4ECKA

Crystal structure of the toxoplasma gondii ts-dhfr
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
608
structure length
498
Chain Sequence
KPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAKEGQQRVRVCASLPAALSLEEYKDSVDQIFVVGAGLYEAALSGVASHLYITRVAREFPCDVFFPAPGDDILTYRPIFISKTFSDNGVPYDFVVLEKRSSAAAIAPVLAWMDEDRELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, oxidoreductase
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title First Three-Dimensional Structure of Toxoplasma gondii Thymidylate Synthase-Dihydrofolate Reductase: Insights for Catalysis, Interdomain Interactions, and Substrate Channeling.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 108
structure length 498
sequence length 608
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4eckA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4eckA01
3EDWX 4DQ1A 3QLXA 3FQFA 5JG0X 1F4DA 1SEJA 1BPJA 1RA8A 3QJ7A 3Q1HA 4LRRA 1PDBA 1DYHA 3FYVX 4OR7A 5JA3A 1J3KC 4QJZD 4LAEX 2INQA 5E8QA 1RX7A 1BP6A 4XRBA 4NX6A 4XT5A 2KCEA 3IX6A 1RX1A 2AZNA 1JOLA 1DHIA 4O1XD 1JOMA 1DR6A 4Q6AA 4X5HA 1HZWA 1TSNA 3M09A 3BHRA 3NZ6X 3QLWA 1DDUA 2FZIA 4ELFA 4IXGX 2G8XA 1TVVA 1KZIA 2C2TA 4Q0EA 1RB2A 4H1IA 6DFRA 3DL6A 4X5IA 1B5DA 1SYNA 2DHFA 4EIZA 3GHWA 4I1NA 3CL9A 3HJ3A 1AO8A 4H96A 1F28A 1HFPA 2QK8A 4KJLA 4P66A 1TSYA 3GH2X 1J3IC 3OCHA 3OB7A 1DF7A 3FREX 2OBCA 3F8ZA 5HVBA 3DG8A 4EILA 4XSEA 2ONBA 1S3UA 4XECX 2D5NA 1JMFA 1J3JC 4X5GA 1DG7A 1DG5A 1BOZA 1EV8A 4H97A 1AOBA 3EAWX 4FGGA 4QJCA 3IJZA 4QLFA 2P4GA 3SA1A 1RB3A 1RX8A 4DP3A 2FTQA 4HOFA 5HUIA 1KMVA 4H98A 1HW4A 1DG8A 1LY4A 3HBBA 3FRAX 1DLSA 3KJSA 1U70A 4PTJA 2CIGA 4FOXA 1MVTA 3S3VA 1FWMA 3N0HA 3DRCA 4KL9A 3EJLA 4F2VA 4M6JA 1TISA 2TDDA 4O1XA 4H95A 3TMSA 1DRAA 2FTNA 1JG0A 3IRNA 8DFRA 3IROA 1M79A 1JMHA 2TSCA 4PDJA 4GH8A 2OIPA 3B9HA 3L3RA 4ELBA 1DRBA 4M2XA 3NZ9X 4KBNA 3NZCX 4QLEA 5J7WA 2D0KA 4EB4A 4G8ZX 3IX9A 1VZDA 3NZAX 4TU5X 3OAFA 1DAJA 4G3MA 1BSPA 4DPDA 3NXTA 2VF0A 1RF7A 3CLBA 2RD8A 2BLBA 3GHCA 1AJMA 3FQCA 5HQYA 5U26A 3FQ0A 1TJSA 3GHVA 3UWLB 3EBUA 3K47A 1TDRA 4LEKX 4FGHA 1RX2A 4O1UA 1QQQA 4PSYA 1DDRA 5CC9A 4EINA 4I13A 1B49A 1BJGA 4TMSA 3EEJA 1TVWA 3SRWX 2RD8B 1DR2A 3ED7A 3F0BX 3IRMA 3K45A 2LF1A 1RG7A 4IXED 2W9GA 2G89A 1DYIA 3FS6A 2TDMA 1TSXA 3BYXA 1DRFA 5HQZA 5WRNA 1RC4A 3F91A 3QL0A 4KM2A 1DRHA 1QZFA 3NXRA 3JWKA 4KLXA 1DYJA 1E26A 1IA2A 3GG5A 2DRCA 1D1GA 3DGAC 5HT4A 1LCBA 3QL3A 4M6LA 3NXYA 5EAJA 2G6VA 3SRQX 4XT6A 1B02A 3D80A 2W9TA 1VJ3A 2AAZA 3CD2A 3JVXA 4KAKA 2FZJA 3LG4A 5CCCA 1F4CA 3SRUX 4E5OA 1U71A 4GEVA 2A9WA 1HFQA 2ANQA 2W9SA 3NXOA 1I00A 1VZEA 1LCAA 3VCOA 1DISA 3FRFX 1JMGA 1RA9A 5HF2X 4PTHA 3TQAA 3KGYA 3SAIA 1BQ1A 1RA2A 1RX3A 1LUDA 3DFRA 4KNEA 1VZAA 3IA5A 4KY4A 3SH2A 1HW3A 1DR3A 5HSUA 1IA3A 4HOGA 3EGYX 2C2SA 3INVA 2BLCA 3FRBX 3JTWA 4X5JA 1TSDA 1AN5A 1CI7A 4NX7A 5HVEA 2TSRA 3S7AA 1DHJA 4DDRA 1NJDA 1DREA 1KMSA 1TDCA 1DR1A 1BO7A 3F0SX 3RO9A 2G8DA 5H38A 3NXVA 5HF0X 4QHVA 3KFYA 3SA2A 3N5GA 3EELA 1RA1A 2BLAA 5HI6A 3M08A 5DXVA 2H2QA 3IHIA 4ELHA 3JWFA 2B3ZA 3DG8C 4QLGA 3UWLA 3QG2A 1AOEA 3F0VX 3TQ9A 1THYA 5HSRA 4KPWA 1VZBA 1JMIA 2XW7A 1RTSA 3F0XX 4UP1A 1RX5A 4RGCA 2W3AA 3TD8A 1M78A 4XE6X 1BKPA 4HA7A 2BL9A 3EX8A 3DL5A 3JWMA 3C0AA 4KJJA 3CSEA 3B5BA 4M6KA 2VETA 1DHFA 4KM0A 1AXWA 1DR7A 4HA9A 4P68A 1KZJA 1JUJA 1VZCA 3EEKA 4PSSA 1FFLA 4P3QA 3BNZA 3QLRA 3H9KA 1S3VA 3F0QX 1CZ3A 3QLZA 1RA3A 3KGBA 3BGXA 3QFXA 1J3KA 5HPBA 1CD2A 3FQVA 3FQOA 1HVYA 1DYRA 1KLKA 1F4GA 2G8AA 3K74A 3S9UA 3JW5A 3EEMA 4Q0DA 4ECKA 1RX6A 5ECXA 4GD7A 1BQ2A 3E0BA 1TDAA 3FL9A 3I8AX 1NJAA 3UM5A 3K2HA 3F0UX 3NZDA 3EF9A 3SQYX 4EJ1A 1IA4A 1IA1A 3V8HA 3IK1A 5H39A 3GH0A 1TSMA 3FY9X 3IK0A 4IQQA 4HOEA 2KGKA 4G6WX 1JUVA 2FZHA 3GYFA 1TDBA 1RE7A 4ELGA 1BKOA 3UM6A 2ITHA 3TQBA 3QYOA 4XT8A 1RX4A 3C06A 4G2OX 2W3BA 1KCEA 1OHJA 1LCEA 4KJKA 3QLYA 3GI2A 4XT7A 4KFJA 1BIDA 1BP0A 1M7AA 5U27A 4JEFA 3SRRX 1J3IA 1JU6A 1F4BA 1DR4A 4KEBA 3BHLA 4EZ8A 1NJCA 3FQZA 4DPHA 5HS3A 1TSZA 1RH3A 3JWCA 3R33A 2W9HA 3FL8A 3FRDX 2GD9A 3BFIA 1JUTA 1TSVA 1NCEA 4FOGA 4IQBA 1J3JA 2JYBA 1LY3A 1VDRA 2HM9A 1S3YA 3NRRA 2HXVA 1EVGA 3QLSA 1TLCA 1BSFA 1F4EA 4M7VA 4IXFX 4LAGX 4FOAA 5H3AA 1DLRA 1HFRA 4OSGA 1NJEA 5FCTA 2W3WA 4ISKA 4KD7A 4QI9A 1DIUA 1TSWA 2O7PA 1NJBA 3FY8X 3ZPCA 1DR5A 1OHKA 1AIQA 5FDAA 1MVSA 2W3MA 3IA4A 1PD8A 1YPVA 4O7UA 1RX9A 1YHOA 2W3VA 3KY8A 3SRSX 1TYSA 1U72A 4XT4A 1TDUA 5BY6A 5HT5A 1TLSA 2FTOX 1ZDRA 1AI9A 3NXXA 3N5EA 3KJRA 3QGTA 3ROAA 1RD7A 4E28A 4IRRA 3NZBX 1EV5A 3QYLA 4ELEA 1JTQA 3JW3A 1BO8A 3EHIX 2L28A 4KYAA 3DAUA 2RDAA 3FYWX 4XSCA 4FQSA 3F8YA 2HQPA 3I3RA 4P3RA 4Q67A 1B5EA 1PD9A 5ECCA 1TRGA 4H0RA 3N5EB 3HB8A 5DFRA 1BDUA 1TSLA 1DDSA 1DNAA 1BZFA 3BZ0A 1F4FA 4H0UA 2BBQA 2ZZAA 3JSUA 1ZPRA 2CD2A 3TQ8A 3UM8A 4KY8A 3RG9A 7DFRA 4FGTA 4PSGA 1TVUA 2ANOA 4FHBA 3NTZA 1EVFA 4KNZA 4LAHX 1S3WA 3SGYA 4G95A 3NU0A 4PSTA 3ZPGA 3D84X 1JTUA 3SR5X 4XSDA 4GYHA 4CD2A 2G86A 3DGAA 4X5FA 4M7UA 3EIGA 4ISWA 4EIGA 4DFRA 3DATA
chains in the Genus database with same CATH superfamily
3EDWX 4DQ1A 3QLXA 3FQFA 5JG0X 1F4DA 1SEJA 1BPJA 1RA8A 3QJ7A 3Q1HA 4LRRA 1PDBA 1DYHA 3FYVX 4OR7A 5JA3A 1J3KC 4QJZD 4LAEX 2INQA 5E8QA 1RX7A 1BP6A 4XRBA 4NX6A 4XT5A 2KCEA 3IX6A 1RX1A 2AZNA 1JOLA 1DHIA 4O1XD 1JOMA 1DR6A 4Q6AA 4X5HA 1HZWA 1TSNA 3M09A 3BHRA 3NZ6X 3QLWA 1DDUA 2FZIA 4ELFA 4IXGX 2G8XA 1TVVA 1KZIA 2C2TA 4Q0EA 1RB2A 4H1IA 6DFRA 3DL6A 4X5IA 1B5DA 1SYNA 2DHFA 4EIZA 3GHWA 4I1NA 3CL9A 3HJ3A 1AO8A 4H96A 1F28A 1HFPA 2QK8A 4KJLA 4P66A 1TSYA 3GH2X 1J3IC 3OCHA 3OB7A 1DF7A 3FREX 2OBCA 3F8ZA 5HVBA 3DG8A 4EILA 4XSEA 2ONBA 1S3UA 4XECX 2D5NA 1JMFA 1J3JC 4X5GA 1DG7A 1DG5A 1BOZA 1EV8A 4H97A 1AOBA 3EAWX 4FGGA 4QJCA 3IJZA 4QLFA 2P4GA 3SA1A 1RB3A 1RX8A 4DP3A 2FTQA 4HOFA 5HUIA 1KMVA 4H98A 1HW4A 1DG8A 1LY4A 3HBBA 3FRAX 1DLSA 3KJSA 1U70A 4PTJA 2CIGA 4FOXA 1MVTA 3S3VA 1FWMA 3N0HA 3DRCA 4KL9A 3EJLA 4F2VA 4M6JA 1TISA 2TDDA 4O1XA 4H95A 3TMSA 1DRAA 2FTNA 1JG0A 3IRNA 8DFRA 3IROA 1M79A 1JMHA 2TSCA 4PDJA 4GH8A 2OIPA 3B9HA 3L3RA 4ELBA 1DRBA 4M2XA 3NZ9X 4KBNA 3NZCX 4QLEA 5J7WA 2D0KA 4EB4A 4G8ZX 3IX9A 1VZDA 3NZAX 4TU5X 3OAFA 1DAJA 4G3MA 1BSPA 4DPDA 3NXTA 2VF0A 1RF7A 3CLBA 2RD8A 2BLBA 3GHCA 1AJMA 3FQCA 5HQYA 5U26A 3FQ0A 1TJSA 3GHVA 3UWLB 3EBUA 3K47A 1TDRA 4LEKX 4FGHA 1RX2A 4O1UA 1QQQA 4PSYA 1DDRA 5CC9A 4EINA 4I13A 1B49A 1BJGA 4TMSA 3EEJA 1TVWA 3SRWX 2RD8B 1DR2A 3ED7A 3F0BX 3IRMA 3K45A 2LF1A 1RG7A 4IXED 2W9GA 2G89A 1DYIA 3FS6A 2TDMA 1TSXA 3BYXA 1DRFA 5HQZA 5WRNA 1RC4A 3F91A 3QL0A 4KM2A 1DRHA 1QZFA 3NXRA 3JWKA 4KLXA 1DYJA 1E26A 1IA2A 3GG5A 2DRCA 1D1GA 3DGAC 5HT4A 1LCBA 3QL3A 4M6LA 3NXYA 5EAJA 2G6VA 3SRQX 4XT6A 1B02A 3D80A 2W9TA 1VJ3A 2AAZA 3CD2A 3JVXA 4KAKA 2FZJA 3LG4A 5CCCA 1F4CA 3SRUX 4E5OA 1U71A 4GEVA 2A9WA 1HFQA 2ANQA 2W9SA 3NXOA 1I00A 1VZEA 1LCAA 3VCOA 1DISA 3FRFX 1JMGA 1RA9A 5HF2X 4PTHA 3TQAA 3KGYA 3SAIA 1BQ1A 1RA2A 1RX3A 1LUDA 3DFRA 4KNEA 1VZAA 3IA5A 4KY4A 3SH2A 1HW3A 1DR3A 5HSUA 1IA3A 4HOGA 3EGYX 2C2SA 3INVA 2BLCA 3FRBX 3JTWA 4X5JA 1TSDA 1AN5A 1CI7A 4NX7A 5HVEA 2TSRA 3S7AA 1DHJA 4DDRA 1NJDA 1DREA 1KMSA 1TDCA 1DR1A 1BO7A 3F0SX 3RO9A 2G8DA 5H38A 3NXVA 5HF0X 4QHVA 3KFYA 3SA2A 3N5GA 3EELA 1RA1A 2BLAA 5HI6A 3M08A 5DXVA 2H2QA 3IHIA 4ELHA 3JWFA 2B3ZA 3DG8C 4QLGA 3UWLA 3QG2A 1AOEA 3F0VX 3TQ9A 1THYA 5HSRA 4KPWA 1VZBA 1JMIA 2XW7A 1RTSA 3F0XX 4UP1A 1RX5A 4RGCA 2W3AA 3TD8A 1M78A 4XE6X 1BKPA 4HA7A 2BL9A 3EX8A 3DL5A 3JWMA 3C0AA 4KJJA 3CSEA 3B5BA 4M6KA 2VETA 1DHFA 4KM0A 1AXWA 1DR7A 4HA9A 4P68A 1KZJA 1JUJA 1VZCA 3EEKA 4PSSA 1FFLA 4P3QA 3BNZA 3QLRA 3H9KA 1S3VA 3F0QX 1CZ3A 3QLZA 1RA3A 3KGBA 3BGXA 3QFXA 1J3KA 5HPBA 1CD2A 3FQVA 3FQOA 1HVYA 1DYRA 1KLKA 1F4GA 2G8AA 3K74A 3S9UA 3JW5A 3EEMA 4Q0DA 4ECKA 1RX6A 5ECXA 4GD7A 1BQ2A 3E0BA 1TDAA 3FL9A 3I8AX 1NJAA 3UM5A 3K2HA 3F0UX 3NZDA 3EF9A 3SQYX 4EJ1A 1IA4A 1IA1A 3V8HA 3IK1A 5H39A 3GH0A 1TSMA 3FY9X 3IK0A 4IQQA 4HOEA 2KGKA 4G6WX 1JUVA 2FZHA 3GYFA 1TDBA 1RE7A 4ELGA 1BKOA 3UM6A 2ITHA 3TQBA 3QYOA 4XT8A 1RX4A 3C06A 4G2OX 2W3BA 1KCEA 1OHJA 1LCEA 4KJKA 3QLYA 3GI2A 4XT7A 4KFJA 1BIDA 1BP0A 1M7AA 5U27A 4JEFA 3SRRX 1J3IA 1JU6A 1F4BA 1DR4A 4KEBA 3BHLA 4EZ8A 1NJCA 3FQZA 4DPHA 5HS3A 1TSZA 1RH3A 3JWCA 3R33A 2W9HA 3FL8A 3FRDX 2GD9A 3BFIA 1JUTA 1TSVA 1NCEA 4FOGA 4IQBA 1J3JA 2JYBA 1LY3A 1VDRA 2HM9A 1S3YA 3NRRA 2HXVA 1EVGA 3QLSA 1TLCA 1BSFA 1F4EA 4M7VA 4IXFX 4LAGX 4FOAA 5H3AA 1DLRA 1HFRA 4OSGA 1NJEA 5FCTA 2W3WA 4ISKA 4KD7A 4QI9A 1DIUA 1TSWA 2O7PA 1NJBA 3FY8X 3ZPCA 1DR5A 1OHKA 1AIQA 5FDAA 1MVSA 2W3MA 3IA4A 1PD8A 1YPVA 4O7UA 1RX9A 1YHOA 2W3VA 3KY8A 3SRSX 1TYSA 1U72A 4XT4A 1TDUA 5BY6A 5HT5A 1TLSA 2FTOX 1ZDRA 1AI9A 3NXXA 3N5EA 3KJRA 3QGTA 3ROAA 1RD7A 4E28A 4IRRA 3NZBX 1EV5A 3QYLA 4ELEA 1JTQA 3JW3A 1BO8A 3EHIX 2L28A 4KYAA 3DAUA 2RDAA 3FYWX 4XSCA 4FQSA 3F8YA 2HQPA 3I3RA 4P3RA 4Q67A 1B5EA 1PD9A 5ECCA 1TRGA 4H0RA 3N5EB 3HB8A 5DFRA 1BDUA 1TSLA 1DDSA 1DNAA 1BZFA 3BZ0A 1F4FA 4H0UA 2BBQA 2ZZAA 3JSUA 1ZPRA 2CD2A 3TQ8A 3UM8A 4KY8A 3RG9A 7DFRA 4FGTA 4PSGA 1TVUA 2ANOA 4FHBA 3NTZA 1EVFA 4KNZA 4LAHX 1S3WA 3SGYA 4G95A 3NU0A 4PSTA 3ZPGA 3D84X 1JTUA 3SR5X 4XSDA 4GYHA 4CD2A 2G86A 3DGAA 4X5FA 4M7UA 3EIGA 4ISWA 4EIGA 4DFRA 3DATA
chains in the Genus database with same CATH topology
3EDWX 4DQ1A 3QLXA 3FQFA 5JG0X 1F4DA 1SEJA 1BPJA 1RA8A 3QJ7A 3Q1HA 4LRRA 1PDBA 1DYHA 3FYVX 4OR7A 5JA3A 1J3KC 4QJZD 4LAEX 2INQA 5E8QA 1RX7A 1BP6A 4XRBA 4NX6A 4XT5A 2KCEA 3IX6A 1RX1A 2AZNA 1JOLA 1DHIA 4O1XD 1JOMA 1DR6A 4Q6AA 4X5HA 1HZWA 1TSNA 3M09A 3BHRA 3NZ6X 3QLWA 1DDUA 2FZIA 4ELFA 4IXGX 2G8XA 1TVVA 1KZIA 2C2TA 4Q0EA 1RB2A 4H1IA 6DFRA 3DL6A 4X5IA 1B5DA 1SYNA 2DHFA 4EIZA 3GHWA 4I1NA 3CL9A 3HJ3A 1AO8A 4H96A 1F28A 1HFPA 2QK8A 4KJLA 4P66A 1TSYA 3GH2X 1J3IC 3OCHA 3OB7A 1DF7A 3FREX 2OBCA 3F8ZA 5HVBA 3DG8A 4EILA 4XSEA 2ONBA 1S3UA 4XECX 2D5NA 1JMFA 1J3JC 4X5GA 1DG7A 1DG5A 1BOZA 1EV8A 4H97A 1AOBA 3EAWX 4FGGA 4QJCA 3IJZA 4QLFA 2P4GA 3SA1A 1RB3A 1RX8A 4DP3A 2FTQA 4HOFA 5HUIA 1KMVA 4H98A 1HW4A 1DG8A 1LY4A 3HBBA 3FRAX 1DLSA 3KJSA 1U70A 4PTJA 2CIGA 4FOXA 1MVTA 3S3VA 1FWMA 3N0HA 3DRCA 4KL9A 3EJLA 4F2VA 4M6JA 1TISA 2TDDA 4O1XA 4H95A 3TMSA 1DRAA 2FTNA 1JG0A 3IRNA 8DFRA 3IROA 1M79A 1JMHA 2TSCA 4PDJA 4GH8A 2OIPA 3B9HA 3L3RA 4ELBA 1DRBA 4M2XA 3NZ9X 4KBNA 3NZCX 4QLEA 5J7WA 2D0KA 4EB4A 4G8ZX 3IX9A 1VZDA 3NZAX 4TU5X 3OAFA 1DAJA 4G3MA 1BSPA 4DPDA 3NXTA 2VF0A 1RF7A 3CLBA 2RD8A 2BLBA 3GHCA 1AJMA 3FQCA 5HQYA 5U26A 3FQ0A 1TJSA 3GHVA 3UWLB 3EBUA 3K47A 1TDRA 4LEKX 4FGHA 1RX2A 4O1UA 1QQQA 4PSYA 1DDRA 5CC9A 4EINA 4I13A 1B49A 1BJGA 4TMSA 3EEJA 1TVWA 3SRWX 2RD8B 1DR2A 3ED7A 3F0BX 3IRMA 3K45A 2LF1A 1RG7A 4IXED 2W9GA 2G89A 1DYIA 3FS6A 2TDMA 1TSXA 3BYXA 1DRFA 5HQZA 5WRNA 1RC4A 3F91A 3QL0A 4KM2A 1DRHA 1QZFA 3NXRA 3JWKA 4KLXA 1DYJA 1E26A 1IA2A 3GG5A 2DRCA 1D1GA 3DGAC 5HT4A 1LCBA 3QL3A 4M6LA 3NXYA 5EAJA 2G6VA 3SRQX 4XT6A 1B02A 3D80A 2W9TA 1VJ3A 2AAZA 3CD2A 3JVXA 4KAKA 2FZJA 3LG4A 5CCCA 1F4CA 3SRUX 4E5OA 1U71A 4GEVA 2A9WA 1HFQA 2ANQA 2W9SA 3NXOA 1I00A 1VZEA 1LCAA 3VCOA 1DISA 3FRFX 1JMGA 1RA9A 5HF2X 4PTHA 3TQAA 3KGYA 3SAIA 1BQ1A 1RA2A 1RX3A 1LUDA 3DFRA 4KNEA 1VZAA 3IA5A 4KY4A 3SH2A 1HW3A 1DR3A 5HSUA 1IA3A 4HOGA 3EGYX 2C2SA 3INVA 2BLCA 3FRBX 3JTWA 4X5JA 1TSDA 1AN5A 1CI7A 4NX7A 5HVEA 2TSRA 3S7AA 1DHJA 4DDRA 1NJDA 1DREA 1KMSA 1TDCA 1DR1A 1BO7A 3F0SX 3RO9A 2G8DA 5H38A 3NXVA 5HF0X 4QHVA 3KFYA 3SA2A 3N5GA 3EELA 1RA1A 2BLAA 5HI6A 3M08A 5DXVA 2H2QA 3IHIA 4ELHA 3JWFA 2B3ZA 3DG8C 4QLGA 3UWLA 3QG2A 1AOEA 3F0VX 3TQ9A 1THYA 5HSRA 4KPWA 1VZBA 1JMIA 2XW7A 1RTSA 3F0XX 4UP1A 1RX5A 4RGCA 2W3AA 3TD8A 1M78A 4XE6X 1BKPA 4HA7A 2BL9A 3EX8A 3DL5A 3JWMA 3C0AA 4KJJA 3CSEA 3B5BA 4M6KA 2VETA 1DHFA 4KM0A 1AXWA 1DR7A 4HA9A 4P68A 1KZJA 1JUJA 1VZCA 3EEKA 4PSSA 1FFLA 4P3QA 3BNZA 3QLRA 3H9KA 1S3VA 3F0QX 1CZ3A 3QLZA 1RA3A 3KGBA 3BGXA 3QFXA 1J3KA 5HPBA 1CD2A 3FQVA 3FQOA 1HVYA 1DYRA 1KLKA 1F4GA 2G8AA 3K74A 3S9UA 3JW5A 3EEMA 4Q0DA 4ECKA 1RX6A 5ECXA 4GD7A 1BQ2A 3E0BA 1TDAA 3FL9A 3I8AX 1NJAA 3UM5A 3K2HA 3F0UX 3NZDA 3EF9A 3SQYX 4EJ1A 1IA4A 1IA1A 3V8HA 3IK1A 5H39A 3GH0A 1TSMA 3FY9X 3IK0A 4IQQA 4HOEA 2KGKA 4G6WX 1JUVA 2FZHA 3GYFA 1TDBA 1RE7A 4ELGA 1BKOA 3UM6A 2ITHA 3TQBA 3QYOA 4XT8A 1RX4A 3C06A 4G2OX 2W3BA 1KCEA 1OHJA 1LCEA 4KJKA 3QLYA 3GI2A 4XT7A 4KFJA 1BIDA 1BP0A 1M7AA 5U27A 4JEFA 3SRRX 1J3IA 1JU6A 1F4BA 1DR4A 4KEBA 3BHLA 4EZ8A 1NJCA 3FQZA 4DPHA 5HS3A 1TSZA 1RH3A 3JWCA 3R33A 2W9HA 3FL8A 3FRDX 2GD9A 3BFIA 1JUTA 1TSVA 1NCEA 4FOGA 4IQBA 1J3JA 2JYBA 1LY3A 1VDRA 2HM9A 1S3YA 3NRRA 2HXVA 1EVGA 3QLSA 1TLCA 1BSFA 1F4EA 4M7VA 4IXFX 4LAGX 4FOAA 5H3AA 1DLRA 1HFRA 4OSGA 1NJEA 5FCTA 2W3WA 4ISKA 4KD7A 4QI9A 1DIUA 1TSWA 2O7PA 1NJBA 3FY8X 3ZPCA 1DR5A 1OHKA 1AIQA 5FDAA 1MVSA 2W3MA 3IA4A 1PD8A 1YPVA 4O7UA 1RX9A 1YHOA 2W3VA 3KY8A 3SRSX 1TYSA 1U72A 4XT4A 1TDUA 5BY6A 5HT5A 1TLSA 2FTOX 1ZDRA 1AI9A 3NXXA 3N5EA 3KJRA 3QGTA 3ROAA 1RD7A 4E28A 4IRRA 3NZBX 1EV5A 3QYLA 4ELEA 1JTQA 3JW3A 1BO8A 3EHIX 2L28A 4KYAA 3DAUA 2RDAA 3FYWX 4XSCA 4FQSA 3F8YA 2HQPA 3I3RA 4P3RA 4Q67A 1B5EA 1PD9A 5ECCA 1TRGA 4H0RA 3N5EB 3HB8A 5DFRA 1BDUA 1TSLA 1DDSA 1DNAA 1BZFA 3BZ0A 1F4FA 4H0UA 2BBQA 2ZZAA 3JSUA 1ZPRA 2CD2A 3TQ8A 3UM8A 4KY8A 3RG9A 7DFRA 4FGTA 4PSGA 1TVUA 2ANOA 4FHBA 3NTZA 1EVFA 4KNZA 4LAHX 1S3WA 3SGYA 4G95A 3NU0A 4PSTA 3ZPGA 3D84X 1JTUA 3SR5X 4XSDA 4GYHA 4CD2A 2G86A 3DGAA 4X5FA 4M7UA 3EIGA 4ISWA 4EIGA 4DFRA 3DATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDW X;  4DQ1 A;  3QLX A;  3FQF A;  5JG0 X;  1F4D A;  1SEJ A;  1BPJ A;  1RA8 A;  3QJ7 A;  3Q1H A;  4LRR A;  1PDB A;  1DYH A;  3FYV X;  4OR7 A;  5JA3 A;  1J3K C;  4QJZ D;  4LAE X;  2INQ A;  5E8Q A;  1RX7 A;  1BP6 A;  4XRB A;  4NX6 A;  4XT5 A;  2KCE A;  3IX6 A;  1RX1 A;  2AZN A;  1JOL A;  1DHI A;  4O1X D;  1JOM A;  1DR6 A;  4Q6A A;  4X5H A;  1HZW A;  1TSN A;  3M09 A;  3BHR A;  3NZ6 X;  3QLW A;  1DDU A;  2FZI A;  4ELF A;  4IXG X;  2G8X A;  1TVV A;  1KZI A;  2C2T A;  4Q0E A;  1RB2 A;  4H1I A;  6DFR A;  3DL6 A;  4X5I A;  1B5D A;  1SYN A;  2DHF A;  4EIZ A;  3GHW A;  4I1N A;  3CL9 A;  3HJ3 A;  1AO8 A;  4H96 A;  1F28 A;  1HFP A;  2QK8 A;  4KJL A;  4P66 A;  1TSY A;  3GH2 X;  1J3I C;  3OCH A;  3OB7 A;  1DF7 A;  3FRE X;  2OBC A;  3F8Z A;  5HVB A;  3DG8 A;  4EIL A;  4XSE A;  2ONB A;  1S3U A;  4XEC X;  2D5N A;  1JMF A;  1J3J C;  4X5G A;  1DG7 A;  1DG5 A;  1BOZ A;  1EV8 A;  4H97 A;  1AOB A;  3EAW X;  4FGG A;  4QJC A;  3IJZ A;  4QLF A;  2P4G A;  3SA1 A;  1RB3 A;  1RX8 A;  4DP3 A;  2FTQ A;  4HOF A;  5HUI A;  1KMV A;  4H98 A;  1HW4 A;  1DG8 A;  1LY4 A;  3HBB A;  3FRA X;  1DLS A;  3KJS A;  1U70 A;  4PTJ A;  2CIG A;  4FOX A;  1MVT A;  3S3V A;  1FWM A;  3N0H A;  3DRC A;  4KL9 A;  3EJL A;  4F2V A;  4M6J A;  1TIS A;  2TDD A;  4O1X A;  4H95 A;  3TMS A;  1DRA A;  2FTN A;  1JG0 A;  3IRN A;  8DFR A;  3IRO A;  1M79 A;  1JMH A;  2TSC A;  4PDJ A;  4GH8 A;  2OIP A;  3B9H A;  3L3R A;  4ELB A;  1DRB A;  4M2X A;  3NZ9 X;  4KBN A;  3NZC X;  4QLE A;  5J7W A;  2D0K A;  4EB4 A;  4G8Z X;  3IX9 A;  1VZD A;  3NZA X;  4TU5 X;  3OAF A;  1DAJ A;  4G3M A;  1BSP A;  4DPD A;  3NXT A;  2VF0 A;  1RF7 A;  3CLB A;  2RD8 A;  2BLB A;  3GHC A;  1AJM A;  3FQC A;  5HQY A;  5U26 A;  3FQ0 A;  1TJS A;  3GHV A;  3UWL B;  3EBU A;  3K47 A;  1TDR A;  4LEK X;  4FGH A;  1RX2 A;  4O1U A;  1QQQ A;  4PSY A;  1DDR A;  5CC9 A;  4EIN A;  4I13 A;  1B49 A;  1BJG A;  4TMS A;  3EEJ A;  1TVW A;  3SRW X;  2RD8 B;  1DR2 A;  3ED7 A;  3F0B X;  3IRM A;  3K45 A;  2LF1 A;  1RG7 A;  4IXE D;  2W9G A;  2G89 A;  1DYI A;  3FS6 A;  2TDM A;  1TSX A;  3BYX A;  1DRF A;  5HQZ A;  5WRN A;  1RC4 A;  3F91 A;  3QL0 A;  4KM2 A;  1DRH A;  1QZF A;  3NXR A;  3JWK A;  4KLX A;  1DYJ A;  1E26 A;  1IA2 A;  3GG5 A;  2DRC A;  1D1G A;  3DGA C;  5HT4 A;  1LCB A;  3QL3 A;  4M6L A;  3NXY A;  5EAJ A;  2G6V A;  3SRQ X;  4XT6 A;  1B02 A;  3D80 A;  2W9T A;  1VJ3 A;  2AAZ A;  3CD2 A;  3JVX A;  4KAK A;  2FZJ A;  3LG4 A;  5CCC A;  1F4C A;  3SRU X;  4E5O A;  1U71 A;  4GEV A;  2A9W A;  1HFQ A;  2ANQ A;  2W9S A;  3NXO A;  1I00 A;  1VZE A;  1LCA A;  3VCO A;  1DIS A;  3FRF X;  1JMG A;  1RA9 A;  5HF2 X;  4PTH A;  3TQA A;  3KGY A;  3SAI A;  1BQ1 A;  1RA2 A;  1RX3 A;  1LUD A;  3DFR A;  4KNE A;  1VZA A;  3IA5 A;  4KY4 A;  3SH2 A;  1HW3 A;  1DR3 A;  5HSU A;  1IA3 A;  4HOG A;  3EGY X;  2C2S A;  3INV A;  2BLC A;  3FRB X;  3JTW A;  4X5J A;  1TSD A;  1AN5 A;  1CI7 A;  4NX7 A;  5HVE A;  2TSR A;  3S7A A;  1DHJ A;  4DDR A;  1NJD A;  1DRE A;  1KMS A;  1TDC A;  1DR1 A;  1BO7 A;  3F0S X;  3RO9 A;  2G8D A;  5H38 A;  3NXV A;  5HF0 X;  4QHV A;  3KFY A;  3SA2 A;  3N5G A;  3EEL A;  1RA1 A;  2BLA A;  5HI6 A;  3M08 A;  5DXV A;  2H2Q A;  3IHI A;  4ELH A;  3JWF A;  2B3Z A;  3DG8 C;  4QLG A;  3UWL A;  3QG2 A;  1AOE A;  3F0V X;  3TQ9 A;  1THY A;  5HSR A;  4KPW A;  1VZB A;  1JMI A;  2XW7 A;  1RTS A;  3F0X X;  4UP1 A;  1RX5 A;  4RGC A;  2W3A A;  3TD8 A;  1M78 A;  4XE6 X;  1BKP A;  4HA7 A;  2BL9 A;  3EX8 A;  3DL5 A;  3JWM A;  3C0A A;  4KJJ A;  3CSE A;  3B5B A;  4M6K A;  2VET A;  1DHF A;  4KM0 A;  1AXW A;  1DR7 A;  4HA9 A;  4P68 A;  1KZJ A;  1JUJ A;  1VZC A;  3EEK A;  4PSS A;  1FFL A;  4P3Q A;  3BNZ A;  3QLR A;  3H9K A;  1S3V A;  3F0Q X;  1CZ3 A;  3QLZ A;  1RA3 A;  3KGB A;  3BGX A;  3QFX A;  1J3K A;  5HPB A;  1CD2 A;  3FQV A;  3FQO A;  1HVY A;  1DYR A;  1KLK A;  1F4G A;  2G8A A;  3K74 A;  3S9U A;  3JW5 A;  3EEM A;  4Q0D A;  4ECK A;  1RX6 A;  5ECX A;  4GD7 A;  1BQ2 A;  3E0B A;  1TDA A;  3FL9 A;  3I8A X;  1NJA A;  3UM5 A;  3K2H A;  3F0U X;  3NZD A;  3EF9 A;  3SQY X;  4EJ1 A;  1IA4 A;  1IA1 A;  3V8H A;  3IK1 A;  5H39 A;  3GH0 A;  1TSM A;  3FY9 X;  3IK0 A;  4IQQ A;  4HOE A;  2KGK A;  4G6W X;  1JUV A;  2FZH A;  3GYF A;  1TDB A;  1RE7 A;  4ELG A;  1BKO A;  3UM6 A;  2ITH A;  3TQB A;  3QYO A;  4XT8 A;  1RX4 A;  3C06 A;  4G2O X;  2W3B A;  1KCE A;  1OHJ A;  1LCE A;  4KJK A;  3QLY A;  3GI2 A;  4XT7 A;  4KFJ A;  1BID A;  1BP0 A;  1M7A A;  5U27 A;  4JEF A;  3SRR X;  1J3I A;  1JU6 A;  1F4B A;  1DR4 A;  4KEB A;  3BHL A;  4EZ8 A;  1NJC A;  3FQZ A;  4DPH A;  5HS3 A;  1TSZ A;  1RH3 A;  3JWC A;  3R33 A;  2W9H A;  3FL8 A;  3FRD X;  2GD9 A;  3BFI A;  1JUT A;  1TSV A;  1NCE A;  4FOG A;  4IQB A;  1J3J A;  2JYB A;  1LY3 A;  1VDR A;  2HM9 A;  1S3Y A;  3NRR A;  2HXV A;  1EVG A;  3QLS A;  1TLC A;  1BSF A;  1F4E A;  4M7V A;  4IXF X;  4LAG X;  4FOA A;  5H3A A;  1DLR A;  1HFR A;  4OSG A;  1NJE A;  5FCT A;  2W3W A;  4ISK A;  4KD7 A;  4QI9 A;  1DIU A;  1TSW A;  2O7P A;  1NJB A;  3FY8 X;  3ZPC A;  1DR5 A;  1OHK A;  1AIQ A;  5FDA A;  1MVS A;  2W3M A;  3IA4 A;  1PD8 A;  1YPV A;  4O7U A;  1RX9 A;  1YHO A;  2W3V A;  3KY8 A;  3SRS X;  1TYS A;  1U72 A;  4XT4 A;  1TDU A;  5BY6 A;  5HT5 A;  1TLS A;  2FTO X;  1ZDR A;  1AI9 A;  3NXX A;  3N5E A;  3KJR A;  3QGT A;  3ROA A;  1RD7 A;  4E28 A;  4IRR A;  3NZB X;  1EV5 A;  3QYL A;  4ELE A;  1JTQ A;  3JW3 A;  1BO8 A;  3EHI X;  2L28 A;  4KYA A;  3DAU A;  2RDA A;  3FYW X;  4XSC A;  4FQS A;  3F8Y A;  2HQP A;  3I3R A;  4P3R A;  4Q67 A;  1B5E A;  1PD9 A;  5ECC A;  1TRG A;  4H0R A;  3N5E B;  3HB8 A;  5DFR A;  1BDU A;  1TSL A;  1DDS A;  1DNA A;  1BZF A;  3BZ0 A;  1F4F A;  4H0U A;  2BBQ A;  2ZZA A;  3JSU A;  1ZPR A;  2CD2 A;  3TQ8 A;  3UM8 A;  4KY8 A;  3RG9 A;  7DFR A;  4FGT A;  4PSG A;  1TVU A;  2ANO A;  4FHB A;  3NTZ A;  1EVF A;  4KNZ A;  4LAH X;  1S3W A;  3SGY A;  4G95 A;  3NU0 A;  4PST A;  3ZPG A;  3D84 X;  1JTU A;  3SR5 X;  4XSD A;  4GYH A;  4CD2 A;  2G86 A;  3DGA A;  4X5F A;  4M7U A;  3EIG A;  4ISW A;  4EIG A;  4DFR A;  3DAT A; 
#chains in the Genus database with same CATH topology
 3EDW X;  4DQ1 A;  3QLX A;  3FQF A;  5JG0 X;  1F4D A;  1SEJ A;  1BPJ A;  1RA8 A;  3QJ7 A;  3Q1H A;  4LRR A;  1PDB A;  1DYH A;  3FYV X;  4OR7 A;  5JA3 A;  1J3K C;  4QJZ D;  4LAE X;  2INQ A;  5E8Q A;  1RX7 A;  1BP6 A;  4XRB A;  4NX6 A;  4XT5 A;  2KCE A;  3IX6 A;  1RX1 A;  2AZN A;  1JOL A;  1DHI A;  4O1X D;  1JOM A;  1DR6 A;  4Q6A A;  4X5H A;  1HZW A;  1TSN A;  3M09 A;  3BHR A;  3NZ6 X;  3QLW A;  1DDU A;  2FZI A;  4ELF A;  4IXG X;  2G8X A;  1TVV A;  1KZI A;  2C2T A;  4Q0E A;  1RB2 A;  4H1I A;  6DFR A;  3DL6 A;  4X5I A;  1B5D A;  1SYN A;  2DHF A;  4EIZ A;  3GHW A;  4I1N A;  3CL9 A;  3HJ3 A;  1AO8 A;  4H96 A;  1F28 A;  1HFP A;  2QK8 A;  4KJL A;  4P66 A;  1TSY A;  3GH2 X;  1J3I C;  3OCH A;  3OB7 A;  1DF7 A;  3FRE X;  2OBC A;  3F8Z A;  5HVB A;  3DG8 A;  4EIL A;  4XSE A;  2ONB A;  1S3U A;  4XEC X;  2D5N A;  1JMF A;  1J3J C;  4X5G A;  1DG7 A;  1DG5 A;  1BOZ A;  1EV8 A;  4H97 A;  1AOB A;  3EAW X;  4FGG A;  4QJC A;  3IJZ A;  4QLF A;  2P4G A;  3SA1 A;  1RB3 A;  1RX8 A;  4DP3 A;  2FTQ A;  4HOF A;  5HUI A;  1KMV A;  4H98 A;  1HW4 A;  1DG8 A;  1LY4 A;  3HBB A;  3FRA X;  1DLS A;  3KJS A;  1U70 A;  4PTJ A;  2CIG A;  4FOX A;  1MVT A;  3S3V A;  1FWM A;  3N0H A;  3DRC A;  4KL9 A;  3EJL A;  4F2V A;  4M6J A;  1TIS A;  2TDD A;  4O1X A;  4H95 A;  3TMS A;  1DRA A;  2FTN A;  1JG0 A;  3IRN A;  8DFR A;  3IRO A;  1M79 A;  1JMH A;  2TSC A;  4PDJ A;  4GH8 A;  2OIP A;  3B9H A;  3L3R A;  4ELB A;  1DRB A;  4M2X A;  3NZ9 X;  4KBN A;  3NZC X;  4QLE A;  5J7W A;  2D0K A;  4EB4 A;  4G8Z X;  3IX9 A;  1VZD A;  3NZA X;  4TU5 X;  3OAF A;  1DAJ A;  4G3M A;  1BSP A;  4DPD A;  3NXT A;  2VF0 A;  1RF7 A;  3CLB A;  2RD8 A;  2BLB A;  3GHC A;  1AJM A;  3FQC A;  5HQY A;  5U26 A;  3FQ0 A;  1TJS A;  3GHV A;  3UWL B;  3EBU A;  3K47 A;  1TDR A;  4LEK X;  4FGH A;  1RX2 A;  4O1U A;  1QQQ A;  4PSY A;  1DDR A;  5CC9 A;  4EIN A;  4I13 A;  1B49 A;  1BJG A;  4TMS A;  3EEJ A;  1TVW A;  3SRW X;  2RD8 B;  1DR2 A;  3ED7 A;  3F0B X;  3IRM A;  3K45 A;  2LF1 A;  1RG7 A;  4IXE D;  2W9G A;  2G89 A;  1DYI A;  3FS6 A;  2TDM A;  1TSX A;  3BYX A;  1DRF A;  5HQZ A;  5WRN A;  1RC4 A;  3F91 A;  3QL0 A;  4KM2 A;  1DRH A;  1QZF A;  3NXR A;  3JWK A;  4KLX A;  1DYJ A;  1E26 A;  1IA2 A;  3GG5 A;  2DRC A;  1D1G A;  3DGA C;  5HT4 A;  1LCB A;  3QL3 A;  4M6L A;  3NXY A;  5EAJ A;  2G6V A;  3SRQ X;  4XT6 A;  1B02 A;  3D80 A;  2W9T A;  1VJ3 A;  2AAZ A;  3CD2 A;  3JVX A;  4KAK A;  2FZJ A;  3LG4 A;  5CCC A;  1F4C A;  3SRU X;  4E5O A;  1U71 A;  4GEV A;  2A9W A;  1HFQ A;  2ANQ A;  2W9S A;  3NXO A;  1I00 A;  1VZE A;  1LCA A;  3VCO A;  1DIS A;  3FRF X;  1JMG A;  1RA9 A;  5HF2 X;  4PTH A;  3TQA A;  3KGY A;  3SAI A;  1BQ1 A;  1RA2 A;  1RX3 A;  1LUD A;  3DFR A;  4KNE A;  1VZA A;  3IA5 A;  4KY4 A;  3SH2 A;  1HW3 A;  1DR3 A;  5HSU A;  1IA3 A;  4HOG A;  3EGY X;  2C2S A;  3INV A;  2BLC A;  3FRB X;  3JTW A;  4X5J A;  1TSD A;  1AN5 A;  1CI7 A;  4NX7 A;  5HVE A;  2TSR A;  3S7A A;  1DHJ A;  4DDR A;  1NJD A;  1DRE A;  1KMS A;  1TDC A;  1DR1 A;  1BO7 A;  3F0S X;  3RO9 A;  2G8D A;  5H38 A;  3NXV A;  5HF0 X;  4QHV A;  3KFY A;  3SA2 A;  3N5G A;  3EEL A;  1RA1 A;  2BLA A;  5HI6 A;  3M08 A;  5DXV A;  2H2Q A;  3IHI A;  4ELH A;  3JWF A;  2B3Z A;  3DG8 C;  4QLG A;  3UWL A;  3QG2 A;  1AOE A;  3F0V X;  3TQ9 A;  1THY A;  5HSR A;  4KPW A;  1VZB A;  1JMI A;  2XW7 A;  1RTS A;  3F0X X;  4UP1 A;  1RX5 A;  4RGC A;  2W3A A;  3TD8 A;  1M78 A;  4XE6 X;  1BKP A;  4HA7 A;  2BL9 A;  3EX8 A;  3DL5 A;  3JWM A;  3C0A A;  4KJJ A;  3CSE A;  3B5B A;  4M6K A;  2VET A;  1DHF A;  4KM0 A;  1AXW A;  1DR7 A;  4HA9 A;  4P68 A;  1KZJ A;  1JUJ A;  1VZC A;  3EEK A;  4PSS A;  1FFL A;  4P3Q A;  3BNZ A;  3QLR A;  3H9K A;  1S3V A;  3F0Q X;  1CZ3 A;  3QLZ A;  1RA3 A;  3KGB A;  3BGX A;  3QFX A;  1J3K A;  5HPB A;  1CD2 A;  3FQV A;  3FQO A;  1HVY A;  1DYR A;  1KLK A;  1F4G A;  2G8A A;  3K74 A;  3S9U A;  3JW5 A;  3EEM A;  4Q0D A;  4ECK A;  1RX6 A;  5ECX A;  4GD7 A;  1BQ2 A;  3E0B A;  1TDA A;  3FL9 A;  3I8A X;  1NJA A;  3UM5 A;  3K2H A;  3F0U X;  3NZD A;  3EF9 A;  3SQY X;  4EJ1 A;  1IA4 A;  1IA1 A;  3V8H A;  3IK1 A;  5H39 A;  3GH0 A;  1TSM A;  3FY9 X;  3IK0 A;  4IQQ A;  4HOE A;  2KGK A;  4G6W X;  1JUV A;  2FZH A;  3GYF A;  1TDB A;  1RE7 A;  4ELG A;  1BKO A;  3UM6 A;  2ITH A;  3TQB A;  3QYO A;  4XT8 A;  1RX4 A;  3C06 A;  4G2O X;  2W3B A;  1KCE A;  1OHJ A;  1LCE A;  4KJK A;  3QLY A;  3GI2 A;  4XT7 A;  4KFJ A;  1BID A;  1BP0 A;  1M7A A;  5U27 A;  4JEF A;  3SRR X;  1J3I A;  1JU6 A;  1F4B A;  1DR4 A;  4KEB A;  3BHL A;  4EZ8 A;  1NJC A;  3FQZ A;  4DPH A;  5HS3 A;  1TSZ A;  1RH3 A;  3JWC A;  3R33 A;  2W9H A;  3FL8 A;  3FRD X;  2GD9 A;  3BFI A;  1JUT A;  1TSV A;  1NCE A;  4FOG A;  4IQB A;  1J3J A;  2JYB A;  1LY3 A;  1VDR A;  2HM9 A;  1S3Y A;  3NRR A;  2HXV A;  1EVG A;  3QLS A;  1TLC A;  1BSF A;  1F4E A;  4M7V A;  4IXF X;  4LAG X;  4FOA A;  5H3A A;  1DLR A;  1HFR A;  4OSG A;  1NJE A;  5FCT A;  2W3W A;  4ISK A;  4KD7 A;  4QI9 A;  1DIU A;  1TSW A;  2O7P A;  1NJB A;  3FY8 X;  3ZPC A;  1DR5 A;  1OHK A;  1AIQ A;  5FDA A;  1MVS A;  2W3M A;  3IA4 A;  1PD8 A;  1YPV A;  4O7U A;  1RX9 A;  1YHO A;  2W3V A;  3KY8 A;  3SRS X;  1TYS A;  1U72 A;  4XT4 A;  1TDU A;  5BY6 A;  5HT5 A;  1TLS A;  2FTO X;  1ZDR A;  1AI9 A;  3NXX A;  3N5E A;  3KJR A;  3QGT A;  3ROA A;  1RD7 A;  4E28 A;  4IRR A;  3NZB X;  1EV5 A;  3QYL A;  4ELE A;  1JTQ A;  3JW3 A;  1BO8 A;  3EHI X;  2L28 A;  4KYA A;  3DAU A;  2RDA A;  3FYW X;  4XSC A;  4FQS A;  3F8Y A;  2HQP A;  3I3R A;  4P3R A;  4Q67 A;  1B5E A;  1PD9 A;  5ECC A;  1TRG A;  4H0R A;  3N5E B;  3HB8 A;  5DFR A;  1BDU A;  1TSL A;  1DDS A;  1DNA A;  1BZF A;  3BZ0 A;  1F4F A;  4H0U A;  2BBQ A;  2ZZA A;  3JSU A;  1ZPR A;  2CD2 A;  3TQ8 A;  3UM8 A;  4KY8 A;  3RG9 A;  7DFR A;  4FGT A;  4PSG A;  1TVU A;  2ANO A;  4FHB A;  3NTZ A;  1EVF A;  4KNZ A;  4LAH X;  1S3W A;  3SGY A;  4G95 A;  3NU0 A;  4PST A;  3ZPG A;  3D84 X;  1JTU A;  3SR5 X;  4XSD A;  4GYH A;  4CD2 A;  2G86 A;  3DGA A;  4X5F A;  4M7U A;  3EIG A;  4ISW A;  4EIG A;  4DFR A;  3DAT A; 
#chains in the Genus database with same CATH homology
 3EDW X;  4DQ1 A;  3QLX A;  3FQF A;  5JG0 X;  1F4D A;  1SEJ A;  1BPJ A;  1RA8 A;  3QJ7 A;  3Q1H A;  4LRR A;  1PDB A;  1DYH A;  3FYV X;  4OR7 A;  5JA3 A;  1J3K C;  4QJZ D;  4LAE X;  2INQ A;  5E8Q A;  1RX7 A;  1BP6 A;  4XRB A;  4NX6 A;  4XT5 A;  2KCE A;  3IX6 A;  1RX1 A;  2AZN A;  1JOL A;  1DHI A;  4O1X D;  1JOM A;  1DR6 A;  4Q6A A;  4X5H A;  1HZW A;  1TSN A;  3M09 A;  3BHR A;  3NZ6 X;  3QLW A;  1DDU A;  2FZI A;  4ELF A;  4IXG X;  2G8X A;  1TVV A;  1KZI A;  2C2T A;  4Q0E A;  1RB2 A;  4H1I A;  6DFR A;  3DL6 A;  4X5I A;  1B5D A;  1SYN A;  2DHF A;  4EIZ A;  3GHW A;  4I1N A;  3CL9 A;  3HJ3 A;  1AO8 A;  4H96 A;  1F28 A;  1HFP A;  2QK8 A;  4KJL A;  4P66 A;  1TSY A;  3GH2 X;  1J3I C;  3OCH A;  3OB7 A;  1DF7 A;  3FRE X;  2OBC A;  3F8Z A;  5HVB A;  3DG8 A;  4EIL A;  4XSE A;  2ONB A;  1S3U A;  4XEC X;  2D5N A;  1JMF A;  1J3J C;  4X5G A;  1DG7 A;  1DG5 A;  1BOZ A;  1EV8 A;  4H97 A;  1AOB A;  3EAW X;  4FGG A;  4QJC A;  3IJZ A;  4QLF A;  2P4G A;  3SA1 A;  1RB3 A;  1RX8 A;  4DP3 A;  2FTQ A;  4HOF A;  5HUI A;  1KMV A;  4H98 A;  1HW4 A;  1DG8 A;  1LY4 A;  3HBB A;  3FRA X;  1DLS A;  3KJS A;  1U70 A;  4PTJ A;  2CIG A;  4FOX A;  1MVT A;  3S3V A;  1FWM A;  3N0H A;  3DRC A;  4KL9 A;  3EJL A;  4F2V A;  4M6J A;  1TIS A;  2TDD A;  4O1X A;  4H95 A;  3TMS A;  1DRA A;  2FTN A;  1JG0 A;  3IRN A;  8DFR A;  3IRO A;  1M79 A;  1JMH A;  2TSC A;  4PDJ A;  4GH8 A;  2OIP A;  3B9H A;  3L3R A;  4ELB A;  1DRB A;  4M2X A;  3NZ9 X;  4KBN A;  3NZC X;  4QLE A;  5J7W A;  2D0K A;  4EB4 A;  4G8Z X;  3IX9 A;  1VZD A;  3NZA X;  4TU5 X;  3OAF A;  1DAJ A;  4G3M A;  1BSP A;  4DPD A;  3NXT A;  2VF0 A;  1RF7 A;  3CLB A;  2RD8 A;  2BLB A;  3GHC A;  1AJM A;  3FQC A;  5HQY A;  5U26 A;  3FQ0 A;  1TJS A;  3GHV A;  3UWL B;  3EBU A;  3K47 A;  1TDR A;  4LEK X;  4FGH A;  1RX2 A;  4O1U A;  1QQQ A;  4PSY A;  1DDR A;  5CC9 A;  4EIN A;  4I13 A;  1B49 A;  1BJG A;  4TMS A;  3EEJ A;  1TVW A;  3SRW X;  2RD8 B;  1DR2 A;  3ED7 A;  3F0B X;  3IRM A;  3K45 A;  2LF1 A;  1RG7 A;  4IXE D;  2W9G A;  2G89 A;  1DYI A;  3FS6 A;  2TDM A;  1TSX A;  3BYX A;  1DRF A;  5HQZ A;  5WRN A;  1RC4 A;  3F91 A;  3QL0 A;  4KM2 A;  1DRH A;  1QZF A;  3NXR A;  3JWK A;  4KLX A;  1DYJ A;  1E26 A;  1IA2 A;  3GG5 A;  2DRC A;  1D1G A;  3DGA C;  5HT4 A;  1LCB A;  3QL3 A;  4M6L A;  3NXY A;  5EAJ A;  2G6V A;  3SRQ X;  4XT6 A;  1B02 A;  3D80 A;  2W9T A;  1VJ3 A;  2AAZ A;  3CD2 A;  3JVX A;  4KAK A;  2FZJ A;  3LG4 A;  5CCC A;  1F4C A;  3SRU X;  4E5O A;  1U71 A;  4GEV A;  2A9W A;  1HFQ A;  2ANQ A;  2W9S A;  3NXO A;  1I00 A;  1VZE A;  1LCA A;  3VCO A;  1DIS A;  3FRF X;  1JMG A;  1RA9 A;  5HF2 X;  4PTH A;  3TQA A;  3KGY A;  3SAI A;  1BQ1 A;  1RA2 A;  1RX3 A;  1LUD A;  3DFR A;  4KNE A;  1VZA A;  3IA5 A;  4KY4 A;  3SH2 A;  1HW3 A;  1DR3 A;  5HSU A;  1IA3 A;  4HOG A;  3EGY X;  2C2S A;  3INV A;  2BLC A;  3FRB X;  3JTW A;  4X5J A;  1TSD A;  1AN5 A;  1CI7 A;  4NX7 A;  5HVE A;  2TSR A;  3S7A A;  1DHJ A;  4DDR A;  1NJD A;  1DRE A;  1KMS A;  1TDC A;  1DR1 A;  1BO7 A;  3F0S X;  3RO9 A;  2G8D A;  5H38 A;  3NXV A;  5HF0 X;  4QHV A;  3KFY A;  3SA2 A;  3N5G A;  3EEL A;  1RA1 A;  2BLA A;  5HI6 A;  3M08 A;  5DXV A;  2H2Q A;  3IHI A;  4ELH A;  3JWF A;  2B3Z A;  3DG8 C;  4QLG A;  3UWL A;  3QG2 A;  1AOE A;  3F0V X;  3TQ9 A;  1THY A;  5HSR A;  4KPW A;  1VZB A;  1JMI A;  2XW7 A;  1RTS A;  3F0X X;  4UP1 A;  1RX5 A;  4RGC A;  2W3A A;  3TD8 A;  1M78 A;  4XE6 X;  1BKP A;  4HA7 A;  2BL9 A;  3EX8 A;  3DL5 A;  3JWM A;  3C0A A;  4KJJ A;  3CSE A;  3B5B A;  4M6K A;  2VET A;  1DHF A;  4KM0 A;  1AXW A;  1DR7 A;  4HA9 A;  4P68 A;  1KZJ A;  1JUJ A;  1VZC A;  3EEK A;  4PSS A;  1FFL A;  4P3Q A;  3BNZ A;  3QLR A;  3H9K A;  1S3V A;  3F0Q X;  1CZ3 A;  3QLZ A;  1RA3 A;  3KGB A;  3BGX A;  3QFX A;  1J3K A;  5HPB A;  1CD2 A;  3FQV A;  3FQO A;  1HVY A;  1DYR A;  1KLK A;  1F4G A;  2G8A A;  3K74 A;  3S9U A;  3JW5 A;  3EEM A;  4Q0D A;  4ECK A;  1RX6 A;  5ECX A;  4GD7 A;  1BQ2 A;  3E0B A;  1TDA A;  3FL9 A;  3I8A X;  1NJA A;  3UM5 A;  3K2H A;  3F0U X;  3NZD A;  3EF9 A;  3SQY X;  4EJ1 A;  1IA4 A;  1IA1 A;  3V8H A;  3IK1 A;  5H39 A;  3GH0 A;  1TSM A;  3FY9 X;  3IK0 A;  4IQQ A;  4HOE A;  2KGK A;  4G6W X;  1JUV A;  2FZH A;  3GYF A;  1TDB A;  1RE7 A;  4ELG A;  1BKO A;  3UM6 A;  2ITH A;  3TQB A;  3QYO A;  4XT8 A;  1RX4 A;  3C06 A;  4G2O X;  2W3B A;  1KCE A;  1OHJ A;  1LCE A;  4KJK A;  3QLY A;  3GI2 A;  4XT7 A;  4KFJ A;  1BID A;  1BP0 A;  1M7A A;  5U27 A;  4JEF A;  3SRR X;  1J3I A;  1JU6 A;  1F4B A;  1DR4 A;  4KEB A;  3BHL A;  4EZ8 A;  1NJC A;  3FQZ A;  4DPH A;  5HS3 A;  1TSZ A;  1RH3 A;  3JWC A;  3R33 A;  2W9H A;  3FL8 A;  3FRD X;  2GD9 A;  3BFI A;  1JUT A;  1TSV A;  1NCE A;  4FOG A;  4IQB A;  1J3J A;  2JYB A;  1LY3 A;  1VDR A;  2HM9 A;  1S3Y A;  3NRR A;  2HXV A;  1EVG A;  3QLS A;  1TLC A;  1BSF A;  1F4E A;  4M7V A;  4IXF X;  4LAG X;  4FOA A;  5H3A A;  1DLR A;  1HFR A;  4OSG A;  1NJE A;  5FCT A;  2W3W A;  4ISK A;  4KD7 A;  4QI9 A;  1DIU A;  1TSW A;  2O7P A;  1NJB A;  3FY8 X;  3ZPC A;  1DR5 A;  1OHK A;  1AIQ A;  5FDA A;  1MVS A;  2W3M A;  3IA4 A;  1PD8 A;  1YPV A;  4O7U A;  1RX9 A;  1YHO A;  2W3V A;  3KY8 A;  3SRS X;  1TYS A;  1U72 A;  4XT4 A;  1TDU A;  5BY6 A;  5HT5 A;  1TLS A;  2FTO X;  1ZDR A;  1AI9 A;  3NXX A;  3N5E A;  3KJR A;  3QGT A;  3ROA A;  1RD7 A;  4E28 A;  4IRR A;  3NZB X;  1EV5 A;  3QYL A;  4ELE A;  1JTQ A;  3JW3 A;  1BO8 A;  3EHI X;  2L28 A;  4KYA A;  3DAU A;  2RDA A;  3FYW X;  4XSC A;  4FQS A;  3F8Y A;  2HQP A;  3I3R A;  4P3R A;  4Q67 A;  1B5E A;  1PD9 A;  5ECC A;  1TRG A;  4H0R A;  3N5E B;  3HB8 A;  5DFR A;  1BDU A;  1TSL A;  1DDS A;  1DNA A;  1BZF A;  3BZ0 A;  1F4F A;  4H0U A;  2BBQ A;  2ZZA A;  3JSU A;  1ZPR A;  2CD2 A;  3TQ8 A;  3UM8 A;  4KY8 A;  3RG9 A;  7DFR A;  4FGT A;  4PSG A;  1TVU A;  2ANO A;  4FHB A;  3NTZ A;  1EVF A;  4KNZ A;  4LAH X;  1S3W A;  3SGY A;  4G95 A;  3NU0 A;  4PST A;  3ZPG A;  3D84 X;  1JTU A;  3SR5 X;  4XSD A;  4GYH A;  4CD2 A;  2G86 A;  3DGA A;  4X5F A;  4M7U A;  3EIG A;  4ISW A;  4EIG A;  4DFR A;  3DAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...