A 1RF7A 1TISA 1RX4A 3EJLA 2FZIA 3FQOA 1S3YA 4XT6A 4KM2A 1LY4A 1U71A 4Q67A 5HF2X 2TDMA 2VF0A 3EAWX 2BLBA 3TQ9A 1PDBA 3DL6A 1QZFA 3IK1A 4O7UA 1BO7A 1BPJA 3KGYA 2L28A 4NX7A 1DYIA 1HFPA 4PSYA 4E28A 1FWMA 1TSLA 4KY4A 4IRRA 3FREX 2KGKA 1VZAA 4O1XA 4FQSA 4XE6X 1KZJA 1DLRA 4PTJA 2BBQA 3V8HA 1EV5A 3FRFX 4H98A 5HF0X 4G6WX 3DAUA 4H0RA 2CD2A 1TSMA 4DP3A 3IJZA 3DG8A 3EGYX 1F4GA 3F0SX 4PSTA 4O1UA 5H3AA 1FFLA 1CD2A 1NJBA 1CZ3A 2BLCA 3EDWX 2CIGA 4P3QA 1HFQA 3FQVA 2HM9A 6DFRA 1F4BA 4X5FA 3DL5A 3K2HA 3JWKA 3KFYA 3GH0A 5WRNA 2DRCA 1BP6A 4IXGX 3SH2A 3NZDA 3IROA 4M6LA 2LF1A 4M6KA 3FRDX 4OSGA 2W3BA 3I3RA 2H2QA 3JW3A 4QJZD 1JUTA 2QK8A 3FQ0A 2W9TA 1CI7A 1TVVA 1DYHA 3QYOA 3QLSA 5FDAA 1EV8A 3IHIA 3UWLA 2ZZAA 1DR4A 1ZDRA 1KLKA 2XW7A 3QFXA 2W9HA 2O7PA 4KJKA 3C0AA 4DDRA 4ECKA 3OB7A 3CSEA 4I1NA 4LEKX 1AIQA 3HBBA 3SR5X 4ELEA 1B49A 3E0BA 4HOGA 1U72A 3IA4A 2TSRA 3BHRA 1DLSA 1J3IC 1LCBA 3FRBX 3NTZA 3JSUA 3NXTA 1DNAA 1HFRA 3OCHA 2D5NA 3TQBA 4XT7A 4KY8A 1RX1A 3IRMA 4FOGA 1RX8A 3SRUX 1J3KC 1HW4A 3GH2X 4Q6AA 1RA1A 3S9UA 1AOEA 1KCEA 3Q1HA 3SRWX 1VDRA 1DHFA 5HUIA 4PSGA 1RA9A 3SAIA 1TDBA 1OHJA 3RG9A 3DG8C 5HPBA 1JMIA 2AAZA 2G8DA 3S3VA 2VETA 4DPDA 2FZHA 4XSDA 4KL9A 5CC9A 1NJEA 3QGTA 4FGHA 3QG2A 1DRAA 1DR1A 1AOBA 3EELA 1JTQA 3ROAA 4P3RA 3F0BX 3D84X 2B3ZA 3VCOA 3NXOA 2FZJA 1NJAA 1EVFA 1HVYA 4DQ1A 4EZ8A 2GD9A 2C2SA 4IXFX 5HQYA 1F28A 1RD7A 1SEJA 3EEKA 2AZNA 3BGXA 2RD8B 3FY9X 1RC4A 2DHFA 1DR3A 4E5OA 3SRRX 3UWLB 1BP0A 3IX6A 1JG0A 1JTUA 3DGAC 4P66A 1DAJA 1DG7A 1QQQA 1PD9A 3UM8A 2BL9A 4KJJA 3KJRA 5HVBA 4Q0DA 1RB3A 3JWMA 1BDUA 4EB4A 1DIUA 3NZ6X 3CD2A 1TSXA 4ELGA 4HA7A 4G2OX 1DREA 4HA9A 3JTWA 5JG0X 3FQCA 1RX3A 1BSFA 1M79A 1IA2A 3FY8X 1NCEA 3KJSA 1EVGA 3GHCA 3EHIX 3NXYA 4EINA 4PDJA 2FTNA 1TVUA 3EBUA 3QL3A 2W9GA 4KNEA 5HT5A 3F8ZA 2W3WA 5EAJA 2W3VA 1THYA 5U26A 1BQ2A 3NXXA 4G95A 1TSYA 5J7WA 1B02A 4GYHA 4IQBA 3QJ7A 3FYVX 4KPWA 3QLWA 3BFIA 4UP1A 4ISKA 3EEMA 5JA3A 3F0QX 1J3JC 1TSNA 3FL8A 4FGTA 1YPVA 3FQZA 1VZDA 3NZBX 4G3MA 3UM6A 2RD8A 1DHIA 3TD8A 4TMSA 3QLZA 5H38A 2ANOA
chains in the Genus database with same CATH topology
4H96A 1RA3A 1DR7A 1IA1A 4M6JA 4PTHA 1RX9A 1VZBA 1TLCA 3C06A 1DYRA 3DRCA 3UM5A 1TSWA 1D1GA 3K74A 4GD7A 1IA3A 1DDSA 1DR2A 1IA4A 3BHLA 4ELFA 1F4DA 1SYNA 3F8YA 2G89A 3NU0A 1AXWA 1M78A 4QLGA 3TQAA 4ELBA 1AO8A 1DRFA 1RG7A 1MVSA 2D0KA 1JMFA 2P4GA 4H97A 4KFJA 3N5EA 1TDAA 1S3UA 3QLRA 2FTOX 5HVEA 4HOFA 1B5DA 3KGBA 5ECCA 1DYJA 3SGYA 1HZWA 2W3MA 4I13A 4X5GA 2W3AA 3OAFA 3IRNA 1VZEA 1TRGA 3ED7A 1RX2A 3R33A 4LAEX 4LAHX 3GHVA 4OR7A 4XT4A 3GYFA 1E26A 1RX7A 3RO9A 1TVWA 1DG5A 4FOXA 4ISWA 3L3RA 4M2XA 4DFRA 1S3WA 1LCAA 4EILA 3FQFA 1OHKA 4FHBA 4GEVA 1AN5A 4LRRA 4EIZA 3NZAX 1TYSA 2OIPA 1JUVA 1NJDA 1BKPA 3SRQX 3CL9A 1AI9A 3FYWX 3H9KA 3GI2A 4TU5X 4H95A 5E8QA 2HQPA 4KYAA 4P68A 3INVA 2JYBA 1KMSA 3NZCX 4KBNA 4XT5A 1RX5A 1RX6A 4XT8A 1LY3A 3LG4A 5HT4A 4M7UA 2G8AA 3HB8A 1TSZA 3NXRA 1RA8A 3BZ0A 5FCTA 3N0HA 4KJLA 3SQYX 1VZCA 4XSEA 3FL9A 3B5BA 4PSSA 4QHVA 3KY8A 4FGGA 1U70A 4F2VA 4KAKA 1TJSA 1BSPA 5DXVA 3ZPCA 1J3IA 1BJGA 3BNZA 3JWCA 4NX6A 1LCEA 3JVXA 4KLXA 2TSCA 4DPHA 3JWFA 4LAGX 1JMGA 3BYXA 1BOZA 1VJ3A 4IXED 2INQA 1DRBA 1MVTA 3N5EB 3F0UX 3F0VX 1J3KA 5ECXA 4QLEA 4XSCA 4EJ1A 1KMVA 4FOAA 3NZ9X 3SRSX 3SA2A 2FTQA 3EIGA 1KZIA 3NRRA 1TDCA 1F4FA 1TLSA 3JW5A 5DFRA 3HJ3A 3DFRA 5BY6A 5U27A 3F91A 4X5IA 3IK0A 2W9SA 1YHOA 3QLXA 1DG8A 2G8XA 4IQQA 5HQZA 3TMSA 4KM0A 5HS3A 4XECX 2G86A 4M7VA 1TDRA 2ITHA 1HW3A 3K45A 3NXVA 4KD7A 3FRAX 4QJCA 4ELHA 1RA2A 4GH8A 3K47A 4X5JA 1BO8A 2OBCA 4KEBA 1BZFA 1RE7A 1LUDA 1TSVA 2KCEA 1JOLA 1PD8A 1F4CA 4H1IA 3QL0A 4RGCA 2ONBA 1RTSA 4HOEA 3IX9A 3EF9A 1DR6A 4QI9A 3B9HA 3N5GA 1JUJA 2HXVA 3SA1A 1BIDA 3FS6A 5HSUA 1TSDA 5HI6A 2RDAA 3DGAA 3IA5A 2C2TA 5HSRA 1AJMA 4Q0EA 3S7AA 1BQ1A 3F0XX 7DFRA 1TDUA 1RH3A 1RB2A 2ANQA 1F4EA 4X5HA 2TDDA 1DHJA 3QYLA 1DDRA 3CLBA 4KNZA 4CD2A 4G8ZX 3GHWA 4QLFA 1ZPRA 4XRBA 3EEJA 3D80A 3ZPGA 2A9WA 2BLAA 1DISA 1BKOA 1DRHA 5CCCA 3QLYA 1B5EA 8DFRA 1NJCA 1DF7A 3M09A 4EIGA 1JOMA 4JEFA 1J3JA 5H39A 1I00A 3TQ8A 1JMHA 2G6VA 1JU6A 3EX8A 4O1XD 3GG5A 1DDUA 1DR5A 4H0UA 1S3VA 1M7AA 3DATA 3I8AX 3M08A 1RF7A 1TISA 1RX4A 3EJLA 2FZIA 3FQOA 1S3YA 4XT6A 4KM2A 1LY4A 1U71A 4Q67A 5HF2X 2TDMA 2VF0A 3EAWX 2BLBA 3TQ9A 1PDBA 3DL6A 1QZFA 3IK1A 4O7UA 1BO7A 1BPJA 3KGYA 2L28A 4NX7A 1DYIA 1HFPA 4PSYA 4E28A 1FWMA 1TSLA 4KY4A 4IRRA 3FREX 2KGKA 1VZAA 4O1XA 4FQSA 4XE6X 1KZJA 1DLRA 4PTJA 2BBQA 3V8HA 1EV5A 3FRFX 4H98A 5HF0X 4G6WX 3DAUA 4H0RA 2CD2A 1TSMA 4DP3A 3IJZA 3DG8A 3EGYX 1F4GA 3F0SX 4PSTA 4O1UA 5H3AA 1FFLA 1CD2A 1NJBA 1CZ3A 2BLCA 3EDWX 2CIGA 4P3QA 1HFQA 3FQVA 2HM9A 6DFRA 1F4BA 4X5FA 3DL5A 3K2HA 3JWKA 3KFYA 3GH0A 5WRNA 2DRCA 1BP6A 4IXGX 3SH2A 3NZDA 3IROA 4M6LA 2LF1A 4M6KA 3FRDX 4OSGA 2W3BA 3I3RA 2H2QA 3JW3A 4QJZD 1JUTA 2QK8A 3FQ0A 2W9TA 1CI7A 1TVVA 1DYHA 3QYOA 3QLSA 5FDAA 1EV8A 3IHIA 3UWLA 2ZZAA 1DR4A 1ZDRA 1KLKA 2XW7A 3QFXA 2W9HA 2O7PA 4KJKA 3C0AA 4DDRA 4ECKA 3OB7A 3CSEA 4I1NA 4LEKX 1AIQA 3HBBA 3SR5X 4ELEA 1B49A 3E0BA 4HOGA 1U72A 3IA4A 2TSRA 3BHRA 1DLSA 1J3IC 1LCBA 3FRBX 3NTZA 3JSUA 3NXTA 1DNAA 1HFRA 3OCHA 2D5NA 3TQBA 4XT7A 4KY8A 1RX1A 3IRMA 4FOGA 1RX8A 3SRUX 1J3KC 1HW4A 3GH2X 4Q6AA 1RA1A 3S9UA 1AOEA 1KCEA 3Q1HA 3SRWX 1VDRA 1DHFA 5HUIA 4PSGA 1RA9A 3SAIA 1TDBA 1OHJA 3RG9A 3DG8C 5HPBA 1JMIA 2AAZA 2G8DA 3S3VA 2VETA 4DPDA 2FZHA 4XSDA 4KL9A 5CC9A 1NJEA 3QGTA 4FGHA 3QG2A 1DRAA 1DR1A 1AOBA 3EELA 1JTQA 3ROAA 4P3RA 3F0BX 3D84X 2B3ZA 3VCOA 3NXOA 2FZJA 1NJAA 1EVFA 1HVYA 4DQ1A 4EZ8A 2GD9A 2C2SA 4IXFX 5HQYA 1F28A 1RD7A 1SEJA 3EEKA 2AZNA 3BGXA 2RD8B 3FY9X 1RC4A 2DHFA 1DR3A 4E5OA 3SRRX 3UWLB 1BP0A 3IX6A 1JG0A 1JTUA 3DGAC 4P66A 1DAJA 1DG7A 1QQQA 1PD9A 3UM8A 2BL9A 4KJJA 3KJRA 5HVBA 4Q0DA 1RB3A 3JWMA 1BDUA 4EB4A 1DIUA 3NZ6X 3CD2A 1TSXA 4ELGA 4HA7A 4G2OX 1DREA 4HA9A 3JTWA 5JG0X 3FQCA 1RX3A 1BSFA 1M79A 1IA2A 3FY8X 1NCEA 3KJSA 1EVGA 3GHCA 3EHIX 3NXYA 4EINA 4PDJA 2FTNA 1TVUA 3EBUA 3QL3A 2W9GA 4KNEA 5HT5A 3F8ZA 2W3WA 5EAJA 2W3VA 1THYA 5U26A 1BQ2A 3NXXA 4G95A 1TSYA 5J7WA 1B02A 4GYHA 4IQBA 3QJ7A 3FYVX 4KPWA 3QLWA 3BFIA 4UP1A 4ISKA 3EEMA 5JA3A 3F0QX 1J3JC 1TSNA 3FL8A 4FGTA 1YPVA 3FQZA 1VZDA 3NZBX 4G3MA 3UM6A 2RD8A 1DHIA 3TD8A 4TMSA 3QLZA 5H38A 2ANOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H96 A;  1RA3 A;  1DR7 A;  1IA1 A;  4M6J A;  4PTH A;  1RX9 A;  1VZB A;  1TLC A;  3C06 A;  1DYR A;  3DRC A;  3UM5 A;  1TSW A;  1D1G A;  3K74 A;  4GD7 A;  1IA3 A;  1DDS A;  1DR2 A;  1IA4 A;  3BHL A;  4ELF A;  1F4D A;  1SYN A;  3F8Y A;  2G89 A;  3NU0 A;  1AXW A;  1M78 A;  4QLG A;  3TQA A;  4ELB A;  1AO8 A;  1DRF A;  1RG7 A;  1MVS A;  2D0K A;  1JMF A;  2P4G A;  4H97 A;  4KFJ A;  3N5E A;  1TDA A;  1S3U A;  3QLR A;  2FTO X;  5HVE A;  4HOF A;  1B5D A;  3KGB A;  5ECC A;  1DYJ A;  3SGY A;  1HZW A;  2W3M A;  4I13 A;  4X5G A;  2W3A A;  3OAF A;  3IRN A;  1VZE A;  1TRG A;  3ED7 A;  1RX2 A;  3R33 A;  4LAE X;  4LAH X;  3GHV A;  4OR7 A;  4XT4 A;  3GYF A;  1E26 A;  1RX7 A;  3RO9 A;  1TVW A;  1DG5 A;  4FOX A;  4ISW A;  3L3R A;  4M2X A;  4DFR A;  1S3W A;  1LCA A;  4EIL A;  3FQF A;  1OHK A;  4FHB A;  4GEV A;  1AN5 A;  4LRR A;  4EIZ A;  3NZA X;  1TYS A;  2OIP A;  1JUV A;  1NJD A;  1BKP A;  3SRQ X;  3CL9 A;  1AI9 A;  3FYW X;  3H9K A;  3GI2 A;  4TU5 X;  4H95 A;  5E8Q A;  2HQP A;  4KYA A;  4P68 A;  3INV A;  2JYB A;  1KMS A;  3NZC X;  4KBN A;  4XT5 A;  1RX5 A;  1RX6 A;  4XT8 A;  1LY3 A;  3LG4 A;  5HT4 A;  4M7U A;  2G8A A;  3HB8 A;  1TSZ A;  3NXR A;  1RA8 A;  3BZ0 A;  5FCT A;  3N0H A;  4KJL A;  3SQY X;  1VZC A;  4XSE A;  3FL9 A;  3B5B A;  4PSS A;  4QHV A;  3KY8 A;  4FGG A;  1U70 A;  4F2V A;  4KAK A;  1TJS A;  1BSP A;  5DXV A;  3ZPC A;  1J3I A;  1BJG A;  3BNZ A;  3JWC A;  4NX6 A;  1LCE A;  3JVX A;  4KLX A;  2TSC A;  4DPH A;  3JWF A;  4LAG X;  1JMG A;  3BYX A;  1BOZ A;  1VJ3 A;  4IXE D;  2INQ A;  1DRB A;  1MVT A;  3N5E B;  3F0U X;  3F0V X;  1J3K A;  5ECX A;  4QLE A;  4XSC A;  4EJ1 A;  1KMV A;  4FOA A;  3NZ9 X;  3SRS X;  3SA2 A;  2FTQ A;  3EIG A;  1KZI A;  3NRR A;  1TDC A;  1F4F A;  1TLS A;  3JW5 A;  5DFR A;  3HJ3 A;  3DFR A;  5BY6 A;  5U27 A;  3F91 A;  4X5I A;  3IK0 A;  2W9S A;  1YHO A;  3QLX A;  1DG8 A;  2G8X A;  4IQQ A;  5HQZ A;  3TMS A;  4KM0 A;  5HS3 A;  4XEC X;  2G86 A;  4M7V A;  1TDR A;  2ITH A;  1HW3 A;  3K45 A;  3NXV A;  4KD7 A;  3FRA X;  4QJC A;  4ELH A;  1RA2 A;  4GH8 A;  3K47 A;  4X5J A;  1BO8 A;  2OBC A;  4KEB A;  1BZF A;  1RE7 A;  1LUD A;  1TSV A;  2KCE A;  1JOL A;  1PD8 A;  1F4C A;  4H1I A;  3QL0 A;  4RGC A;  2ONB A;  1RTS A;  4HOE A;  3IX9 A;  3EF9 A;  1DR6 A;  4QI9 A;  3B9H A;  3N5G A;  1JUJ A;  2HXV A;  3SA1 A;  1BID A;  3FS6 A;  5HSU A;  1TSD A;  5HI6 A;  2RDA A;  3DGA A;  3IA5 A;  2C2T A;  5HSR A;  1AJM A;  4Q0E A;  3S7A A;  1BQ1 A;  3F0X X;  7DFR A;  1TDU A;  1RH3 A;  1RB2 A;  2ANQ A;  1F4E A;  4X5H A;  2TDD A;  1DHJ A;  3QYL A;  1DDR A;  3CLB A;  4KNZ A;  4CD2 A;  4G8Z X;  3GHW A;  4QLF A;  1ZPR A;  4XRB A;  3EEJ A;  3D80 A;  3ZPG A;  2A9W A;  2BLA A;  1DIS A;  1BKO A;  1DRH A;  5CCC A;  3QLY A;  1B5E A;  8DFR A;  1NJC A;  1DF7 A;  3M09 A;  4EIG A;  1JOM A;  4JEF A;  1J3J A;  5H39 A;  1I00 A;  3TQ8 A;  1JMH A;  2G6V A;  1JU6 A;  3EX8 A;  4O1X D;  3GG5 A;  1DDU A;  1DR5 A;  4H0U A;  1S3V A;  1M7A A;  3DAT A;  3I8A X;  3M08 A;  1RF7 A;  1TIS A;  1RX4 A;  3EJL A;  2FZI A;  3FQO A;  1S3Y A;  4XT6 A;  4KM2 A;  1LY4 A;  1U71 A;  4Q67 A;  5HF2 X;  2TDM A;  2VF0 A;  3EAW X;  2BLB A;  3TQ9 A;  1PDB A;  3DL6 A;  1QZF A;  3IK1 A;  4O7U A;  1BO7 A;  1BPJ A;  3KGY A;  2L28 A;  4NX7 A;  1DYI A;  1HFP A;  4PSY A;  4E28 A;  1FWM A;  1TSL A;  4KY4 A;  4IRR A;  3FRE X;  2KGK A;  1VZA A;  4O1X A;  4FQS A;  4XE6 X;  1KZJ A;  1DLR A;  4PTJ A;  2BBQ A;  3V8H A;  1EV5 A;  3FRF X;  4H98 A;  5HF0 X;  4G6W X;  3DAU A;  4H0R A;  2CD2 A;  1TSM A;  4DP3 A;  3IJZ A;  3DG8 A;  3EGY X;  1F4G A;  3F0S X;  4PST A;  4O1U A;  5H3A A;  1FFL A;  1CD2 A;  1NJB A;  1CZ3 A;  2BLC A;  3EDW X;  2CIG A;  4P3Q A;  1HFQ A;  3FQV A;  2HM9 A;  6DFR A;  1F4B A;  4X5F A;  3DL5 A;  3K2H A;  3JWK A;  3KFY A;  3GH0 A;  5WRN A;  2DRC A;  1BP6 A;  4IXG X;  3SH2 A;  3NZD A;  3IRO A;  4M6L A;  2LF1 A;  4M6K A;  3FRD X;  4OSG A;  2W3B A;  3I3R A;  2H2Q A;  3JW3 A;  4QJZ D;  1JUT A;  2QK8 A;  3FQ0 A;  2W9T A;  1CI7 A;  1TVV A;  1DYH A;  3QYO A;  3QLS A;  5FDA A;  1EV8 A;  3IHI A;  3UWL A;  2ZZA A;  1DR4 A;  1ZDR A;  1KLK A;  2XW7 A;  3QFX A;  2W9H A;  2O7P A;  4KJK A;  3C0A A;  4DDR A;  4ECK A;  3OB7 A;  3CSE A;  4I1N A;  4LEK X;  1AIQ A;  3HBB A;  3SR5 X;  4ELE A;  1B49 A;  3E0B A;  4HOG A;  1U72 A;  3IA4 A;  2TSR A;  3BHR A;  1DLS A;  1J3I C;  1LCB A;  3FRB X;  3NTZ A;  3JSU A;  3NXT A;  1DNA A;  1HFR A;  3OCH A;  2D5N A;  3TQB A;  4XT7 A;  4KY8 A;  1RX1 A;  3IRM A;  4FOG A;  1RX8 A;  3SRU X;  1J3K C;  1HW4 A;  3GH2 X;  4Q6A A;  1RA1 A;  3S9U A;  1AOE A;  1KCE A;  3Q1H A;  3SRW X;  1VDR A;  1DHF A;  5HUI A;  4PSG A;  1RA9 A;  3SAI A;  1TDB A;  1OHJ A;  3RG9 A;  3DG8 C;  5HPB A;  1JMI A;  2AAZ A;  2G8D A;  3S3V A;  2VET A;  4DPD A;  2FZH A;  4XSD A;  4KL9 A;  5CC9 A;  1NJE A;  3QGT A;  4FGH A;  3QG2 A;  1DRA A;  1DR1 A;  1AOB A;  3EEL A;  1JTQ A;  3ROA A;  4P3R A;  3F0B X;  3D84 X;  2B3Z A;  3VCO A;  3NXO A;  2FZJ A;  1NJA A;  1EVF A;  1HVY A;  4DQ1 A;  4EZ8 A;  2GD9 A;  2C2S A;  4IXF X;  5HQY A;  1F28 A;  1RD7 A;  1SEJ A;  3EEK A;  2AZN A;  3BGX A;  2RD8 B;  3FY9 X;  1RC4 A;  2DHF A;  1DR3 A;  4E5O A;  3SRR X;  3UWL B;  1BP0 A;  3IX6 A;  1JG0 A;  1JTU A;  3DGA C;  4P66 A;  1DAJ A;  1DG7 A;  1QQQ A;  1PD9 A;  3UM8 A;  2BL9 A;  4KJJ A;  3KJR A;  5HVB A;  4Q0D A;  1RB3 A;  3JWM A;  1BDU A;  4EB4 A;  1DIU A;  3NZ6 X;  3CD2 A;  1TSX A;  4ELG A;  4HA7 A;  4G2O X;  1DRE A;  4HA9 A;  3JTW A;  5JG0 X;  3FQC A;  1RX3 A;  1BSF A;  1M79 A;  1IA2 A;  3FY8 X;  1NCE A;  3KJS A;  1EVG A;  3GHC A;  3EHI X;  3NXY A;  4EIN A;  4PDJ A;  2FTN A;  1TVU A;  3EBU A;  3QL3 A;  2W9G A;  4KNE A;  5HT5 A;  3F8Z A;  2W3W A;  5EAJ A;  2W3V A;  1THY A;  5U26 A;  1BQ2 A;  3NXX A;  4G95 A;  1TSY A;  5J7W A;  1B02 A;  4GYH A;  4IQB A;  3QJ7 A;  3FYV X;  4KPW A;  3QLW A;  3BFI A;  4UP1 A;  4ISK A;  3EEM A;  5JA3 A;  3F0Q X;  1J3J C;  1TSN A;  3FL8 A;  4FGT A;  1YPV A;  3FQZ A;  1VZD A;  3NZB X;  4G3M A;  3UM6 A;  2RD8 A;  1DHI A;  3TD8 A;  4TMS A;  3QLZ A;  5H38 A;  2ANO A; 
#chains in the Genus database with same CATH topology
 4H96 A;  1RA3 A;  1DR7 A;  1IA1 A;  4M6J A;  4PTH A;  1RX9 A;  1VZB A;  1TLC A;  3C06 A;  1DYR A;  3DRC A;  3UM5 A;  1TSW A;  1D1G A;  3K74 A;  4GD7 A;  1IA3 A;  1DDS A;  1DR2 A;  1IA4 A;  3BHL A;  4ELF A;  1F4D A;  1SYN A;  3F8Y A;  2G89 A;  3NU0 A;  1AXW A;  1M78 A;  4QLG A;  3TQA A;  4ELB A;  1AO8 A;  1DRF A;  1RG7 A;  1MVS A;  2D0K A;  1JMF A;  2P4G A;  4H97 A;  4KFJ A;  3N5E A;  1TDA A;  1S3U A;  3QLR A;  2FTO X;  5HVE A;  4HOF A;  1B5D A;  3KGB A;  5ECC A;  1DYJ A;  3SGY A;  1HZW A;  2W3M A;  4I13 A;  4X5G A;  2W3A A;  3OAF A;  3IRN A;  1VZE A;  1TRG A;  3ED7 A;  1RX2 A;  3R33 A;  4LAE X;  4LAH X;  3GHV A;  4OR7 A;  4XT4 A;  3GYF A;  1E26 A;  1RX7 A;  3RO9 A;  1TVW A;  1DG5 A;  4FOX A;  4ISW A;  3L3R A;  4M2X A;  4DFR A;  1S3W A;  1LCA A;  4EIL A;  3FQF A;  1OHK A;  4FHB A;  4GEV A;  1AN5 A;  4LRR A;  4EIZ A;  3NZA X;  1TYS A;  2OIP A;  1JUV A;  1NJD A;  1BKP A;  3SRQ X;  3CL9 A;  1AI9 A;  3FYW X;  3H9K A;  3GI2 A;  4TU5 X;  4H95 A;  5E8Q A;  2HQP A;  4KYA A;  4P68 A;  3INV A;  2JYB A;  1KMS A;  3NZC X;  4KBN A;  4XT5 A;  1RX5 A;  1RX6 A;  4XT8 A;  1LY3 A;  3LG4 A;  5HT4 A;  4M7U A;  2G8A A;  3HB8 A;  1TSZ A;  3NXR A;  1RA8 A;  3BZ0 A;  5FCT A;  3N0H A;  4KJL A;  3SQY X;  1VZC A;  4XSE A;  3FL9 A;  3B5B A;  4PSS A;  4QHV A;  3KY8 A;  4FGG A;  1U70 A;  4F2V A;  4KAK A;  1TJS A;  1BSP A;  5DXV A;  3ZPC A;  1J3I A;  1BJG A;  3BNZ A;  3JWC A;  4NX6 A;  1LCE A;  3JVX A;  4KLX A;  2TSC A;  4DPH A;  3JWF A;  4LAG X;  1JMG A;  3BYX A;  1BOZ A;  1VJ3 A;  4IXE D;  2INQ A;  1DRB A;  1MVT A;  3N5E B;  3F0U X;  3F0V X;  1J3K A;  5ECX A;  4QLE A;  4XSC A;  4EJ1 A;  1KMV A;  4FOA A;  3NZ9 X;  3SRS X;  3SA2 A;  2FTQ A;  3EIG A;  1KZI A;  3NRR A;  1TDC A;  1F4F A;  1TLS A;  3JW5 A;  5DFR A;  3HJ3 A;  3DFR A;  5BY6 A;  5U27 A;  3F91 A;  4X5I A;  3IK0 A;  2W9S A;  1YHO A;  3QLX A;  1DG8 A;  2G8X A;  4IQQ A;  5HQZ A;  3TMS A;  4KM0 A;  5HS3 A;  4XEC X;  2G86 A;  4M7V A;  1TDR A;  2ITH A;  1HW3 A;  3K45 A;  3NXV A;  4KD7 A;  3FRA X;  4QJC A;  4ELH A;  1RA2 A;  4GH8 A;  3K47 A;  4X5J A;  1BO8 A;  2OBC A;  4KEB A;  1BZF A;  1RE7 A;  1LUD A;  1TSV A;  2KCE A;  1JOL A;  1PD8 A;  1F4C A;  4H1I A;  3QL0 A;  4RGC A;  2ONB A;  1RTS A;  4HOE A;  3IX9 A;  3EF9 A;  1DR6 A;  4QI9 A;  3B9H A;  3N5G A;  1JUJ A;  2HXV A;  3SA1 A;  1BID A;  3FS6 A;  5HSU A;  1TSD A;  5HI6 A;  2RDA A;  3DGA A;  3IA5 A;  2C2T A;  5HSR A;  1AJM A;  4Q0E A;  3S7A A;  1BQ1 A;  3F0X X;  7DFR A;  1TDU A;  1RH3 A;  1RB2 A;  2ANQ A;  1F4E A;  4X5H A;  2TDD A;  1DHJ A;  3QYL A;  1DDR A;  3CLB A;  4KNZ A;  4CD2 A;  4G8Z X;  3GHW A;  4QLF A;  1ZPR A;  4XRB A;  3EEJ A;  3D80 A;  3ZPG A;  2A9W A;  2BLA A;  1DIS A;  1BKO A;  1DRH A;  5CCC A;  3QLY A;  1B5E A;  8DFR A;  1NJC A;  1DF7 A;  3M09 A;  4EIG A;  1JOM A;  4JEF A;  1J3J A;  5H39 A;  1I00 A;  3TQ8 A;  1JMH A;  2G6V A;  1JU6 A;  3EX8 A;  4O1X D;  3GG5 A;  1DDU A;  1DR5 A;  4H0U A;  1S3V A;  1M7A A;  3DAT A;  3I8A X;  3M08 A;  1RF7 A;  1TIS A;  1RX4 A;  3EJL A;  2FZI A;  3FQO A;  1S3Y A;  4XT6 A;  4KM2 A;  1LY4 A;  1U71 A;  4Q67 A;  5HF2 X;  2TDM A;  2VF0 A;  3EAW X;  2BLB A;  3TQ9 A;  1PDB A;  3DL6 A;  1QZF A;  3IK1 A;  4O7U A;  1BO7 A;  1BPJ A;  3KGY A;  2L28 A;  4NX7 A;  1DYI A;  1HFP A;  4PSY A;  4E28 A;  1FWM A;  1TSL A;  4KY4 A;  4IRR A;  3FRE X;  2KGK A;  1VZA A;  4O1X A;  4FQS A;  4XE6 X;  1KZJ A;  1DLR A;  4PTJ A;  2BBQ A;  3V8H A;  1EV5 A;  3FRF X;  4H98 A;  5HF0 X;  4G6W X;  3DAU A;  4H0R A;  2CD2 A;  1TSM A;  4DP3 A;  3IJZ A;  3DG8 A;  3EGY X;  1F4G A;  3F0S X;  4PST A;  4O1U A;  5H3A A;  1FFL A;  1CD2 A;  1NJB A;  1CZ3 A;  2BLC A;  3EDW X;  2CIG A;  4P3Q A;  1HFQ A;  3FQV A;  2HM9 A;  6DFR A;  1F4B A;  4X5F A;  3DL5 A;  3K2H A;  3JWK A;  3KFY A;  3GH0 A;  5WRN A;  2DRC A;  1BP6 A;  4IXG X;  3SH2 A;  3NZD A;  3IRO A;  4M6L A;  2LF1 A;  4M6K A;  3FRD X;  4OSG A;  2W3B A;  3I3R A;  2H2Q A;  3JW3 A;  4QJZ D;  1JUT A;  2QK8 A;  3FQ0 A;  2W9T A;  1CI7 A;  1TVV A;  1DYH A;  3QYO A;  3QLS A;  5FDA A;  1EV8 A;  3IHI A;  3UWL A;  2ZZA A;  1DR4 A;  1ZDR A;  1KLK A;  2XW7 A;  3QFX A;  2W9H A;  2O7P A;  4KJK A;  3C0A A;  4DDR A;  4ECK A;  3OB7 A;  3CSE A;  4I1N A;  4LEK X;  1AIQ A;  3HBB A;  3SR5 X;  4ELE A;  1B49 A;  3E0B A;  4HOG A;  1U72 A;  3IA4 A;  2TSR A;  3BHR A;  1DLS A;  1J3I C;  1LCB A;  3FRB X;  3NTZ A;  3JSU A;  3NXT A;  1DNA A;  1HFR A;  3OCH A;  2D5N A;  3TQB A;  4XT7 A;  4KY8 A;  1RX1 A;  3IRM A;  4FOG A;  1RX8 A;  3SRU X;  1J3K C;  1HW4 A;  3GH2 X;  4Q6A A;  1RA1 A;  3S9U A;  1AOE A;  1KCE A;  3Q1H A;  3SRW X;  1VDR A;  1DHF A;  5HUI A;  4PSG A;  1RA9 A;  3SAI A;  1TDB A;  1OHJ A;  3RG9 A;  3DG8 C;  5HPB A;  1JMI A;  2AAZ A;  2G8D A;  3S3V A;  2VET A;  4DPD A;  2FZH A;  4XSD A;  4KL9 A;  5CC9 A;  1NJE A;  3QGT A;  4FGH A;  3QG2 A;  1DRA A;  1DR1 A;  1AOB A;  3EEL A;  1JTQ A;  3ROA A;  4P3R A;  3F0B X;  3D84 X;  2B3Z A;  3VCO A;  3NXO A;  2FZJ A;  1NJA A;  1EVF A;  1HVY A;  4DQ1 A;  4EZ8 A;  2GD9 A;  2C2S A;  4IXF X;  5HQY A;  1F28 A;  1RD7 A;  1SEJ A;  3EEK A;  2AZN A;  3BGX A;  2RD8 B;  3FY9 X;  1RC4 A;  2DHF A;  1DR3 A;  4E5O A;  3SRR X;  3UWL B;  1BP0 A;  3IX6 A;  1JG0 A;  1JTU A;  3DGA C;  4P66 A;  1DAJ A;  1DG7 A;  1QQQ A;  1PD9 A;  3UM8 A;  2BL9 A;  4KJJ A;  3KJR A;  5HVB A;  4Q0D A;  1RB3 A;  3JWM A;  1BDU A;  4EB4 A;  1DIU A;  3NZ6 X;  3CD2 A;  1TSX A;  4ELG A;  4HA7 A;  4G2O X;  1DRE A;  4HA9 A;  3JTW A;  5JG0 X;  3FQC A;  1RX3 A;  1BSF A;  1M79 A;  1IA2 A;  3FY8 X;  1NCE A;  3KJS A;  1EVG A;  3GHC A;  3EHI X;  3NXY A;  4EIN A;  4PDJ A;  2FTN A;  1TVU A;  3EBU A;  3QL3 A;  2W9G A;  4KNE A;  5HT5 A;  3F8Z A;  2W3W A;  5EAJ A;  2W3V A;  1THY A;  5U26 A;  1BQ2 A;  3NXX A;  4G95 A;  1TSY A;  5J7W A;  1B02 A;  4GYH A;  4IQB A;  3QJ7 A;  3FYV X;  4KPW A;  3QLW A;  3BFI A;  4UP1 A;  4ISK A;  3EEM A;  5JA3 A;  3F0Q X;  1J3J C;  1TSN A;  3FL8 A;  4FGT A;  1YPV A;  3FQZ A;  1VZD A;  3NZB X;  4G3M A;  3UM6 A;  2RD8 A;  1DHI A;  3TD8 A;  4TMS A;  3QLZ A;  5H38 A;  2ANO A; 
#chains in the Genus database with same CATH homology
 4H96 A;  1RA3 A;  1DR7 A;  1IA1 A;  4M6J A;  4PTH A;  1RX9 A;  1VZB A;  1TLC A;  3C06 A;  1DYR A;  3DRC A;  3UM5 A;  1TSW A;  1D1G A;  3K74 A;  4GD7 A;  1IA3 A;  1DDS A;  1DR2 A;  1IA4 A;  3BHL A;  4ELF A;  1F4D A;  1SYN A;  3F8Y A;  2G89 A;  3NU0 A;  1AXW A;  1M78 A;  4QLG A;  3TQA A;  4ELB A;  1AO8 A;  1DRF A;  1RG7 A;  1MVS A;  2D0K A;  1JMF A;  2P4G A;  4H97 A;  4KFJ A;  3N5E A;  1TDA A;  1S3U A;  3QLR A;  2FTO X;  5HVE A;  4HOF A;  1B5D A;  3KGB A;  5ECC A;  1DYJ A;  3SGY A;  1HZW A;  2W3M A;  4I13 A;  4X5G A;  2W3A A;  3OAF A;  3IRN A;  1VZE A;  1TRG A;  3ED7 A;  1RX2 A;  3R33 A;  4LAE X;  4LAH X;  3GHV A;  4OR7 A;  4XT4 A;  3GYF A;  1E26 A;  1RX7 A;  3RO9 A;  1TVW A;  1DG5 A;  4FOX A;  4ISW A;  3L3R A;  4M2X A;  4DFR A;  1S3W A;  1LCA A;  4EIL A;  3FQF A;  1OHK A;  4FHB A;  4GEV A;  1AN5 A;  4LRR A;  4EIZ A;  3NZA X;  1TYS A;  2OIP A;  1JUV A;  1NJD A;  1BKP A;  3SRQ X;  3CL9 A;  1AI9 A;  3FYW X;  3H9K A;  3GI2 A;  4TU5 X;  4H95 A;  5E8Q A;  2HQP A;  4KYA A;  4P68 A;  3INV A;  2JYB A;  1KMS A;  3NZC X;  4KBN A;  4XT5 A;  1RX5 A;  1RX6 A;  4XT8 A;  1LY3 A;  3LG4 A;  5HT4 A;  4M7U A;  2G8A A;  3HB8 A;  1TSZ A;  3NXR A;  1RA8 A;  3BZ0 A;  5FCT A;  3N0H A;  4KJL A;  3SQY X;  1VZC A;  4XSE A;  3FL9 A;  3B5B A;  4PSS A;  4QHV A;  3KY8 A;  4FGG A;  1U70 A;  4F2V A;  4KAK A;  1TJS A;  1BSP A;  5DXV A;  3ZPC A;  1J3I A;  1BJG A;  3BNZ A;  3JWC A;  4NX6 A;  1LCE A;  3JVX A;  4KLX A;  2TSC A;  4DPH A;  3JWF A;  4LAG X;  1JMG A;  3BYX A;  1BOZ A;  1VJ3 A;  4IXE D;  2INQ A;  1DRB A;  1MVT A;  3N5E B;  3F0U X;  3F0V X;  1J3K A;  5ECX A;  4QLE A;  4XSC A;  4EJ1 A;  1KMV A;  4FOA A;  3NZ9 X;  3SRS X;  3SA2 A;  2FTQ A;  3EIG A;  1KZI A;  3NRR A;  1TDC A;  1F4F A;  1TLS A;  3JW5 A;  5DFR A;  3HJ3 A;  3DFR A;  5BY6 A;  5U27 A;  3F91 A;  4X5I A;  3IK0 A;  2W9S A;  1YHO A;  3QLX A;  1DG8 A;  2G8X A;  4IQQ A;  5HQZ A;  3TMS A;  4KM0 A;  5HS3 A;  4XEC X;  2G86 A;  4M7V A;  1TDR A;  2ITH A;  1HW3 A;  3K45 A;  3NXV A;  4KD7 A;  3FRA X;  4QJC A;  4ELH A;  1RA2 A;  4GH8 A;  3K47 A;  4X5J A;  1BO8 A;  2OBC A;  4KEB A;  1BZF A;  1RE7 A;  1LUD A;  1TSV A;  2KCE A;  1JOL A;  1PD8 A;  1F4C A;  4H1I A;  3QL0 A;  4RGC A;  2ONB A;  1RTS A;  4HOE A;  3IX9 A;  3EF9 A;  1DR6 A;  4QI9 A;  3B9H A;  3N5G A;  1JUJ A;  2HXV A;  3SA1 A;  1BID A;  3FS6 A;  5HSU A;  1TSD A;  5HI6 A;  2RDA A;  3DGA A;  3IA5 A;  2C2T A;  5HSR A;  1AJM A;  4Q0E A;  3S7A A;  1BQ1 A;  3F0X X;  7DFR A;  1TDU A;  1RH3 A;  1RB2 A;  2ANQ A;  1F4E A;  4X5H A;  2TDD A;  1DHJ A;  3QYL A;  1DDR A;  3CLB A;  4KNZ A;  4CD2 A;  4G8Z X;  3GHW A;  4QLF A;  1ZPR A;  4XRB A;  3EEJ A;  3D80 A;  3ZPG A;  2A9W A;  2BLA A;  1DIS A;  1BKO A;  1DRH A;  5CCC A;  3QLY A;  1B5E A;  8DFR A;  1NJC A;  1DF7 A;  3M09 A;  4EIG A;  1JOM A;  4JEF A;  1J3J A;  5H39 A;  1I00 A;  3TQ8 A;  1JMH A;  2G6V A;  1JU6 A;  3EX8 A;  4O1X D;  3GG5 A;  1DDU A;  1DR5 A;  4H0U A;  1S3V A;  1M7A A;  3DAT A;  3I8A X;  3M08 A;  1RF7 A;  1TIS A;  1RX4 A;  3EJL A;  2FZI A;  3FQO A;  1S3Y A;  4XT6 A;  4KM2 A;  1LY4 A;  1U71 A;  4Q67 A;  5HF2 X;  2TDM A;  2VF0 A;  3EAW X;  2BLB A;  3TQ9 A;  1PDB A;  3DL6 A;  1QZF A;  3IK1 A;  4O7U A;  1BO7 A;  1BPJ A;  3KGY A;  2L28 A;  4NX7 A;  1DYI A;  1HFP A;  4PSY A;  4E28 A;  1FWM A;  1TSL A;  4KY4 A;  4IRR A;  3FRE X;  2KGK A;  1VZA A;  4O1X A;  4FQS A;  4XE6 X;  1KZJ A;  1DLR A;  4PTJ A;  2BBQ A;  3V8H A;  1EV5 A;  3FRF X;  4H98 A;  5HF0 X;  4G6W X;  3DAU A;  4H0R A;  2CD2 A;  1TSM A;  4DP3 A;  3IJZ A;  3DG8 A;  3EGY X;  1F4G A;  3F0S X;  4PST A;  4O1U A;  5H3A A;  1FFL A;  1CD2 A;  1NJB A;  1CZ3 A;  2BLC A;  3EDW X;  2CIG A;  4P3Q A;  1HFQ A;  3FQV A;  2HM9 A;  6DFR A;  1F4B A;  4X5F A;  3DL5 A;  3K2H A;  3JWK A;  3KFY A;  3GH0 A;  5WRN A;  2DRC A;  1BP6 A;  4IXG X;  3SH2 A;  3NZD A;  3IRO A;  4M6L A;  2LF1 A;  4M6K A;  3FRD X;  4OSG A;  2W3B A;  3I3R A;  2H2Q A;  3JW3 A;  4QJZ D;  1JUT A;  2QK8 A;  3FQ0 A;  2W9T A;  1CI7 A;  1TVV A;  1DYH A;  3QYO A;  3QLS A;  5FDA A;  1EV8 A;  3IHI A;  3UWL A;  2ZZA A;  1DR4 A;  1ZDR A;  1KLK A;  2XW7 A;  3QFX A;  2W9H A;  2O7P A;  4KJK A;  3C0A A;  4DDR A;  4ECK A;  3OB7 A;  3CSE A;  4I1N A;  4LEK X;  1AIQ A;  3HBB A;  3SR5 X;  4ELE A;  1B49 A;  3E0B A;  4HOG A;  1U72 A;  3IA4 A;  2TSR A;  3BHR A;  1DLS A;  1J3I C;  1LCB A;  3FRB X;  3NTZ A;  3JSU A;  3NXT A;  1DNA A;  1HFR A;  3OCH A;  2D5N A;  3TQB A;  4XT7 A;  4KY8 A;  1RX1 A;  3IRM A;  4FOG A;  1RX8 A;  3SRU X;  1J3K C;  1HW4 A;  3GH2 X;  4Q6A A;  1RA1 A;  3S9U A;  1AOE A;  1KCE A;  3Q1H A;  3SRW X;  1VDR A;  1DHF A;  5HUI A;  4PSG A;  1RA9 A;  3SAI A;  1TDB A;  1OHJ A;  3RG9 A;  3DG8 C;  5HPB A;  1JMI A;  2AAZ A;  2G8D A;  3S3V A;  2VET A;  4DPD A;  2FZH A;  4XSD A;  4KL9 A;  5CC9 A;  1NJE A;  3QGT A;  4FGH A;  3QG2 A;  1DRA A;  1DR1 A;  1AOB A;  3EEL A;  1JTQ A;  3ROA A;  4P3R A;  3F0B X;  3D84 X;  2B3Z A;  3VCO A;  3NXO A;  2FZJ A;  1NJA A;  1EVF A;  1HVY A;  4DQ1 A;  4EZ8 A;  2GD9 A;  2C2S A;  4IXF X;  5HQY A;  1F28 A;  1RD7 A;  1SEJ A;  3EEK A;  2AZN A;  3BGX A;  2RD8 B;  3FY9 X;  1RC4 A;  2DHF A;  1DR3 A;  4E5O A;  3SRR X;  3UWL B;  1BP0 A;  3IX6 A;  1JG0 A;  1JTU A;  3DGA C;  4P66 A;  1DAJ A;  1DG7 A;  1QQQ A;  1PD9 A;  3UM8 A;  2BL9 A;  4KJJ A;  3KJR A;  5HVB A;  4Q0D A;  1RB3 A;  3JWM A;  1BDU A;  4EB4 A;  1DIU A;  3NZ6 X;  3CD2 A;  1TSX A;  4ELG A;  4HA7 A;  4G2O X;  1DRE A;  4HA9 A;  3JTW A;  5JG0 X;  3FQC A;  1RX3 A;  1BSF A;  1M79 A;  1IA2 A;  3FY8 X;  1NCE A;  3KJS A;  1EVG A;  3GHC A;  3EHI X;  3NXY A;  4EIN A;  4PDJ A;  2FTN A;  1TVU A;  3EBU A;  3QL3 A;  2W9G A;  4KNE A;  5HT5 A;  3F8Z A;  2W3W A;  5EAJ A;  2W3V A;  1THY A;  5U26 A;  1BQ2 A;  3NXX A;  4G95 A;  1TSY A;  5J7W A;  1B02 A;  4GYH A;  4IQB A;  3QJ7 A;  3FYV X;  4KPW A;  3QLW A;  3BFI A;  4UP1 A;  4ISK A;  3EEM A;  5JA3 A;  3F0Q X;  1J3J C;  1TSN A;  3FL8 A;  4FGT A;  1YPV A;  3FQZ A;  1VZD A;  3NZB X;  4G3M A;  3UM6 A;  2RD8 A;  1DHI A;  3TD8 A;  4TMS A;  3QLZ A;  5H38 A;  2ANO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...