4DPHA

Quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with p65 and nadph
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
606
structure length
538
Chain Sequence
EQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase, transferase
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title Malarial dihydrofolate reductase as a paradigm for drug development against a resistance-compromised target
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 173
structure length 538
sequence length 606
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4dphA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4dphA01
1KLKA 1HZWA 1TDUA 3SRQX 2W3VA 1HFRA 4RGCA 1TRGA 1RX2A 4KBNA 1KMSA 1RF7A 2TSCA 3TQBA 1J3IC 4KM0A 4IRRA 1BP0A 1M7AA 1LCAA 2O7PA 1TSVA 3EELA 4X5IA 1F4FA 4EB4A 4G2OX 2TDMA 3F0SX 4EJ1A 1DRFA 4XRBA 3SRSX 3FYVX 1BO7A 4FGHA 3I3RA 3DL6A 1DF7A 2CD2A 3B9HA 1AIQA 4Q0EA 4NX6A 2G89A 5BY6A 1BZFA 1NJCA 3DGAC 4FHBA 4I1NA 2BLBA 3SRWX 2ANQA 3L3RA 3N5EB 1JMFA 1QQQA 1HFQA 4KPWA 3OAFA 4X5JA 1DISA 3IK0A 3EAWX 2AAZA 4DQ1A 1TSMA 4Q6AA 4LAEX 1RE7A 3OB7A 4E28A 2ANOA 1B02A 1I00A 2INQA 3QLWA 3FL9A 3SQYX 1DHJA 1HW3A 3JWFA 3KY8A 1HFPA 1AN5A 3NRRA 3GHCA 4M6LA 1THYA 5HVEA 2VETA 1TVWA 3FQVA 4G3MA 2W9HA 3BNZA 2W9TA 1F4GA 4HA7A 4FGTA 4H95A 4XT6A 5HF0X 2D0KA 2JYBA 1E26A 1BPJA 1CI7A 1IA4A 2ZZAA 3GHWA 3TQ8A 3EF9A 4KJKA 1TSYA 3K2HA 3C0AA 2BLAA 3UWLA 4KY8A 3BYXA 5JA3A 3QJ7A 1BSPA 1TSDA 4TMSA 3CD2A 3IK1A 3D80A 4NX7A 1TVVA 1SYNA 3JW3A 1QZFA 3K74A 4PSTA 1MVSA 3JWMA 3NXOA 1J3IA 1DDUA 2OBCA 5U26A 3IA5A 3INVA 1BO8A 1DG7A 3TMSA 4UP1A 4QJCA 2TDDA 3CLBA 1KZIA 1PD9A 1D1GA 4QI9A 3EEMA 5CCCA 3QYOA 1FFLA 4M6KA 4X5FA 2BL9A 1DLSA 1MVTA 4JEFA 1DR4A 4FGGA 5ECXA 5E8QA 3BZ0A 4FOXA 3EJLA 4HA9A 2LF1A 4H97A 3DGAA 2HQPA 2XW7A 1CD2A 3FRAX 4GYHA 4LAGX 3QL0A 4PTHA 1DREA 4ELGA 3JVXA 2TSRA 1DYHA 3NTZA 2W3BA 4TU5X 1TSZA 3N5EA 4XSDA 1DG5A 1TDRA 5FDAA 3BHRA 3D84X 2GD9A 1PDBA 5HSRA 1AI9A 4ELEA 4IXGX 3FY8X 1LY4A 2OIPA 4KJJA 5CC9A 3QLSA 3SRRX 1RX1A 3HBBA 2DHFA 5H38A 3JW5A 1YPVA 1ZPRA 1VZAA 5HQZA 5HSUA 4KNEA 1RA9A 4H1IA 3QG2A 3IJZA 1EV8A 1DRHA 1TSLA 2DRCA 1EV5A 1TDBA 3E0BA 2RD8A 3FQFA 3FS6A 4KEBA 1OHKA 3DATA 5H39A 1BDUA 1JUJA 3GG5A 3F8ZA 5WRNA 3NXTA 3DFRA 5U27A 1DHIA 4FOGA 3NXXA 1DR6A 1RC4A 1F4BA 3NZAX 1JMHA 5HF2X 1DR2A 5J7WA 3EEKA 1RX5A 1TJSA 3FQZA 4P3RA 1TSXA 3TD8A 2W3WA 1F4CA 4M7UA 1NJEA 3F0UX 4EILA 1DDSA 5FCTA 3F91A 3F0QX 4PTJA 1TLCA 4QLEA 1EVFA 3QL3A 3FRBX 1DYJA 1F28A 1SEJA 3QLXA 1VDRA 1RA2A 3FREX 5HPBA 3NZ6X 4O1XA 1J3JC 5H3AA 2B3ZA 3FQCA 2FTQA 3NZDA 4ELBA 3HJ3A 4O1XD 1JUTA 3GH2X 4XSCA 5HUIA 1U70A 1B49A 3FRFX 3IX9A 1DRAA 1AXWA 1DYIA 1NJAA 3KJSA 1AJMA 1DNAA 3EX8A 3B5BA 3FQOA 3QLYA 4HOGA 4KL9A 4XE6X 2RDAA 4XSEA 2KCEA 4KY4A 1KCEA 1DYRA 3C06A 1JG0A 1IA1A 1KMVA 1S3VA 1B5EA 2D5NA 5HS3A 3ED7A 4XT8A 3EIGA 4KJLA 4QLFA 3M09A 2HXVA 1ZDRA 2G86A 3ROAA 1VZEA 1BJGA 1YHOA 2CIGA 1RD7A 3BFIA 1DHFA 5DXVA 2G8DA 4HOFA 4X5GA 5ECCA 1NJBA 3SA1A 3SH2A 3I8AX 1RX7A 1RX4A 2KGKA 3UM5A 4KM2A 1TISA 2BBQA 1LCEA 4M6JA 4G8ZX 1DIUA 1NCEA 4X5HA 2L28A 3QGTA 4FOAA 1F4DA 1BSFA 4DPHA 4Q67A 1M79A 1LCBA 4GH8A 1KZJA 5HT4A 4O7UA 4HOEA 3NZCX 3IRNA 1HVYA 2G6VA 2A9WA 1DG8A 1DR5A 1TSWA 3JWCA 1JU6A 3QLZA 3V8HA 4XT5A 3BGXA 3SRUX 1DR1A 3JTWA 4PSSA 1RG7A 4P68A 4KYAA 1TVUA 4QLGA 3CL9A 3EHIX 3GH0A 1DR3A 4EINA 2C2TA 1J3JA 2BLCA 3K47A 3H9KA 4PSGA 2W9GA 4Q0DA 4F2VA 3F0XX 1LUDA 1RX8A 1RX3A 4OR7A 5EAJA 4ELHA 1J3KC 4XT7A 3IHIA 1DRBA 3S3VA 1AOEA 1RA8A 1IA3A 4LAHX 4E5OA 2FZJA 4PDJA 3SAIA 4PSYA 4M7VA 5HVBA 3SR5X 1TSNA 1RH3A 1RX9A 2P4GA 3UM6A 3DG8C 4H0UA 1RB2A 3F0VX 1B5DA 5DFRA 3SA2A 3EDWX 1U72A 3NZ9X 4KLXA 2FTOX 4EIGA 3FY9X 4GD7A 3S7AA 3EBUA 4EZ8A 2HM9A 4G6WX 2ONBA 3KGYA 3IX6A 4GEVA 4CD2A 1RA3A 2FZIA 1NJDA 1RX6A 3M08A 8DFRA 4H0RA 4IXFX 1JMGA 3IRMA 3EEJA 3IROA 1IA2A 1LY3A 3NZBX 3KGBA 1VZDA 4ISWA 2VF0A 4FQSA 4M2XA 3IA4A 3NU0A 3ZPCA 3RO9A 3DRCA 3K45A 4P66A 2H2QA 4OSGA 4DP3A 1M78A 3SGYA 4DPDA 4O1UA 1DLRA 3NXYA 3S9UA 2FTNA 1VZBA 3Q1HA 5HT5A 1JMIA 1CZ3A 4I13A 1BQ2A 4ISKA 4KAKA 1AOBA 2W3AA 1S3WA 1AO8A 2G8XA 1BIDA 4G95A 3RG9A 1VJ3A 4H98A 4LRRA 3FL8A 3HB8A 3N5GA 1BKPA 4ECKA 1JUVA 3FYWX 1S3UA 3VCOA 2RD8B 4ELFA 5JG0X 1JTQA 4QHVA 4LEKX 1TYSA 3FQ0A 3QLRA 3CSEA 1OHJA 5HQYA 3TQ9A 1J3KA 4P3QA 3JSUA 1TDCA 5HI6A 1DDRA 1S3YA 1U71A 1BP6A 3F0BX 4H96A 3KFYA 4DFRA 3LG4A 3FRDX 4KNZA 4KFJA 1FWMA 1RTSA 3DG8A 1BKOA 1HW4A 2G8AA 3N0HA 4IXED 1F4EA 3GI2A 2AZNA 4IQBA 1DAJA 3EGYX 2ITHA 3DAUA 1BOZA 4EIZA 3QYLA 3UM8A 1BQ1A 1PD8A 7DFRA 3QFXA 3TQAA 2C2SA 3R33A 4XT4A 3ZPGA 3KJRA 3F8YA 3GHVA 4KD7A 4QJZD 3DL5A 3JWKA 1DR7A 1JOLA 1JOMA 2W9SA 1RA1A 6DFRA 1EVGA 2QK8A 3BHLA 1RB3A 3NXVA 1VZCA 1JTUA 4IQQA 3UWLB 1TLSA 4DDRA 2FZHA 3NXRA 3OCHA 4XECX 3GYFA 2W3MA 1TDAA
chains in the Genus database with same CATH superfamily
1KLKA 1HZWA 1TDUA 3SRQX 2W3VA 1HFRA 4RGCA 1TRGA 1RX2A 4KBNA 1KMSA 1RF7A 2TSCA 3TQBA 1J3IC 4KM0A 4IRRA 1BP0A 1M7AA 1LCAA 2O7PA 1TSVA 3EELA 4X5IA 1F4FA 4EB4A 4G2OX 2TDMA 3F0SX 4EJ1A 1DRFA 4XRBA 3SRSX 3FYVX 1BO7A 4FGHA 3I3RA 3DL6A 1DF7A 2CD2A 3B9HA 1AIQA 4Q0EA 4NX6A 2G89A 5BY6A 1BZFA 1NJCA 3DGAC 4FHBA 4I1NA 2BLBA 3SRWX 2ANQA 3L3RA 3N5EB 1JMFA 1QQQA 1HFQA 4KPWA 3OAFA 4X5JA 1DISA 3IK0A 3EAWX 2AAZA 4DQ1A 1TSMA 4Q6AA 4LAEX 1RE7A 3OB7A 4E28A 2ANOA 1B02A 1I00A 2INQA 3QLWA 3FL9A 3SQYX 1DHJA 1HW3A 3JWFA 3KY8A 1HFPA 1AN5A 3NRRA 3GHCA 4M6LA 1THYA 5HVEA 2VETA 1TVWA 3FQVA 4G3MA 2W9HA 3BNZA 2W9TA 1F4GA 4HA7A 4FGTA 4H95A 4XT6A 5HF0X 2D0KA 2JYBA 1E26A 1BPJA 1CI7A 1IA4A 2ZZAA 3GHWA 3TQ8A 3EF9A 4KJKA 1TSYA 3K2HA 3C0AA 2BLAA 3UWLA 4KY8A 3BYXA 5JA3A 3QJ7A 1BSPA 1TSDA 4TMSA 3CD2A 3IK1A 3D80A 4NX7A 1TVVA 1SYNA 3JW3A 1QZFA 3K74A 4PSTA 1MVSA 3JWMA 3NXOA 1J3IA 1DDUA 2OBCA 5U26A 3IA5A 3INVA 1BO8A 1DG7A 3TMSA 4UP1A 4QJCA 2TDDA 3CLBA 1KZIA 1PD9A 1D1GA 4QI9A 3EEMA 5CCCA 3QYOA 1FFLA 4M6KA 4X5FA 2BL9A 1DLSA 1MVTA 4JEFA 1DR4A 4FGGA 5ECXA 5E8QA 3BZ0A 4FOXA 3EJLA 4HA9A 2LF1A 4H97A 3DGAA 2HQPA 2XW7A 1CD2A 3FRAX 4GYHA 4LAGX 3QL0A 4PTHA 1DREA 4ELGA 3JVXA 2TSRA 1DYHA 3NTZA 2W3BA 4TU5X 1TSZA 3N5EA 4XSDA 1DG5A 1TDRA 5FDAA 3BHRA 3D84X 2GD9A 1PDBA 5HSRA 1AI9A 4ELEA 4IXGX 3FY8X 1LY4A 2OIPA 4KJJA 5CC9A 3QLSA 3SRRX 1RX1A 3HBBA 2DHFA 5H38A 3JW5A 1YPVA 1ZPRA 1VZAA 5HQZA 5HSUA 4KNEA 1RA9A 4H1IA 3QG2A 3IJZA 1EV8A 1DRHA 1TSLA 2DRCA 1EV5A 1TDBA 3E0BA 2RD8A 3FQFA 3FS6A 4KEBA 1OHKA 3DATA 5H39A 1BDUA 1JUJA 3GG5A 3F8ZA 5WRNA 3NXTA 3DFRA 5U27A 1DHIA 4FOGA 3NXXA 1DR6A 1RC4A 1F4BA 3NZAX 1JMHA 5HF2X 1DR2A 5J7WA 3EEKA 1RX5A 1TJSA 3FQZA 4P3RA 1TSXA 3TD8A 2W3WA 1F4CA 4M7UA 1NJEA 3F0UX 4EILA 1DDSA 5FCTA 3F91A 3F0QX 4PTJA 1TLCA 4QLEA 1EVFA 3QL3A 3FRBX 1DYJA 1F28A 1SEJA 3QLXA 1VDRA 1RA2A 3FREX 5HPBA 3NZ6X 4O1XA 1J3JC 5H3AA 2B3ZA 3FQCA 2FTQA 3NZDA 4ELBA 3HJ3A 4O1XD 1JUTA 3GH2X 4XSCA 5HUIA 1U70A 1B49A 3FRFX 3IX9A 1DRAA 1AXWA 1DYIA 1NJAA 3KJSA 1AJMA 1DNAA 3EX8A 3B5BA 3FQOA 3QLYA 4HOGA 4KL9A 4XE6X 2RDAA 4XSEA 2KCEA 4KY4A 1KCEA 1DYRA 3C06A 1JG0A 1IA1A 1KMVA 1S3VA 1B5EA 2D5NA 5HS3A 3ED7A 4XT8A 3EIGA 4KJLA 4QLFA 3M09A 2HXVA 1ZDRA 2G86A 3ROAA 1VZEA 1BJGA 1YHOA 2CIGA 1RD7A 3BFIA 1DHFA 5DXVA 2G8DA 4HOFA 4X5GA 5ECCA 1NJBA 3SA1A 3SH2A 3I8AX 1RX7A 1RX4A 2KGKA 3UM5A 4KM2A 1TISA 2BBQA 1LCEA 4M6JA 4G8ZX 1DIUA 1NCEA 4X5HA 2L28A 3QGTA 4FOAA 1F4DA 1BSFA 4DPHA 4Q67A 1M79A 1LCBA 4GH8A 1KZJA 5HT4A 4O7UA 4HOEA 3NZCX 3IRNA 1HVYA 2G6VA 2A9WA 1DG8A 1DR5A 1TSWA 3JWCA 1JU6A 3QLZA 3V8HA 4XT5A 3BGXA 3SRUX 1DR1A 3JTWA 4PSSA 1RG7A 4P68A 4KYAA 1TVUA 4QLGA 3CL9A 3EHIX 3GH0A 1DR3A 4EINA 2C2TA 1J3JA 2BLCA 3K47A 3H9KA 4PSGA 2W9GA 4Q0DA 4F2VA 3F0XX 1LUDA 1RX8A 1RX3A 4OR7A 5EAJA 4ELHA 1J3KC 4XT7A 3IHIA 1DRBA 3S3VA 1AOEA 1RA8A 1IA3A 4LAHX 4E5OA 2FZJA 4PDJA 3SAIA 4PSYA 4M7VA 5HVBA 3SR5X 1TSNA 1RH3A 1RX9A 2P4GA 3UM6A 3DG8C 4H0UA 1RB2A 3F0VX 1B5DA 5DFRA 3SA2A 3EDWX 1U72A 3NZ9X 4KLXA 2FTOX 4EIGA 3FY9X 4GD7A 3S7AA 3EBUA 4EZ8A 2HM9A 4G6WX 2ONBA 3KGYA 3IX6A 4GEVA 4CD2A 1RA3A 2FZIA 1NJDA 1RX6A 3M08A 8DFRA 4H0RA 4IXFX 1JMGA 3IRMA 3EEJA 3IROA 1IA2A 1LY3A 3NZBX 3KGBA 1VZDA 4ISWA 2VF0A 4FQSA 4M2XA 3IA4A 3NU0A 3ZPCA 3RO9A 3DRCA 3K45A 4P66A 2H2QA 4OSGA 4DP3A 1M78A 3SGYA 4DPDA 4O1UA 1DLRA 3NXYA 3S9UA 2FTNA 1VZBA 3Q1HA 5HT5A 1JMIA 1CZ3A 4I13A 1BQ2A 4ISKA 4KAKA 1AOBA 2W3AA 1S3WA 1AO8A 2G8XA 1BIDA 4G95A 3RG9A 1VJ3A 4H98A 4LRRA 3FL8A 3HB8A 3N5GA 1BKPA 4ECKA 1JUVA 3FYWX 1S3UA 3VCOA 2RD8B 4ELFA 5JG0X 1JTQA 4QHVA 4LEKX 1TYSA 3FQ0A 3QLRA 3CSEA 1OHJA 5HQYA 3TQ9A 1J3KA 4P3QA 3JSUA 1TDCA 5HI6A 1DDRA 1S3YA 1U71A 1BP6A 3F0BX 4H96A 3KFYA 4DFRA 3LG4A 3FRDX 4KNZA 4KFJA 1FWMA 1RTSA 3DG8A 1BKOA 1HW4A 2G8AA 3N0HA 4IXED 1F4EA 3GI2A 2AZNA 4IQBA 1DAJA 3EGYX 2ITHA 3DAUA 1BOZA 4EIZA 3QYLA 3UM8A 1BQ1A 1PD8A 7DFRA 3QFXA 3TQAA 2C2SA 3R33A 4XT4A 3ZPGA 3KJRA 3F8YA 3GHVA 4KD7A 4QJZD 3DL5A 3JWKA 1DR7A 1JOLA 1JOMA 2W9SA 1RA1A 6DFRA 1EVGA 2QK8A 3BHLA 1RB3A 3NXVA 1VZCA 1JTUA 4IQQA 3UWLB 1TLSA 4DDRA 2FZHA 3NXRA 3OCHA 4XECX 3GYFA 2W3MA 1TDAA
chains in the Genus database with same CATH topology
1KLKA 1HZWA 1TDUA 3SRQX 2W3VA 1HFRA 4RGCA 1TRGA 1RX2A 4KBNA 1KMSA 1RF7A 2TSCA 3TQBA 1J3IC 4KM0A 4IRRA 1BP0A 1M7AA 1LCAA 2O7PA 1TSVA 3EELA 4X5IA 1F4FA 4EB4A 4G2OX 2TDMA 3F0SX 4EJ1A 1DRFA 4XRBA 3SRSX 3FYVX 1BO7A 4FGHA 3I3RA 3DL6A 1DF7A 2CD2A 3B9HA 1AIQA 4Q0EA 4NX6A 2G89A 5BY6A 1BZFA 1NJCA 3DGAC 4FHBA 4I1NA 2BLBA 3SRWX 2ANQA 3L3RA 3N5EB 1JMFA 1QQQA 1HFQA 4KPWA 3OAFA 4X5JA 1DISA 3IK0A 3EAWX 2AAZA 4DQ1A 1TSMA 4Q6AA 4LAEX 1RE7A 3OB7A 4E28A 2ANOA 1B02A 1I00A 2INQA 3QLWA 3FL9A 3SQYX 1DHJA 1HW3A 3JWFA 3KY8A 1HFPA 1AN5A 3NRRA 3GHCA 4M6LA 1THYA 5HVEA 2VETA 1TVWA 3FQVA 4G3MA 2W9HA 3BNZA 2W9TA 1F4GA 4HA7A 4FGTA 4H95A 4XT6A 5HF0X 2D0KA 2JYBA 1E26A 1BPJA 1CI7A 1IA4A 2ZZAA 3GHWA 3TQ8A 3EF9A 4KJKA 1TSYA 3K2HA 3C0AA 2BLAA 3UWLA 4KY8A 3BYXA 5JA3A 3QJ7A 1BSPA 1TSDA 4TMSA 3CD2A 3IK1A 3D80A 4NX7A 1TVVA 1SYNA 3JW3A 1QZFA 3K74A 4PSTA 1MVSA 3JWMA 3NXOA 1J3IA 1DDUA 2OBCA 5U26A 3IA5A 3INVA 1BO8A 1DG7A 3TMSA 4UP1A 4QJCA 2TDDA 3CLBA 1KZIA 1PD9A 1D1GA 4QI9A 3EEMA 5CCCA 3QYOA 1FFLA 4M6KA 4X5FA 2BL9A 1DLSA 1MVTA 4JEFA 1DR4A 4FGGA 5ECXA 5E8QA 3BZ0A 4FOXA 3EJLA 4HA9A 2LF1A 4H97A 3DGAA 2HQPA 2XW7A 1CD2A 3FRAX 4GYHA 4LAGX 3QL0A 4PTHA 1DREA 4ELGA 3JVXA 2TSRA 1DYHA 3NTZA 2W3BA 4TU5X 1TSZA 3N5EA 4XSDA 1DG5A 1TDRA 5FDAA 3BHRA 3D84X 2GD9A 1PDBA 5HSRA 1AI9A 4ELEA 4IXGX 3FY8X 1LY4A 2OIPA 4KJJA 5CC9A 3QLSA 3SRRX 1RX1A 3HBBA 2DHFA 5H38A 3JW5A 1YPVA 1ZPRA 1VZAA 5HQZA 5HSUA 4KNEA 1RA9A 4H1IA 3QG2A 3IJZA 1EV8A 1DRHA 1TSLA 2DRCA 1EV5A 1TDBA 3E0BA 2RD8A 3FQFA 3FS6A 4KEBA 1OHKA 3DATA 5H39A 1BDUA 1JUJA 3GG5A 3F8ZA 5WRNA 3NXTA 3DFRA 5U27A 1DHIA 4FOGA 3NXXA 1DR6A 1RC4A 1F4BA 3NZAX 1JMHA 5HF2X 1DR2A 5J7WA 3EEKA 1RX5A 1TJSA 3FQZA 4P3RA 1TSXA 3TD8A 2W3WA 1F4CA 4M7UA 1NJEA 3F0UX 4EILA 1DDSA 5FCTA 3F91A 3F0QX 4PTJA 1TLCA 4QLEA 1EVFA 3QL3A 3FRBX 1DYJA 1F28A 1SEJA 3QLXA 1VDRA 1RA2A 3FREX 5HPBA 3NZ6X 4O1XA 1J3JC 5H3AA 2B3ZA 3FQCA 2FTQA 3NZDA 4ELBA 3HJ3A 4O1XD 1JUTA 3GH2X 4XSCA 5HUIA 1U70A 1B49A 3FRFX 3IX9A 1DRAA 1AXWA 1DYIA 1NJAA 3KJSA 1AJMA 1DNAA 3EX8A 3B5BA 3FQOA 3QLYA 4HOGA 4KL9A 4XE6X 2RDAA 4XSEA 2KCEA 4KY4A 1KCEA 1DYRA 3C06A 1JG0A 1IA1A 1KMVA 1S3VA 1B5EA 2D5NA 5HS3A 3ED7A 4XT8A 3EIGA 4KJLA 4QLFA 3M09A 2HXVA 1ZDRA 2G86A 3ROAA 1VZEA 1BJGA 1YHOA 2CIGA 1RD7A 3BFIA 1DHFA 5DXVA 2G8DA 4HOFA 4X5GA 5ECCA 1NJBA 3SA1A 3SH2A 3I8AX 1RX7A 1RX4A 2KGKA 3UM5A 4KM2A 1TISA 2BBQA 1LCEA 4M6JA 4G8ZX 1DIUA 1NCEA 4X5HA 2L28A 3QGTA 4FOAA 1F4DA 1BSFA 4DPHA 4Q67A 1M79A 1LCBA 4GH8A 1KZJA 5HT4A 4O7UA 4HOEA 3NZCX 3IRNA 1HVYA 2G6VA 2A9WA 1DG8A 1DR5A 1TSWA 3JWCA 1JU6A 3QLZA 3V8HA 4XT5A 3BGXA 3SRUX 1DR1A 3JTWA 4PSSA 1RG7A 4P68A 4KYAA 1TVUA 4QLGA 3CL9A 3EHIX 3GH0A 1DR3A 4EINA 2C2TA 1J3JA 2BLCA 3K47A 3H9KA 4PSGA 2W9GA 4Q0DA 4F2VA 3F0XX 1LUDA 1RX8A 1RX3A 4OR7A 5EAJA 4ELHA 1J3KC 4XT7A 3IHIA 1DRBA 3S3VA 1AOEA 1RA8A 1IA3A 4LAHX 4E5OA 2FZJA 4PDJA 3SAIA 4PSYA 4M7VA 5HVBA 3SR5X 1TSNA 1RH3A 1RX9A 2P4GA 3UM6A 3DG8C 4H0UA 1RB2A 3F0VX 1B5DA 5DFRA 3SA2A 3EDWX 1U72A 3NZ9X 4KLXA 2FTOX 4EIGA 3FY9X 4GD7A 3S7AA 3EBUA 4EZ8A 2HM9A 4G6WX 2ONBA 3KGYA 3IX6A 4GEVA 4CD2A 1RA3A 2FZIA 1NJDA 1RX6A 3M08A 8DFRA 4H0RA 4IXFX 1JMGA 3IRMA 3EEJA 3IROA 1IA2A 1LY3A 3NZBX 3KGBA 1VZDA 4ISWA 2VF0A 4FQSA 4M2XA 3IA4A 3NU0A 3ZPCA 3RO9A 3DRCA 3K45A 4P66A 2H2QA 4OSGA 4DP3A 1M78A 3SGYA 4DPDA 4O1UA 1DLRA 3NXYA 3S9UA 2FTNA 1VZBA 3Q1HA 5HT5A 1JMIA 1CZ3A 4I13A 1BQ2A 4ISKA 4KAKA 1AOBA 2W3AA 1S3WA 1AO8A 2G8XA 1BIDA 4G95A 3RG9A 1VJ3A 4H98A 4LRRA 3FL8A 3HB8A 3N5GA 1BKPA 4ECKA 1JUVA 3FYWX 1S3UA 3VCOA 2RD8B 4ELFA 5JG0X 1JTQA 4QHVA 4LEKX 1TYSA 3FQ0A 3QLRA 3CSEA 1OHJA 5HQYA 3TQ9A 1J3KA 4P3QA 3JSUA 1TDCA 5HI6A 1DDRA 1S3YA 1U71A 1BP6A 3F0BX 4H96A 3KFYA 4DFRA 3LG4A 3FRDX 4KNZA 4KFJA 1FWMA 1RTSA 3DG8A 1BKOA 1HW4A 2G8AA 3N0HA 4IXED 1F4EA 3GI2A 2AZNA 4IQBA 1DAJA 3EGYX 2ITHA 3DAUA 1BOZA 4EIZA 3QYLA 3UM8A 1BQ1A 1PD8A 7DFRA 3QFXA 3TQAA 2C2SA 3R33A 4XT4A 3ZPGA 3KJRA 3F8YA 3GHVA 4KD7A 4QJZD 3DL5A 3JWKA 1DR7A 1JOLA 1JOMA 2W9SA 1RA1A 6DFRA 1EVGA 2QK8A 3BHLA 1RB3A 3NXVA 1VZCA 1JTUA 4IQQA 3UWLB 1TLSA 4DDRA 2FZHA 3NXRA 3OCHA 4XECX 3GYFA 2W3MA 1TDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KLK A;  1HZW A;  1TDU A;  3SRQ X;  2W3V A;  1HFR A;  4RGC A;  1TRG A;  1RX2 A;  4KBN A;  1KMS A;  1RF7 A;  2TSC A;  3TQB A;  1J3I C;  4KM0 A;  4IRR A;  1BP0 A;  1M7A A;  1LCA A;  2O7P A;  1TSV A;  3EEL A;  4X5I A;  1F4F A;  4EB4 A;  4G2O X;  2TDM A;  3F0S X;  4EJ1 A;  1DRF A;  4XRB A;  3SRS X;  3FYV X;  1BO7 A;  4FGH A;  3I3R A;  3DL6 A;  1DF7 A;  2CD2 A;  3B9H A;  1AIQ A;  4Q0E A;  4NX6 A;  2G89 A;  5BY6 A;  1BZF A;  1NJC A;  3DGA C;  4FHB A;  4I1N A;  2BLB A;  3SRW X;  2ANQ A;  3L3R A;  3N5E B;  1JMF A;  1QQQ A;  1HFQ A;  4KPW A;  3OAF A;  4X5J A;  1DIS A;  3IK0 A;  3EAW X;  2AAZ A;  4DQ1 A;  1TSM A;  4Q6A A;  4LAE X;  1RE7 A;  3OB7 A;  4E28 A;  2ANO A;  1B02 A;  1I00 A;  2INQ A;  3QLW A;  3FL9 A;  3SQY X;  1DHJ A;  1HW3 A;  3JWF A;  3KY8 A;  1HFP A;  1AN5 A;  3NRR A;  3GHC A;  4M6L A;  1THY A;  5HVE A;  2VET A;  1TVW A;  3FQV A;  4G3M A;  2W9H A;  3BNZ A;  2W9T A;  1F4G A;  4HA7 A;  4FGT A;  4H95 A;  4XT6 A;  5HF0 X;  2D0K A;  2JYB A;  1E26 A;  1BPJ A;  1CI7 A;  1IA4 A;  2ZZA A;  3GHW A;  3TQ8 A;  3EF9 A;  4KJK A;  1TSY A;  3K2H A;  3C0A A;  2BLA A;  3UWL A;  4KY8 A;  3BYX A;  5JA3 A;  3QJ7 A;  1BSP A;  1TSD A;  4TMS A;  3CD2 A;  3IK1 A;  3D80 A;  4NX7 A;  1TVV A;  1SYN A;  3JW3 A;  1QZF A;  3K74 A;  4PST A;  1MVS A;  3JWM A;  3NXO A;  1J3I A;  1DDU A;  2OBC A;  5U26 A;  3IA5 A;  3INV A;  1BO8 A;  1DG7 A;  3TMS A;  4UP1 A;  4QJC A;  2TDD A;  3CLB A;  1KZI A;  1PD9 A;  1D1G A;  4QI9 A;  3EEM A;  5CCC A;  3QYO A;  1FFL A;  4M6K A;  4X5F A;  2BL9 A;  1DLS A;  1MVT A;  4JEF A;  1DR4 A;  4FGG A;  5ECX A;  5E8Q A;  3BZ0 A;  4FOX A;  3EJL A;  4HA9 A;  2LF1 A;  4H97 A;  3DGA A;  2HQP A;  2XW7 A;  1CD2 A;  3FRA X;  4GYH A;  4LAG X;  3QL0 A;  4PTH A;  1DRE A;  4ELG A;  3JVX A;  2TSR A;  1DYH A;  3NTZ A;  2W3B A;  4TU5 X;  1TSZ A;  3N5E A;  4XSD A;  1DG5 A;  1TDR A;  5FDA A;  3BHR A;  3D84 X;  2GD9 A;  1PDB A;  5HSR A;  1AI9 A;  4ELE A;  4IXG X;  3FY8 X;  1LY4 A;  2OIP A;  4KJJ A;  5CC9 A;  3QLS A;  3SRR X;  1RX1 A;  3HBB A;  2DHF A;  5H38 A;  3JW5 A;  1YPV A;  1ZPR A;  1VZA A;  5HQZ A;  5HSU A;  4KNE A;  1RA9 A;  4H1I A;  3QG2 A;  3IJZ A;  1EV8 A;  1DRH A;  1TSL A;  2DRC A;  1EV5 A;  1TDB A;  3E0B A;  2RD8 A;  3FQF A;  3FS6 A;  4KEB A;  1OHK A;  3DAT A;  5H39 A;  1BDU A;  1JUJ A;  3GG5 A;  3F8Z A;  5WRN A;  3NXT A;  3DFR A;  5U27 A;  1DHI A;  4FOG A;  3NXX A;  1DR6 A;  1RC4 A;  1F4B A;  3NZA X;  1JMH A;  5HF2 X;  1DR2 A;  5J7W A;  3EEK A;  1RX5 A;  1TJS A;  3FQZ A;  4P3R A;  1TSX A;  3TD8 A;  2W3W A;  1F4C A;  4M7U A;  1NJE A;  3F0U X;  4EIL A;  1DDS A;  5FCT A;  3F91 A;  3F0Q X;  4PTJ A;  1TLC A;  4QLE A;  1EVF A;  3QL3 A;  3FRB X;  1DYJ A;  1F28 A;  1SEJ A;  3QLX A;  1VDR A;  1RA2 A;  3FRE X;  5HPB A;  3NZ6 X;  4O1X A;  1J3J C;  5H3A A;  2B3Z A;  3FQC A;  2FTQ A;  3NZD A;  4ELB A;  3HJ3 A;  4O1X D;  1JUT A;  3GH2 X;  4XSC A;  5HUI A;  1U70 A;  1B49 A;  3FRF X;  3IX9 A;  1DRA A;  1AXW A;  1DYI A;  1NJA A;  3KJS A;  1AJM A;  1DNA A;  3EX8 A;  3B5B A;  3FQO A;  3QLY A;  4HOG A;  4KL9 A;  4XE6 X;  2RDA A;  4XSE A;  2KCE A;  4KY4 A;  1KCE A;  1DYR A;  3C06 A;  1JG0 A;  1IA1 A;  1KMV A;  1S3V A;  1B5E A;  2D5N A;  5HS3 A;  3ED7 A;  4XT8 A;  3EIG A;  4KJL A;  4QLF A;  3M09 A;  2HXV A;  1ZDR A;  2G86 A;  3ROA A;  1VZE A;  1BJG A;  1YHO A;  2CIG A;  1RD7 A;  3BFI A;  1DHF A;  5DXV A;  2G8D A;  4HOF A;  4X5G A;  5ECC A;  1NJB A;  3SA1 A;  3SH2 A;  3I8A X;  1RX7 A;  1RX4 A;  2KGK A;  3UM5 A;  4KM2 A;  1TIS A;  2BBQ A;  1LCE A;  4M6J A;  4G8Z X;  1DIU A;  1NCE A;  4X5H A;  2L28 A;  3QGT A;  4FOA A;  1F4D A;  1BSF A;  4DPH A;  4Q67 A;  1M79 A;  1LCB A;  4GH8 A;  1KZJ A;  5HT4 A;  4O7U A;  4HOE A;  3NZC X;  3IRN A;  1HVY A;  2G6V A;  2A9W A;  1DG8 A;  1DR5 A;  1TSW A;  3JWC A;  1JU6 A;  3QLZ A;  3V8H A;  4XT5 A;  3BGX A;  3SRU X;  1DR1 A;  3JTW A;  4PSS A;  1RG7 A;  4P68 A;  4KYA A;  1TVU A;  4QLG A;  3CL9 A;  3EHI X;  3GH0 A;  1DR3 A;  4EIN A;  2C2T A;  1J3J A;  2BLC A;  3K47 A;  3H9K A;  4PSG A;  2W9G A;  4Q0D A;  4F2V A;  3F0X X;  1LUD A;  1RX8 A;  1RX3 A;  4OR7 A;  5EAJ A;  4ELH A;  1J3K C;  4XT7 A;  3IHI A;  1DRB A;  3S3V A;  1AOE A;  1RA8 A;  1IA3 A;  4LAH X;  4E5O A;  2FZJ A;  4PDJ A;  3SAI A;  4PSY A;  4M7V A;  5HVB A;  3SR5 X;  1TSN A;  1RH3 A;  1RX9 A;  2P4G A;  3UM6 A;  3DG8 C;  4H0U A;  1RB2 A;  3F0V X;  1B5D A;  5DFR A;  3SA2 A;  3EDW X;  1U72 A;  3NZ9 X;  4KLX A;  2FTO X;  4EIG A;  3FY9 X;  4GD7 A;  3S7A A;  3EBU A;  4EZ8 A;  2HM9 A;  4G6W X;  2ONB A;  3KGY A;  3IX6 A;  4GEV A;  4CD2 A;  1RA3 A;  2FZI A;  1NJD A;  1RX6 A;  3M08 A;  8DFR A;  4H0R A;  4IXF X;  1JMG A;  3IRM A;  3EEJ A;  3IRO A;  1IA2 A;  1LY3 A;  3NZB X;  3KGB A;  1VZD A;  4ISW A;  2VF0 A;  4FQS A;  4M2X A;  3IA4 A;  3NU0 A;  3ZPC A;  3RO9 A;  3DRC A;  3K45 A;  4P66 A;  2H2Q A;  4OSG A;  4DP3 A;  1M78 A;  3SGY A;  4DPD A;  4O1U A;  1DLR A;  3NXY A;  3S9U A;  2FTN A;  1VZB A;  3Q1H A;  5HT5 A;  1JMI A;  1CZ3 A;  4I13 A;  1BQ2 A;  4ISK A;  4KAK A;  1AOB A;  2W3A A;  1S3W A;  1AO8 A;  2G8X A;  1BID A;  4G95 A;  3RG9 A;  1VJ3 A;  4H98 A;  4LRR A;  3FL8 A;  3HB8 A;  3N5G A;  1BKP A;  4ECK A;  1JUV A;  3FYW X;  1S3U A;  3VCO A;  2RD8 B;  4ELF A;  5JG0 X;  1JTQ A;  4QHV A;  4LEK X;  1TYS A;  3FQ0 A;  3QLR A;  3CSE A;  1OHJ A;  5HQY A;  3TQ9 A;  1J3K A;  4P3Q A;  3JSU A;  1TDC A;  5HI6 A;  1DDR A;  1S3Y A;  1U71 A;  1BP6 A;  3F0B X;  4H96 A;  3KFY A;  4DFR A;  3LG4 A;  3FRD X;  4KNZ A;  4KFJ A;  1FWM A;  1RTS A;  3DG8 A;  1BKO A;  1HW4 A;  2G8A A;  3N0H A;  4IXE D;  1F4E A;  3GI2 A;  2AZN A;  4IQB A;  1DAJ A;  3EGY X;  2ITH A;  3DAU A;  1BOZ A;  4EIZ A;  3QYL A;  3UM8 A;  1BQ1 A;  1PD8 A;  7DFR A;  3QFX A;  3TQA A;  2C2S A;  3R33 A;  4XT4 A;  3ZPG A;  3KJR A;  3F8Y A;  3GHV A;  4KD7 A;  4QJZ D;  3DL5 A;  3JWK A;  1DR7 A;  1JOL A;  1JOM A;  2W9S A;  1RA1 A;  6DFR A;  1EVG A;  2QK8 A;  3BHL A;  1RB3 A;  3NXV A;  1VZC A;  1JTU A;  4IQQ A;  3UWL B;  1TLS A;  4DDR A;  2FZH A;  3NXR A;  3OCH A;  4XEC X;  3GYF A;  2W3M A;  1TDA A; 
#chains in the Genus database with same CATH topology
 1KLK A;  1HZW A;  1TDU A;  3SRQ X;  2W3V A;  1HFR A;  4RGC A;  1TRG A;  1RX2 A;  4KBN A;  1KMS A;  1RF7 A;  2TSC A;  3TQB A;  1J3I C;  4KM0 A;  4IRR A;  1BP0 A;  1M7A A;  1LCA A;  2O7P A;  1TSV A;  3EEL A;  4X5I A;  1F4F A;  4EB4 A;  4G2O X;  2TDM A;  3F0S X;  4EJ1 A;  1DRF A;  4XRB A;  3SRS X;  3FYV X;  1BO7 A;  4FGH A;  3I3R A;  3DL6 A;  1DF7 A;  2CD2 A;  3B9H A;  1AIQ A;  4Q0E A;  4NX6 A;  2G89 A;  5BY6 A;  1BZF A;  1NJC A;  3DGA C;  4FHB A;  4I1N A;  2BLB A;  3SRW X;  2ANQ A;  3L3R A;  3N5E B;  1JMF A;  1QQQ A;  1HFQ A;  4KPW A;  3OAF A;  4X5J A;  1DIS A;  3IK0 A;  3EAW X;  2AAZ A;  4DQ1 A;  1TSM A;  4Q6A A;  4LAE X;  1RE7 A;  3OB7 A;  4E28 A;  2ANO A;  1B02 A;  1I00 A;  2INQ A;  3QLW A;  3FL9 A;  3SQY X;  1DHJ A;  1HW3 A;  3JWF A;  3KY8 A;  1HFP A;  1AN5 A;  3NRR A;  3GHC A;  4M6L A;  1THY A;  5HVE A;  2VET A;  1TVW A;  3FQV A;  4G3M A;  2W9H A;  3BNZ A;  2W9T A;  1F4G A;  4HA7 A;  4FGT A;  4H95 A;  4XT6 A;  5HF0 X;  2D0K A;  2JYB A;  1E26 A;  1BPJ A;  1CI7 A;  1IA4 A;  2ZZA A;  3GHW A;  3TQ8 A;  3EF9 A;  4KJK A;  1TSY A;  3K2H A;  3C0A A;  2BLA A;  3UWL A;  4KY8 A;  3BYX A;  5JA3 A;  3QJ7 A;  1BSP A;  1TSD A;  4TMS A;  3CD2 A;  3IK1 A;  3D80 A;  4NX7 A;  1TVV A;  1SYN A;  3JW3 A;  1QZF A;  3K74 A;  4PST A;  1MVS A;  3JWM A;  3NXO A;  1J3I A;  1DDU A;  2OBC A;  5U26 A;  3IA5 A;  3INV A;  1BO8 A;  1DG7 A;  3TMS A;  4UP1 A;  4QJC A;  2TDD A;  3CLB A;  1KZI A;  1PD9 A;  1D1G A;  4QI9 A;  3EEM A;  5CCC A;  3QYO A;  1FFL A;  4M6K A;  4X5F A;  2BL9 A;  1DLS A;  1MVT A;  4JEF A;  1DR4 A;  4FGG A;  5ECX A;  5E8Q A;  3BZ0 A;  4FOX A;  3EJL A;  4HA9 A;  2LF1 A;  4H97 A;  3DGA A;  2HQP A;  2XW7 A;  1CD2 A;  3FRA X;  4GYH A;  4LAG X;  3QL0 A;  4PTH A;  1DRE A;  4ELG A;  3JVX A;  2TSR A;  1DYH A;  3NTZ A;  2W3B A;  4TU5 X;  1TSZ A;  3N5E A;  4XSD A;  1DG5 A;  1TDR A;  5FDA A;  3BHR A;  3D84 X;  2GD9 A;  1PDB A;  5HSR A;  1AI9 A;  4ELE A;  4IXG X;  3FY8 X;  1LY4 A;  2OIP A;  4KJJ A;  5CC9 A;  3QLS A;  3SRR X;  1RX1 A;  3HBB A;  2DHF A;  5H38 A;  3JW5 A;  1YPV A;  1ZPR A;  1VZA A;  5HQZ A;  5HSU A;  4KNE A;  1RA9 A;  4H1I A;  3QG2 A;  3IJZ A;  1EV8 A;  1DRH A;  1TSL A;  2DRC A;  1EV5 A;  1TDB A;  3E0B A;  2RD8 A;  3FQF A;  3FS6 A;  4KEB A;  1OHK A;  3DAT A;  5H39 A;  1BDU A;  1JUJ A;  3GG5 A;  3F8Z A;  5WRN A;  3NXT A;  3DFR A;  5U27 A;  1DHI A;  4FOG A;  3NXX A;  1DR6 A;  1RC4 A;  1F4B A;  3NZA X;  1JMH A;  5HF2 X;  1DR2 A;  5J7W A;  3EEK A;  1RX5 A;  1TJS A;  3FQZ A;  4P3R A;  1TSX A;  3TD8 A;  2W3W A;  1F4C A;  4M7U A;  1NJE A;  3F0U X;  4EIL A;  1DDS A;  5FCT A;  3F91 A;  3F0Q X;  4PTJ A;  1TLC A;  4QLE A;  1EVF A;  3QL3 A;  3FRB X;  1DYJ A;  1F28 A;  1SEJ A;  3QLX A;  1VDR A;  1RA2 A;  3FRE X;  5HPB A;  3NZ6 X;  4O1X A;  1J3J C;  5H3A A;  2B3Z A;  3FQC A;  2FTQ A;  3NZD A;  4ELB A;  3HJ3 A;  4O1X D;  1JUT A;  3GH2 X;  4XSC A;  5HUI A;  1U70 A;  1B49 A;  3FRF X;  3IX9 A;  1DRA A;  1AXW A;  1DYI A;  1NJA A;  3KJS A;  1AJM A;  1DNA A;  3EX8 A;  3B5B A;  3FQO A;  3QLY A;  4HOG A;  4KL9 A;  4XE6 X;  2RDA A;  4XSE A;  2KCE A;  4KY4 A;  1KCE A;  1DYR A;  3C06 A;  1JG0 A;  1IA1 A;  1KMV A;  1S3V A;  1B5E A;  2D5N A;  5HS3 A;  3ED7 A;  4XT8 A;  3EIG A;  4KJL A;  4QLF A;  3M09 A;  2HXV A;  1ZDR A;  2G86 A;  3ROA A;  1VZE A;  1BJG A;  1YHO A;  2CIG A;  1RD7 A;  3BFI A;  1DHF A;  5DXV A;  2G8D A;  4HOF A;  4X5G A;  5ECC A;  1NJB A;  3SA1 A;  3SH2 A;  3I8A X;  1RX7 A;  1RX4 A;  2KGK A;  3UM5 A;  4KM2 A;  1TIS A;  2BBQ A;  1LCE A;  4M6J A;  4G8Z X;  1DIU A;  1NCE A;  4X5H A;  2L28 A;  3QGT A;  4FOA A;  1F4D A;  1BSF A;  4DPH A;  4Q67 A;  1M79 A;  1LCB A;  4GH8 A;  1KZJ A;  5HT4 A;  4O7U A;  4HOE A;  3NZC X;  3IRN A;  1HVY A;  2G6V A;  2A9W A;  1DG8 A;  1DR5 A;  1TSW A;  3JWC A;  1JU6 A;  3QLZ A;  3V8H A;  4XT5 A;  3BGX A;  3SRU X;  1DR1 A;  3JTW A;  4PSS A;  1RG7 A;  4P68 A;  4KYA A;  1TVU A;  4QLG A;  3CL9 A;  3EHI X;  3GH0 A;  1DR3 A;  4EIN A;  2C2T A;  1J3J A;  2BLC A;  3K47 A;  3H9K A;  4PSG A;  2W9G A;  4Q0D A;  4F2V A;  3F0X X;  1LUD A;  1RX8 A;  1RX3 A;  4OR7 A;  5EAJ A;  4ELH A;  1J3K C;  4XT7 A;  3IHI A;  1DRB A;  3S3V A;  1AOE A;  1RA8 A;  1IA3 A;  4LAH X;  4E5O A;  2FZJ A;  4PDJ A;  3SAI A;  4PSY A;  4M7V A;  5HVB A;  3SR5 X;  1TSN A;  1RH3 A;  1RX9 A;  2P4G A;  3UM6 A;  3DG8 C;  4H0U A;  1RB2 A;  3F0V X;  1B5D A;  5DFR A;  3SA2 A;  3EDW X;  1U72 A;  3NZ9 X;  4KLX A;  2FTO X;  4EIG A;  3FY9 X;  4GD7 A;  3S7A A;  3EBU A;  4EZ8 A;  2HM9 A;  4G6W X;  2ONB A;  3KGY A;  3IX6 A;  4GEV A;  4CD2 A;  1RA3 A;  2FZI A;  1NJD A;  1RX6 A;  3M08 A;  8DFR A;  4H0R A;  4IXF X;  1JMG A;  3IRM A;  3EEJ A;  3IRO A;  1IA2 A;  1LY3 A;  3NZB X;  3KGB A;  1VZD A;  4ISW A;  2VF0 A;  4FQS A;  4M2X A;  3IA4 A;  3NU0 A;  3ZPC A;  3RO9 A;  3DRC A;  3K45 A;  4P66 A;  2H2Q A;  4OSG A;  4DP3 A;  1M78 A;  3SGY A;  4DPD A;  4O1U A;  1DLR A;  3NXY A;  3S9U A;  2FTN A;  1VZB A;  3Q1H A;  5HT5 A;  1JMI A;  1CZ3 A;  4I13 A;  1BQ2 A;  4ISK A;  4KAK A;  1AOB A;  2W3A A;  1S3W A;  1AO8 A;  2G8X A;  1BID A;  4G95 A;  3RG9 A;  1VJ3 A;  4H98 A;  4LRR A;  3FL8 A;  3HB8 A;  3N5G A;  1BKP A;  4ECK A;  1JUV A;  3FYW X;  1S3U A;  3VCO A;  2RD8 B;  4ELF A;  5JG0 X;  1JTQ A;  4QHV A;  4LEK X;  1TYS A;  3FQ0 A;  3QLR A;  3CSE A;  1OHJ A;  5HQY A;  3TQ9 A;  1J3K A;  4P3Q A;  3JSU A;  1TDC A;  5HI6 A;  1DDR A;  1S3Y A;  1U71 A;  1BP6 A;  3F0B X;  4H96 A;  3KFY A;  4DFR A;  3LG4 A;  3FRD X;  4KNZ A;  4KFJ A;  1FWM A;  1RTS A;  3DG8 A;  1BKO A;  1HW4 A;  2G8A A;  3N0H A;  4IXE D;  1F4E A;  3GI2 A;  2AZN A;  4IQB A;  1DAJ A;  3EGY X;  2ITH A;  3DAU A;  1BOZ A;  4EIZ A;  3QYL A;  3UM8 A;  1BQ1 A;  1PD8 A;  7DFR A;  3QFX A;  3TQA A;  2C2S A;  3R33 A;  4XT4 A;  3ZPG A;  3KJR A;  3F8Y A;  3GHV A;  4KD7 A;  4QJZ D;  3DL5 A;  3JWK A;  1DR7 A;  1JOL A;  1JOM A;  2W9S A;  1RA1 A;  6DFR A;  1EVG A;  2QK8 A;  3BHL A;  1RB3 A;  3NXV A;  1VZC A;  1JTU A;  4IQQ A;  3UWL B;  1TLS A;  4DDR A;  2FZH A;  3NXR A;  3OCH A;  4XEC X;  3GYF A;  2W3M A;  1TDA A; 
#chains in the Genus database with same CATH homology
 1KLK A;  1HZW A;  1TDU A;  3SRQ X;  2W3V A;  1HFR A;  4RGC A;  1TRG A;  1RX2 A;  4KBN A;  1KMS A;  1RF7 A;  2TSC A;  3TQB A;  1J3I C;  4KM0 A;  4IRR A;  1BP0 A;  1M7A A;  1LCA A;  2O7P A;  1TSV A;  3EEL A;  4X5I A;  1F4F A;  4EB4 A;  4G2O X;  2TDM A;  3F0S X;  4EJ1 A;  1DRF A;  4XRB A;  3SRS X;  3FYV X;  1BO7 A;  4FGH A;  3I3R A;  3DL6 A;  1DF7 A;  2CD2 A;  3B9H A;  1AIQ A;  4Q0E A;  4NX6 A;  2G89 A;  5BY6 A;  1BZF A;  1NJC A;  3DGA C;  4FHB A;  4I1N A;  2BLB A;  3SRW X;  2ANQ A;  3L3R A;  3N5E B;  1JMF A;  1QQQ A;  1HFQ A;  4KPW A;  3OAF A;  4X5J A;  1DIS A;  3IK0 A;  3EAW X;  2AAZ A;  4DQ1 A;  1TSM A;  4Q6A A;  4LAE X;  1RE7 A;  3OB7 A;  4E28 A;  2ANO A;  1B02 A;  1I00 A;  2INQ A;  3QLW A;  3FL9 A;  3SQY X;  1DHJ A;  1HW3 A;  3JWF A;  3KY8 A;  1HFP A;  1AN5 A;  3NRR A;  3GHC A;  4M6L A;  1THY A;  5HVE A;  2VET A;  1TVW A;  3FQV A;  4G3M A;  2W9H A;  3BNZ A;  2W9T A;  1F4G A;  4HA7 A;  4FGT A;  4H95 A;  4XT6 A;  5HF0 X;  2D0K A;  2JYB A;  1E26 A;  1BPJ A;  1CI7 A;  1IA4 A;  2ZZA A;  3GHW A;  3TQ8 A;  3EF9 A;  4KJK A;  1TSY A;  3K2H A;  3C0A A;  2BLA A;  3UWL A;  4KY8 A;  3BYX A;  5JA3 A;  3QJ7 A;  1BSP A;  1TSD A;  4TMS A;  3CD2 A;  3IK1 A;  3D80 A;  4NX7 A;  1TVV A;  1SYN A;  3JW3 A;  1QZF A;  3K74 A;  4PST A;  1MVS A;  3JWM A;  3NXO A;  1J3I A;  1DDU A;  2OBC A;  5U26 A;  3IA5 A;  3INV A;  1BO8 A;  1DG7 A;  3TMS A;  4UP1 A;  4QJC A;  2TDD A;  3CLB A;  1KZI A;  1PD9 A;  1D1G A;  4QI9 A;  3EEM A;  5CCC A;  3QYO A;  1FFL A;  4M6K A;  4X5F A;  2BL9 A;  1DLS A;  1MVT A;  4JEF A;  1DR4 A;  4FGG A;  5ECX A;  5E8Q A;  3BZ0 A;  4FOX A;  3EJL A;  4HA9 A;  2LF1 A;  4H97 A;  3DGA A;  2HQP A;  2XW7 A;  1CD2 A;  3FRA X;  4GYH A;  4LAG X;  3QL0 A;  4PTH A;  1DRE A;  4ELG A;  3JVX A;  2TSR A;  1DYH A;  3NTZ A;  2W3B A;  4TU5 X;  1TSZ A;  3N5E A;  4XSD A;  1DG5 A;  1TDR A;  5FDA A;  3BHR A;  3D84 X;  2GD9 A;  1PDB A;  5HSR A;  1AI9 A;  4ELE A;  4IXG X;  3FY8 X;  1LY4 A;  2OIP A;  4KJJ A;  5CC9 A;  3QLS A;  3SRR X;  1RX1 A;  3HBB A;  2DHF A;  5H38 A;  3JW5 A;  1YPV A;  1ZPR A;  1VZA A;  5HQZ A;  5HSU A;  4KNE A;  1RA9 A;  4H1I A;  3QG2 A;  3IJZ A;  1EV8 A;  1DRH A;  1TSL A;  2DRC A;  1EV5 A;  1TDB A;  3E0B A;  2RD8 A;  3FQF A;  3FS6 A;  4KEB A;  1OHK A;  3DAT A;  5H39 A;  1BDU A;  1JUJ A;  3GG5 A;  3F8Z A;  5WRN A;  3NXT A;  3DFR A;  5U27 A;  1DHI A;  4FOG A;  3NXX A;  1DR6 A;  1RC4 A;  1F4B A;  3NZA X;  1JMH A;  5HF2 X;  1DR2 A;  5J7W A;  3EEK A;  1RX5 A;  1TJS A;  3FQZ A;  4P3R A;  1TSX A;  3TD8 A;  2W3W A;  1F4C A;  4M7U A;  1NJE A;  3F0U X;  4EIL A;  1DDS A;  5FCT A;  3F91 A;  3F0Q X;  4PTJ A;  1TLC A;  4QLE A;  1EVF A;  3QL3 A;  3FRB X;  1DYJ A;  1F28 A;  1SEJ A;  3QLX A;  1VDR A;  1RA2 A;  3FRE X;  5HPB A;  3NZ6 X;  4O1X A;  1J3J C;  5H3A A;  2B3Z A;  3FQC A;  2FTQ A;  3NZD A;  4ELB A;  3HJ3 A;  4O1X D;  1JUT A;  3GH2 X;  4XSC A;  5HUI A;  1U70 A;  1B49 A;  3FRF X;  3IX9 A;  1DRA A;  1AXW A;  1DYI A;  1NJA A;  3KJS A;  1AJM A;  1DNA A;  3EX8 A;  3B5B A;  3FQO A;  3QLY A;  4HOG A;  4KL9 A;  4XE6 X;  2RDA A;  4XSE A;  2KCE A;  4KY4 A;  1KCE A;  1DYR A;  3C06 A;  1JG0 A;  1IA1 A;  1KMV A;  1S3V A;  1B5E A;  2D5N A;  5HS3 A;  3ED7 A;  4XT8 A;  3EIG A;  4KJL A;  4QLF A;  3M09 A;  2HXV A;  1ZDR A;  2G86 A;  3ROA A;  1VZE A;  1BJG A;  1YHO A;  2CIG A;  1RD7 A;  3BFI A;  1DHF A;  5DXV A;  2G8D A;  4HOF A;  4X5G A;  5ECC A;  1NJB A;  3SA1 A;  3SH2 A;  3I8A X;  1RX7 A;  1RX4 A;  2KGK A;  3UM5 A;  4KM2 A;  1TIS A;  2BBQ A;  1LCE A;  4M6J A;  4G8Z X;  1DIU A;  1NCE A;  4X5H A;  2L28 A;  3QGT A;  4FOA A;  1F4D A;  1BSF A;  4DPH A;  4Q67 A;  1M79 A;  1LCB A;  4GH8 A;  1KZJ A;  5HT4 A;  4O7U A;  4HOE A;  3NZC X;  3IRN A;  1HVY A;  2G6V A;  2A9W A;  1DG8 A;  1DR5 A;  1TSW A;  3JWC A;  1JU6 A;  3QLZ A;  3V8H A;  4XT5 A;  3BGX A;  3SRU X;  1DR1 A;  3JTW A;  4PSS A;  1RG7 A;  4P68 A;  4KYA A;  1TVU A;  4QLG A;  3CL9 A;  3EHI X;  3GH0 A;  1DR3 A;  4EIN A;  2C2T A;  1J3J A;  2BLC A;  3K47 A;  3H9K A;  4PSG A;  2W9G A;  4Q0D A;  4F2V A;  3F0X X;  1LUD A;  1RX8 A;  1RX3 A;  4OR7 A;  5EAJ A;  4ELH A;  1J3K C;  4XT7 A;  3IHI A;  1DRB A;  3S3V A;  1AOE A;  1RA8 A;  1IA3 A;  4LAH X;  4E5O A;  2FZJ A;  4PDJ A;  3SAI A;  4PSY A;  4M7V A;  5HVB A;  3SR5 X;  1TSN A;  1RH3 A;  1RX9 A;  2P4G A;  3UM6 A;  3DG8 C;  4H0U A;  1RB2 A;  3F0V X;  1B5D A;  5DFR A;  3SA2 A;  3EDW X;  1U72 A;  3NZ9 X;  4KLX A;  2FTO X;  4EIG A;  3FY9 X;  4GD7 A;  3S7A A;  3EBU A;  4EZ8 A;  2HM9 A;  4G6W X;  2ONB A;  3KGY A;  3IX6 A;  4GEV A;  4CD2 A;  1RA3 A;  2FZI A;  1NJD A;  1RX6 A;  3M08 A;  8DFR A;  4H0R A;  4IXF X;  1JMG A;  3IRM A;  3EEJ A;  3IRO A;  1IA2 A;  1LY3 A;  3NZB X;  3KGB A;  1VZD A;  4ISW A;  2VF0 A;  4FQS A;  4M2X A;  3IA4 A;  3NU0 A;  3ZPC A;  3RO9 A;  3DRC A;  3K45 A;  4P66 A;  2H2Q A;  4OSG A;  4DP3 A;  1M78 A;  3SGY A;  4DPD A;  4O1U A;  1DLR A;  3NXY A;  3S9U A;  2FTN A;  1VZB A;  3Q1H A;  5HT5 A;  1JMI A;  1CZ3 A;  4I13 A;  1BQ2 A;  4ISK A;  4KAK A;  1AOB A;  2W3A A;  1S3W A;  1AO8 A;  2G8X A;  1BID A;  4G95 A;  3RG9 A;  1VJ3 A;  4H98 A;  4LRR A;  3FL8 A;  3HB8 A;  3N5G A;  1BKP A;  4ECK A;  1JUV A;  3FYW X;  1S3U A;  3VCO A;  2RD8 B;  4ELF A;  5JG0 X;  1JTQ A;  4QHV A;  4LEK X;  1TYS A;  3FQ0 A;  3QLR A;  3CSE A;  1OHJ A;  5HQY A;  3TQ9 A;  1J3K A;  4P3Q A;  3JSU A;  1TDC A;  5HI6 A;  1DDR A;  1S3Y A;  1U71 A;  1BP6 A;  3F0B X;  4H96 A;  3KFY A;  4DFR A;  3LG4 A;  3FRD X;  4KNZ A;  4KFJ A;  1FWM A;  1RTS A;  3DG8 A;  1BKO A;  1HW4 A;  2G8A A;  3N0H A;  4IXE D;  1F4E A;  3GI2 A;  2AZN A;  4IQB A;  1DAJ A;  3EGY X;  2ITH A;  3DAU A;  1BOZ A;  4EIZ A;  3QYL A;  3UM8 A;  1BQ1 A;  1PD8 A;  7DFR A;  3QFX A;  3TQA A;  2C2S A;  3R33 A;  4XT4 A;  3ZPG A;  3KJR A;  3F8Y A;  3GHV A;  4KD7 A;  4QJZ D;  3DL5 A;  3JWK A;  1DR7 A;  1JOL A;  1JOM A;  2W9S A;  1RA1 A;  6DFR A;  1EVG A;  2QK8 A;  3BHL A;  1RB3 A;  3NXV A;  1VZC A;  1JTU A;  4IQQ A;  3UWL B;  1TLS A;  4DDR A;  2FZH A;  3NXR A;  3OCH A;  4XEC X;  3GYF A;  2W3M A;  1TDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...