4EILA

Crystal structure of the loop truncated toxoplasma gondii ts-dhfr
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
563
structure length
510
Chain Sequence
PVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPASRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKATYRPIFISKTFSDNGVPYDFVVLEKRRSSAAAIAPVLAWMDELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, transferase
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title First Three-Dimensional Structure of Toxoplasma gondii Thymidylate Synthase-Dihydrofolate Reductase: Insights for Catalysis, Interdomain Interactions, and Substrate Channeling.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 171
structure length 510
sequence length 563
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4eilA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4eilA01
4XT7A 3NXXA 4EZ8A 1YPVA 1RX7A 3IJZA 3GI2A 2RD8B 2FTNA 3FRDX 3FY8X 2HXVA 2B3ZA 2W3BA 1MVTA 4O1XA 1LCEA 4Q0DA 4LAEX 2FTOX 3V8HA 3FYVX 3NZBX 4M7VA 1DR1A 2W9TA 1BP0A 3UM8A 2G8DA 1EVFA 2KCEA 1VDRA 2QK8A 1BJGA 1HFPA 1KZJA 1SEJA 4M6JA 5HF0X 3EGYX 2G8AA 3KY8A 2FZHA 3SRWX 3TQ8A 4LRRA 5HUIA 4FOAA 4G3MA 4KJKA 2FZIA 2FTQA 3FQCA 3ZPCA 1BOZA 4HA7A 3QGTA 1IA2A 4KLXA 4M6LA 3EDWX 3E0BA 4E28A 3I3RA 3BFIA 2W9HA 3DL6A 5HPBA 1B02A 4Q0EA 3L3RA 2ZZAA 3SH2A 4XT6A 3DG8C 1DISA 1U70A 2DRCA 3Q1HA 1NJAA 3CLBA 2BL9A 4IRRA 3SA1A 3BNZA 3M09A 2OIPA 1DR5A 2VETA 3IK0A 1S3YA 1TSMA 1BKPA 3S7AA 1DHJA 1TLCA 1DYJA 4HOFA 1JUTA 2TSRA 4GH8A 3M08A 1JMFA 3UWLB 1AOBA 1DRAA 1RX3A 3NZAX 3F0SX 3K47A 1TSZA 3EELA 5DXVA 5HQYA 1DRFA 1RX2A 3IHIA 3EIGA 1S3UA 1RX9A 1RA2A 4HA9A 3S3VA 3NZ9X 1VZDA 1BP6A 1BQ2A 1LCAA 2VF0A 4FOXA 2ANQA 1ZPRA 3EEMA 1TDBA 4PSYA 2TDDA 1DAJA 1DNAA 5H3AA 1RB2A 3C06A 4HOGA 4O1XD 4X5IA 4FQSA 3GHWA 4O1UA 4IQQA 2FZJA 3FRFX 1NJCA 1JG0A 1KCEA 1DR7A 4ELGA 1F4CA 1J3KA 3SR5X 4PSTA 4PTHA 3ZPGA 3HB8A 1RE7A 3SRSX 4KBNA 4KAKA 3N5EA 2W3MA 3GHVA 5FCTA 1EV5A 3DGAA 1KMSA 3EX8A 3R33A 2RD8A 1DRBA 1VZCA 1AJMA 3CSEA 6DFRA 1AO8A 1RX8A 3QLRA 1PD9A 2O7PA 1EVGA 4XRBA 3BYXA 1LY4A 5U26A 4CD2A 1RD7A 2D0KA 2W3VA 3FREX 4QJZD 1M79A 4H97A 1TSXA 4QLFA 2BBQA 4E5OA 1RB3A 1RC4A 3FS6A 2CIGA 1JMGA 3SA2A 1B5EA 5H39A 1TVVA 1JUVA 4RGCA 1HFQA 1RF7A 5J7WA 3NU0A 4Q67A 2OBCA 4H96A 3QJ7A 4I13A 1RX5A 4ISKA 3KJRA 3UM6A 5ECXA 4UP1A 5HSUA 3SRUX 4H0UA 2C2TA 4KNEA 4X5JA 4FGHA 1JU6A 1TDCA 1J3JA 3GYFA 3NZDA 3QLSA 4NX6A 2LF1A 1NJBA 3NTZA 1RA9A 5E8QA 4XE6X 1JMHA 4NX7A 4OR7A 4P68A 3JWCA 4EINA 3DFRA 4ELEA 1J3IC 3DATA 3RO9A 4G8ZX 1TDUA 1DYHA 1DDUA 3NXOA 3OAFA 2HQPA 3D84X 1RTSA 2G86A 1QQQA 4KY4A 3INVA 3IX6A 3NZ6X 4X5FA 3KFYA 3S9UA 1YHOA 3HBBA 3JW5A 1BSPA 1E26A 3BGXA 4HOEA 3EBUA 4P3QA 3IA4A 1CI7A 2ITHA 4G6WX 1VZBA 3H9KA 1HW4A 4O7UA 4QJCA 4PTJA 3K45A 1BO7A 1DHFA 1DR4A 2BLCA 3TD8A 1LUDA 2TSCA 4M7UA 4EIGA 3CD2A 4X5GA 1M78A 1NCEA 4EB4A 7DFRA 3I8AX 1KZIA 4PSGA 1AXWA 3FY9X 3FL9A 1DYIA 1SYNA 2GD9A 4ELFA 3QLZA 2RDAA 1KLKA 3F91A 1F4EA 3QL0A 3KGBA 1HVYA 4X5HA 5U27A 1DG8A 4DP3A 1LY3A 4ECKA 3SQYX 1F4GA 3DRCA 3RG9A 3F0BX 4DPHA 4IXFX 2DHFA 1TRGA 1RG7A 1VZAA 3CL9A 3IRNA 1D1GA 2W9SA 3QYOA 4KY8A 2JYBA 4KD7A 3DG8A 3FQ0A 5EAJA 1HW3A 2ANOA 4H98A 3F0UX 2KGKA 4KM2A 1RX1A 5JA3A 1JTUA 5DFRA 1TSWA 4XSEA 4EIZA 1F28A 5CC9A 3HJ3A 2H2QA 5WRNA 3F0VX 4H1IA 3BHRA 4DFRA 3GH0A 3FQVA 4KJJA 4I1NA 4QHVA 1FFLA 1F4BA 8DFRA 1DG5A 4ISWA 2BLAA 1RH3A 5CCCA 5HVBA 2L28A 1FWMA 3JWMA 4OSGA 5HVEA 3TQBA 1TISA 3K2HA 4FGTA 3DAUA 1TVUA 1DLSA 3B5BA 1F4FA 3B9HA 4GEVA 1JMIA 4QLGA 1TDRA 1OHJA 4GYHA 4EJ1A 3QFXA 3FL8A 3QL3A 3FQOA 4KEBA 3FYWX 5H38A 3GG5A 1BZFA 1DDSA 4XSCA 3F0QX 1NJEA 1BO8A 3QYLA 4KL9A 4PSSA 1JUJA 3UM5A 3GH2X 3JSUA 1RA3A 2HM9A 1BDUA 1DLRA 3F0XX 2P4GA 2TDMA 3NXTA 2G89A 4TU5X 1KMVA 4Q6AA 3DL5A 4FHBA 5ECCA 3GHCA 1DR3A 1JOLA 1ZDRA 3ED7A 3FRBX 3QG2A 1TSVA 5JG0X 4XT8A 4LAHX 1BQ1A 3NXVA 4ELHA 1M7AA 3UWLA 1HZWA 1DR2A 4EILA 1CD2A 2AZNA 4ELBA 3QLYA 1HFRA 1J3KC 1BPJA 1DRHA 3IRMA 2CD2A 1EV8A 4KPWA 3OB7A 1DIUA 3ROAA 1TVWA 1AN5A 1TSYA 1F4DA 1DHIA 1VJ3A 1B5DA 2AAZA 5HS3A 3QLWA 3BZ0A 3DGAC 4H95A 1BIDA 1DREA 1RX4A 1THYA 3F8YA 3F8ZA 1CZ3A 1JOMA 3SAIA 1B49A 5HSRA 3TQAA 1AIQA 4DDRA 2C2SA 2G8XA 4KJLA 1IA1A 1S3WA 1LCBA 2ONBA 3D80A 3EEKA 1BSFA 1RA8A 4KM0A 4IXED 3EEJA 4XT4A 4P3RA 1BKOA 1IA4A 3KJSA 4LEKX 4PDJA 5HT5A 4F2VA 3IK1A 3N5GA 1DDRA 4H0RA 3JW3A 4P66A 3C0AA 4XT5A 3JWKA 4DQ1A 5HT4A 2BLBA 3EHIX 4GD7A 1AOEA 4JEFA 4XSDA 4G2OX 3EJLA 2D5NA 3NXYA 3KGYA 4LAGX 3JVXA 2W3AA 1MVSA 3EAWX 3FRAX 3SRQX 3FQFA 4QI9A 1U72A 1J3IA 3N0HA 1TSNA 1J3JC 3NRRA 4TMSA 5HQZA 1TSLA 1DYRA 4G95A 3IA5A 5FDAA 1NJDA 3IROA 1TLSA 1S3VA 3FQZA 1RA1A 1I00A 5HF2X 1DG7A 3TQ9A 1DF7A 1QZFA 1DR6A 4IXGX 3NXRA 3SRRX 3LG4A 5HI6A 1PDBA 4DPDA 3JWFA 2A9WA 3OCHA 3K74A 1PD8A 4FOGA 4IQBA 2XW7A 4M2XA 1TDAA 1TJSA 5BY6A 3QLXA 3NZCX 3SGYA 4FGGA 4M6KA 1OHKA 2G6VA 2W9GA 3IX9A 3TMSA 1VZEA 4KNZA 4KYAA 4XECX 1JTQA 3VCOA 3EF9A 2INQA 3JTWA 3BHLA 1RX6A 3N5EB 1TYSA 1TSDA 2W3WA 1IA3A 1U71A 4KFJA 4QLEA 1AI9A
chains in the Genus database with same CATH superfamily
4XT7A 3NXXA 4EZ8A 1YPVA 1RX7A 3IJZA 3GI2A 2RD8B 2FTNA 3FRDX 3FY8X 2HXVA 2B3ZA 2W3BA 1MVTA 4O1XA 1LCEA 4Q0DA 4LAEX 2FTOX 3V8HA 3FYVX 3NZBX 4M7VA 1DR1A 2W9TA 1BP0A 3UM8A 2G8DA 1EVFA 2KCEA 1VDRA 2QK8A 1BJGA 1HFPA 1KZJA 1SEJA 4M6JA 5HF0X 3EGYX 2G8AA 3KY8A 2FZHA 3SRWX 3TQ8A 4LRRA 5HUIA 4FOAA 4G3MA 4KJKA 2FZIA 2FTQA 3FQCA 3ZPCA 1BOZA 4HA7A 3QGTA 1IA2A 4KLXA 4M6LA 3EDWX 3E0BA 4E28A 3I3RA 3BFIA 2W9HA 3DL6A 5HPBA 1B02A 4Q0EA 3L3RA 2ZZAA 3SH2A 4XT6A 3DG8C 1DISA 1U70A 2DRCA 3Q1HA 1NJAA 3CLBA 2BL9A 4IRRA 3SA1A 3BNZA 3M09A 2OIPA 1DR5A 2VETA 3IK0A 1S3YA 1TSMA 1BKPA 3S7AA 1DHJA 1TLCA 1DYJA 4HOFA 1JUTA 2TSRA 4GH8A 3M08A 1JMFA 3UWLB 1AOBA 1DRAA 1RX3A 3NZAX 3F0SX 3K47A 1TSZA 3EELA 5DXVA 5HQYA 1DRFA 1RX2A 3IHIA 3EIGA 1S3UA 1RX9A 1RA2A 4HA9A 3S3VA 3NZ9X 1VZDA 1BP6A 1BQ2A 1LCAA 2VF0A 4FOXA 2ANQA 1ZPRA 3EEMA 1TDBA 4PSYA 2TDDA 1DAJA 1DNAA 5H3AA 1RB2A 3C06A 4HOGA 4O1XD 4X5IA 4FQSA 3GHWA 4O1UA 4IQQA 2FZJA 3FRFX 1NJCA 1JG0A 1KCEA 1DR7A 4ELGA 1F4CA 1J3KA 3SR5X 4PSTA 4PTHA 3ZPGA 3HB8A 1RE7A 3SRSX 4KBNA 4KAKA 3N5EA 2W3MA 3GHVA 5FCTA 1EV5A 3DGAA 1KMSA 3EX8A 3R33A 2RD8A 1DRBA 1VZCA 1AJMA 3CSEA 6DFRA 1AO8A 1RX8A 3QLRA 1PD9A 2O7PA 1EVGA 4XRBA 3BYXA 1LY4A 5U26A 4CD2A 1RD7A 2D0KA 2W3VA 3FREX 4QJZD 1M79A 4H97A 1TSXA 4QLFA 2BBQA 4E5OA 1RB3A 1RC4A 3FS6A 2CIGA 1JMGA 3SA2A 1B5EA 5H39A 1TVVA 1JUVA 4RGCA 1HFQA 1RF7A 5J7WA 3NU0A 4Q67A 2OBCA 4H96A 3QJ7A 4I13A 1RX5A 4ISKA 3KJRA 3UM6A 5ECXA 4UP1A 5HSUA 3SRUX 4H0UA 2C2TA 4KNEA 4X5JA 4FGHA 1JU6A 1TDCA 1J3JA 3GYFA 3NZDA 3QLSA 4NX6A 2LF1A 1NJBA 3NTZA 1RA9A 5E8QA 4XE6X 1JMHA 4NX7A 4OR7A 4P68A 3JWCA 4EINA 3DFRA 4ELEA 1J3IC 3DATA 3RO9A 4G8ZX 1TDUA 1DYHA 1DDUA 3NXOA 3OAFA 2HQPA 3D84X 1RTSA 2G86A 1QQQA 4KY4A 3INVA 3IX6A 3NZ6X 4X5FA 3KFYA 3S9UA 1YHOA 3HBBA 3JW5A 1BSPA 1E26A 3BGXA 4HOEA 3EBUA 4P3QA 3IA4A 1CI7A 2ITHA 4G6WX 1VZBA 3H9KA 1HW4A 4O7UA 4QJCA 4PTJA 3K45A 1BO7A 1DHFA 1DR4A 2BLCA 3TD8A 1LUDA 2TSCA 4M7UA 4EIGA 3CD2A 4X5GA 1M78A 1NCEA 4EB4A 7DFRA 3I8AX 1KZIA 4PSGA 1AXWA 3FY9X 3FL9A 1DYIA 1SYNA 2GD9A 4ELFA 3QLZA 2RDAA 1KLKA 3F91A 1F4EA 3QL0A 3KGBA 1HVYA 4X5HA 5U27A 1DG8A 4DP3A 1LY3A 4ECKA 3SQYX 1F4GA 3DRCA 3RG9A 3F0BX 4DPHA 4IXFX 2DHFA 1TRGA 1RG7A 1VZAA 3CL9A 3IRNA 1D1GA 2W9SA 3QYOA 4KY8A 2JYBA 4KD7A 3DG8A 3FQ0A 5EAJA 1HW3A 2ANOA 4H98A 3F0UX 2KGKA 4KM2A 1RX1A 5JA3A 1JTUA 5DFRA 1TSWA 4XSEA 4EIZA 1F28A 5CC9A 3HJ3A 2H2QA 5WRNA 3F0VX 4H1IA 3BHRA 4DFRA 3GH0A 3FQVA 4KJJA 4I1NA 4QHVA 1FFLA 1F4BA 8DFRA 1DG5A 4ISWA 2BLAA 1RH3A 5CCCA 5HVBA 2L28A 1FWMA 3JWMA 4OSGA 5HVEA 3TQBA 1TISA 3K2HA 4FGTA 3DAUA 1TVUA 1DLSA 3B5BA 1F4FA 3B9HA 4GEVA 1JMIA 4QLGA 1TDRA 1OHJA 4GYHA 4EJ1A 3QFXA 3FL8A 3QL3A 3FQOA 4KEBA 3FYWX 5H38A 3GG5A 1BZFA 1DDSA 4XSCA 3F0QX 1NJEA 1BO8A 3QYLA 4KL9A 4PSSA 1JUJA 3UM5A 3GH2X 3JSUA 1RA3A 2HM9A 1BDUA 1DLRA 3F0XX 2P4GA 2TDMA 3NXTA 2G89A 4TU5X 1KMVA 4Q6AA 3DL5A 4FHBA 5ECCA 3GHCA 1DR3A 1JOLA 1ZDRA 3ED7A 3FRBX 3QG2A 1TSVA 5JG0X 4XT8A 4LAHX 1BQ1A 3NXVA 4ELHA 1M7AA 3UWLA 1HZWA 1DR2A 4EILA 1CD2A 2AZNA 4ELBA 3QLYA 1HFRA 1J3KC 1BPJA 1DRHA 3IRMA 2CD2A 1EV8A 4KPWA 3OB7A 1DIUA 3ROAA 1TVWA 1AN5A 1TSYA 1F4DA 1DHIA 1VJ3A 1B5DA 2AAZA 5HS3A 3QLWA 3BZ0A 3DGAC 4H95A 1BIDA 1DREA 1RX4A 1THYA 3F8YA 3F8ZA 1CZ3A 1JOMA 3SAIA 1B49A 5HSRA 3TQAA 1AIQA 4DDRA 2C2SA 2G8XA 4KJLA 1IA1A 1S3WA 1LCBA 2ONBA 3D80A 3EEKA 1BSFA 1RA8A 4KM0A 4IXED 3EEJA 4XT4A 4P3RA 1BKOA 1IA4A 3KJSA 4LEKX 4PDJA 5HT5A 4F2VA 3IK1A 3N5GA 1DDRA 4H0RA 3JW3A 4P66A 3C0AA 4XT5A 3JWKA 4DQ1A 5HT4A 2BLBA 3EHIX 4GD7A 1AOEA 4JEFA 4XSDA 4G2OX 3EJLA 2D5NA 3NXYA 3KGYA 4LAGX 3JVXA 2W3AA 1MVSA 3EAWX 3FRAX 3SRQX 3FQFA 4QI9A 1U72A 1J3IA 3N0HA 1TSNA 1J3JC 3NRRA 4TMSA 5HQZA 1TSLA 1DYRA 4G95A 3IA5A 5FDAA 1NJDA 3IROA 1TLSA 1S3VA 3FQZA 1RA1A 1I00A 5HF2X 1DG7A 3TQ9A 1DF7A 1QZFA 1DR6A 4IXGX 3NXRA 3SRRX 3LG4A 5HI6A 1PDBA 4DPDA 3JWFA 2A9WA 3OCHA 3K74A 1PD8A 4FOGA 4IQBA 2XW7A 4M2XA 1TDAA 1TJSA 5BY6A 3QLXA 3NZCX 3SGYA 4FGGA 4M6KA 1OHKA 2G6VA 2W9GA 3IX9A 3TMSA 1VZEA 4KNZA 4KYAA 4XECX 1JTQA 3VCOA 3EF9A 2INQA 3JTWA 3BHLA 1RX6A 3N5EB 1TYSA 1TSDA 2W3WA 1IA3A 1U71A 4KFJA 4QLEA 1AI9A
chains in the Genus database with same CATH topology
4XT7A 3NXXA 4EZ8A 1YPVA 1RX7A 3IJZA 3GI2A 2RD8B 2FTNA 3FRDX 3FY8X 2HXVA 2B3ZA 2W3BA 1MVTA 4O1XA 1LCEA 4Q0DA 4LAEX 2FTOX 3V8HA 3FYVX 3NZBX 4M7VA 1DR1A 2W9TA 1BP0A 3UM8A 2G8DA 1EVFA 2KCEA 1VDRA 2QK8A 1BJGA 1HFPA 1KZJA 1SEJA 4M6JA 5HF0X 3EGYX 2G8AA 3KY8A 2FZHA 3SRWX 3TQ8A 4LRRA 5HUIA 4FOAA 4G3MA 4KJKA 2FZIA 2FTQA 3FQCA 3ZPCA 1BOZA 4HA7A 3QGTA 1IA2A 4KLXA 4M6LA 3EDWX 3E0BA 4E28A 3I3RA 3BFIA 2W9HA 3DL6A 5HPBA 1B02A 4Q0EA 3L3RA 2ZZAA 3SH2A 4XT6A 3DG8C 1DISA 1U70A 2DRCA 3Q1HA 1NJAA 3CLBA 2BL9A 4IRRA 3SA1A 3BNZA 3M09A 2OIPA 1DR5A 2VETA 3IK0A 1S3YA 1TSMA 1BKPA 3S7AA 1DHJA 1TLCA 1DYJA 4HOFA 1JUTA 2TSRA 4GH8A 3M08A 1JMFA 3UWLB 1AOBA 1DRAA 1RX3A 3NZAX 3F0SX 3K47A 1TSZA 3EELA 5DXVA 5HQYA 1DRFA 1RX2A 3IHIA 3EIGA 1S3UA 1RX9A 1RA2A 4HA9A 3S3VA 3NZ9X 1VZDA 1BP6A 1BQ2A 1LCAA 2VF0A 4FOXA 2ANQA 1ZPRA 3EEMA 1TDBA 4PSYA 2TDDA 1DAJA 1DNAA 5H3AA 1RB2A 3C06A 4HOGA 4O1XD 4X5IA 4FQSA 3GHWA 4O1UA 4IQQA 2FZJA 3FRFX 1NJCA 1JG0A 1KCEA 1DR7A 4ELGA 1F4CA 1J3KA 3SR5X 4PSTA 4PTHA 3ZPGA 3HB8A 1RE7A 3SRSX 4KBNA 4KAKA 3N5EA 2W3MA 3GHVA 5FCTA 1EV5A 3DGAA 1KMSA 3EX8A 3R33A 2RD8A 1DRBA 1VZCA 1AJMA 3CSEA 6DFRA 1AO8A 1RX8A 3QLRA 1PD9A 2O7PA 1EVGA 4XRBA 3BYXA 1LY4A 5U26A 4CD2A 1RD7A 2D0KA 2W3VA 3FREX 4QJZD 1M79A 4H97A 1TSXA 4QLFA 2BBQA 4E5OA 1RB3A 1RC4A 3FS6A 2CIGA 1JMGA 3SA2A 1B5EA 5H39A 1TVVA 1JUVA 4RGCA 1HFQA 1RF7A 5J7WA 3NU0A 4Q67A 2OBCA 4H96A 3QJ7A 4I13A 1RX5A 4ISKA 3KJRA 3UM6A 5ECXA 4UP1A 5HSUA 3SRUX 4H0UA 2C2TA 4KNEA 4X5JA 4FGHA 1JU6A 1TDCA 1J3JA 3GYFA 3NZDA 3QLSA 4NX6A 2LF1A 1NJBA 3NTZA 1RA9A 5E8QA 4XE6X 1JMHA 4NX7A 4OR7A 4P68A 3JWCA 4EINA 3DFRA 4ELEA 1J3IC 3DATA 3RO9A 4G8ZX 1TDUA 1DYHA 1DDUA 3NXOA 3OAFA 2HQPA 3D84X 1RTSA 2G86A 1QQQA 4KY4A 3INVA 3IX6A 3NZ6X 4X5FA 3KFYA 3S9UA 1YHOA 3HBBA 3JW5A 1BSPA 1E26A 3BGXA 4HOEA 3EBUA 4P3QA 3IA4A 1CI7A 2ITHA 4G6WX 1VZBA 3H9KA 1HW4A 4O7UA 4QJCA 4PTJA 3K45A 1BO7A 1DHFA 1DR4A 2BLCA 3TD8A 1LUDA 2TSCA 4M7UA 4EIGA 3CD2A 4X5GA 1M78A 1NCEA 4EB4A 7DFRA 3I8AX 1KZIA 4PSGA 1AXWA 3FY9X 3FL9A 1DYIA 1SYNA 2GD9A 4ELFA 3QLZA 2RDAA 1KLKA 3F91A 1F4EA 3QL0A 3KGBA 1HVYA 4X5HA 5U27A 1DG8A 4DP3A 1LY3A 4ECKA 3SQYX 1F4GA 3DRCA 3RG9A 3F0BX 4DPHA 4IXFX 2DHFA 1TRGA 1RG7A 1VZAA 3CL9A 3IRNA 1D1GA 2W9SA 3QYOA 4KY8A 2JYBA 4KD7A 3DG8A 3FQ0A 5EAJA 1HW3A 2ANOA 4H98A 3F0UX 2KGKA 4KM2A 1RX1A 5JA3A 1JTUA 5DFRA 1TSWA 4XSEA 4EIZA 1F28A 5CC9A 3HJ3A 2H2QA 5WRNA 3F0VX 4H1IA 3BHRA 4DFRA 3GH0A 3FQVA 4KJJA 4I1NA 4QHVA 1FFLA 1F4BA 8DFRA 1DG5A 4ISWA 2BLAA 1RH3A 5CCCA 5HVBA 2L28A 1FWMA 3JWMA 4OSGA 5HVEA 3TQBA 1TISA 3K2HA 4FGTA 3DAUA 1TVUA 1DLSA 3B5BA 1F4FA 3B9HA 4GEVA 1JMIA 4QLGA 1TDRA 1OHJA 4GYHA 4EJ1A 3QFXA 3FL8A 3QL3A 3FQOA 4KEBA 3FYWX 5H38A 3GG5A 1BZFA 1DDSA 4XSCA 3F0QX 1NJEA 1BO8A 3QYLA 4KL9A 4PSSA 1JUJA 3UM5A 3GH2X 3JSUA 1RA3A 2HM9A 1BDUA 1DLRA 3F0XX 2P4GA 2TDMA 3NXTA 2G89A 4TU5X 1KMVA 4Q6AA 3DL5A 4FHBA 5ECCA 3GHCA 1DR3A 1JOLA 1ZDRA 3ED7A 3FRBX 3QG2A 1TSVA 5JG0X 4XT8A 4LAHX 1BQ1A 3NXVA 4ELHA 1M7AA 3UWLA 1HZWA 1DR2A 4EILA 1CD2A 2AZNA 4ELBA 3QLYA 1HFRA 1J3KC 1BPJA 1DRHA 3IRMA 2CD2A 1EV8A 4KPWA 3OB7A 1DIUA 3ROAA 1TVWA 1AN5A 1TSYA 1F4DA 1DHIA 1VJ3A 1B5DA 2AAZA 5HS3A 3QLWA 3BZ0A 3DGAC 4H95A 1BIDA 1DREA 1RX4A 1THYA 3F8YA 3F8ZA 1CZ3A 1JOMA 3SAIA 1B49A 5HSRA 3TQAA 1AIQA 4DDRA 2C2SA 2G8XA 4KJLA 1IA1A 1S3WA 1LCBA 2ONBA 3D80A 3EEKA 1BSFA 1RA8A 4KM0A 4IXED 3EEJA 4XT4A 4P3RA 1BKOA 1IA4A 3KJSA 4LEKX 4PDJA 5HT5A 4F2VA 3IK1A 3N5GA 1DDRA 4H0RA 3JW3A 4P66A 3C0AA 4XT5A 3JWKA 4DQ1A 5HT4A 2BLBA 3EHIX 4GD7A 1AOEA 4JEFA 4XSDA 4G2OX 3EJLA 2D5NA 3NXYA 3KGYA 4LAGX 3JVXA 2W3AA 1MVSA 3EAWX 3FRAX 3SRQX 3FQFA 4QI9A 1U72A 1J3IA 3N0HA 1TSNA 1J3JC 3NRRA 4TMSA 5HQZA 1TSLA 1DYRA 4G95A 3IA5A 5FDAA 1NJDA 3IROA 1TLSA 1S3VA 3FQZA 1RA1A 1I00A 5HF2X 1DG7A 3TQ9A 1DF7A 1QZFA 1DR6A 4IXGX 3NXRA 3SRRX 3LG4A 5HI6A 1PDBA 4DPDA 3JWFA 2A9WA 3OCHA 3K74A 1PD8A 4FOGA 4IQBA 2XW7A 4M2XA 1TDAA 1TJSA 5BY6A 3QLXA 3NZCX 3SGYA 4FGGA 4M6KA 1OHKA 2G6VA 2W9GA 3IX9A 3TMSA 1VZEA 4KNZA 4KYAA 4XECX 1JTQA 3VCOA 3EF9A 2INQA 3JTWA 3BHLA 1RX6A 3N5EB 1TYSA 1TSDA 2W3WA 1IA3A 1U71A 4KFJA 4QLEA 1AI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT7 A;  3NXX A;  4EZ8 A;  1YPV A;  1RX7 A;  3IJZ A;  3GI2 A;  2RD8 B;  2FTN A;  3FRD X;  3FY8 X;  2HXV A;  2B3Z A;  2W3B A;  1MVT A;  4O1X A;  1LCE A;  4Q0D A;  4LAE X;  2FTO X;  3V8H A;  3FYV X;  3NZB X;  4M7V A;  1DR1 A;  2W9T A;  1BP0 A;  3UM8 A;  2G8D A;  1EVF A;  2KCE A;  1VDR A;  2QK8 A;  1BJG A;  1HFP A;  1KZJ A;  1SEJ A;  4M6J A;  5HF0 X;  3EGY X;  2G8A A;  3KY8 A;  2FZH A;  3SRW X;  3TQ8 A;  4LRR A;  5HUI A;  4FOA A;  4G3M A;  4KJK A;  2FZI A;  2FTQ A;  3FQC A;  3ZPC A;  1BOZ A;  4HA7 A;  3QGT A;  1IA2 A;  4KLX A;  4M6L A;  3EDW X;  3E0B A;  4E28 A;  3I3R A;  3BFI A;  2W9H A;  3DL6 A;  5HPB A;  1B02 A;  4Q0E A;  3L3R A;  2ZZA A;  3SH2 A;  4XT6 A;  3DG8 C;  1DIS A;  1U70 A;  2DRC A;  3Q1H A;  1NJA A;  3CLB A;  2BL9 A;  4IRR A;  3SA1 A;  3BNZ A;  3M09 A;  2OIP A;  1DR5 A;  2VET A;  3IK0 A;  1S3Y A;  1TSM A;  1BKP A;  3S7A A;  1DHJ A;  1TLC A;  1DYJ A;  4HOF A;  1JUT A;  2TSR A;  4GH8 A;  3M08 A;  1JMF A;  3UWL B;  1AOB A;  1DRA A;  1RX3 A;  3NZA X;  3F0S X;  3K47 A;  1TSZ A;  3EEL A;  5DXV A;  5HQY A;  1DRF A;  1RX2 A;  3IHI A;  3EIG A;  1S3U A;  1RX9 A;  1RA2 A;  4HA9 A;  3S3V A;  3NZ9 X;  1VZD A;  1BP6 A;  1BQ2 A;  1LCA A;  2VF0 A;  4FOX A;  2ANQ A;  1ZPR A;  3EEM A;  1TDB A;  4PSY A;  2TDD A;  1DAJ A;  1DNA A;  5H3A A;  1RB2 A;  3C06 A;  4HOG A;  4O1X D;  4X5I A;  4FQS A;  3GHW A;  4O1U A;  4IQQ A;  2FZJ A;  3FRF X;  1NJC A;  1JG0 A;  1KCE A;  1DR7 A;  4ELG A;  1F4C A;  1J3K A;  3SR5 X;  4PST A;  4PTH A;  3ZPG A;  3HB8 A;  1RE7 A;  3SRS X;  4KBN A;  4KAK A;  3N5E A;  2W3M A;  3GHV A;  5FCT A;  1EV5 A;  3DGA A;  1KMS A;  3EX8 A;  3R33 A;  2RD8 A;  1DRB A;  1VZC A;  1AJM A;  3CSE A;  6DFR A;  1AO8 A;  1RX8 A;  3QLR A;  1PD9 A;  2O7P A;  1EVG A;  4XRB A;  3BYX A;  1LY4 A;  5U26 A;  4CD2 A;  1RD7 A;  2D0K A;  2W3V A;  3FRE X;  4QJZ D;  1M79 A;  4H97 A;  1TSX A;  4QLF A;  2BBQ A;  4E5O A;  1RB3 A;  1RC4 A;  3FS6 A;  2CIG A;  1JMG A;  3SA2 A;  1B5E A;  5H39 A;  1TVV A;  1JUV A;  4RGC A;  1HFQ A;  1RF7 A;  5J7W A;  3NU0 A;  4Q67 A;  2OBC A;  4H96 A;  3QJ7 A;  4I13 A;  1RX5 A;  4ISK A;  3KJR A;  3UM6 A;  5ECX A;  4UP1 A;  5HSU A;  3SRU X;  4H0U A;  2C2T A;  4KNE A;  4X5J A;  4FGH A;  1JU6 A;  1TDC A;  1J3J A;  3GYF A;  3NZD A;  3QLS A;  4NX6 A;  2LF1 A;  1NJB A;  3NTZ A;  1RA9 A;  5E8Q A;  4XE6 X;  1JMH A;  4NX7 A;  4OR7 A;  4P68 A;  3JWC A;  4EIN A;  3DFR A;  4ELE A;  1J3I C;  3DAT A;  3RO9 A;  4G8Z X;  1TDU A;  1DYH A;  1DDU A;  3NXO A;  3OAF A;  2HQP A;  3D84 X;  1RTS A;  2G86 A;  1QQQ A;  4KY4 A;  3INV A;  3IX6 A;  3NZ6 X;  4X5F A;  3KFY A;  3S9U A;  1YHO A;  3HBB A;  3JW5 A;  1BSP A;  1E26 A;  3BGX A;  4HOE A;  3EBU A;  4P3Q A;  3IA4 A;  1CI7 A;  2ITH A;  4G6W X;  1VZB A;  3H9K A;  1HW4 A;  4O7U A;  4QJC A;  4PTJ A;  3K45 A;  1BO7 A;  1DHF A;  1DR4 A;  2BLC A;  3TD8 A;  1LUD A;  2TSC A;  4M7U A;  4EIG A;  3CD2 A;  4X5G A;  1M78 A;  1NCE A;  4EB4 A;  7DFR A;  3I8A X;  1KZI A;  4PSG A;  1AXW A;  3FY9 X;  3FL9 A;  1DYI A;  1SYN A;  2GD9 A;  4ELF A;  3QLZ A;  2RDA A;  1KLK A;  3F91 A;  1F4E A;  3QL0 A;  3KGB A;  1HVY A;  4X5H A;  5U27 A;  1DG8 A;  4DP3 A;  1LY3 A;  4ECK A;  3SQY X;  1F4G A;  3DRC A;  3RG9 A;  3F0B X;  4DPH A;  4IXF X;  2DHF A;  1TRG A;  1RG7 A;  1VZA A;  3CL9 A;  3IRN A;  1D1G A;  2W9S A;  3QYO A;  4KY8 A;  2JYB A;  4KD7 A;  3DG8 A;  3FQ0 A;  5EAJ A;  1HW3 A;  2ANO A;  4H98 A;  3F0U X;  2KGK A;  4KM2 A;  1RX1 A;  5JA3 A;  1JTU A;  5DFR A;  1TSW A;  4XSE A;  4EIZ A;  1F28 A;  5CC9 A;  3HJ3 A;  2H2Q A;  5WRN A;  3F0V X;  4H1I A;  3BHR A;  4DFR A;  3GH0 A;  3FQV A;  4KJJ A;  4I1N A;  4QHV A;  1FFL A;  1F4B A;  8DFR A;  1DG5 A;  4ISW A;  2BLA A;  1RH3 A;  5CCC A;  5HVB A;  2L28 A;  1FWM A;  3JWM A;  4OSG A;  5HVE A;  3TQB A;  1TIS A;  3K2H A;  4FGT A;  3DAU A;  1TVU A;  1DLS A;  3B5B A;  1F4F A;  3B9H A;  4GEV A;  1JMI A;  4QLG A;  1TDR A;  1OHJ A;  4GYH A;  4EJ1 A;  3QFX A;  3FL8 A;  3QL3 A;  3FQO A;  4KEB A;  3FYW X;  5H38 A;  3GG5 A;  1BZF A;  1DDS A;  4XSC A;  3F0Q X;  1NJE A;  1BO8 A;  3QYL A;  4KL9 A;  4PSS A;  1JUJ A;  3UM5 A;  3GH2 X;  3JSU A;  1RA3 A;  2HM9 A;  1BDU A;  1DLR A;  3F0X X;  2P4G A;  2TDM A;  3NXT A;  2G89 A;  4TU5 X;  1KMV A;  4Q6A A;  3DL5 A;  4FHB A;  5ECC A;  3GHC A;  1DR3 A;  1JOL A;  1ZDR A;  3ED7 A;  3FRB X;  3QG2 A;  1TSV A;  5JG0 X;  4XT8 A;  4LAH X;  1BQ1 A;  3NXV A;  4ELH A;  1M7A A;  3UWL A;  1HZW A;  1DR2 A;  4EIL A;  1CD2 A;  2AZN A;  4ELB A;  3QLY A;  1HFR A;  1J3K C;  1BPJ A;  1DRH A;  3IRM A;  2CD2 A;  1EV8 A;  4KPW A;  3OB7 A;  1DIU A;  3ROA A;  1TVW A;  1AN5 A;  1TSY A;  1F4D A;  1DHI A;  1VJ3 A;  1B5D A;  2AAZ A;  5HS3 A;  3QLW A;  3BZ0 A;  3DGA C;  4H95 A;  1BID A;  1DRE A;  1RX4 A;  1THY A;  3F8Y A;  3F8Z A;  1CZ3 A;  1JOM A;  3SAI A;  1B49 A;  5HSR A;  3TQA A;  1AIQ A;  4DDR A;  2C2S A;  2G8X A;  4KJL A;  1IA1 A;  1S3W A;  1LCB A;  2ONB A;  3D80 A;  3EEK A;  1BSF A;  1RA8 A;  4KM0 A;  4IXE D;  3EEJ A;  4XT4 A;  4P3R A;  1BKO A;  1IA4 A;  3KJS A;  4LEK X;  4PDJ A;  5HT5 A;  4F2V A;  3IK1 A;  3N5G A;  1DDR A;  4H0R A;  3JW3 A;  4P66 A;  3C0A A;  4XT5 A;  3JWK A;  4DQ1 A;  5HT4 A;  2BLB A;  3EHI X;  4GD7 A;  1AOE A;  4JEF A;  4XSD A;  4G2O X;  3EJL A;  2D5N A;  3NXY A;  3KGY A;  4LAG X;  3JVX A;  2W3A A;  1MVS A;  3EAW X;  3FRA X;  3SRQ X;  3FQF A;  4QI9 A;  1U72 A;  1J3I A;  3N0H A;  1TSN A;  1J3J C;  3NRR A;  4TMS A;  5HQZ A;  1TSL A;  1DYR A;  4G95 A;  3IA5 A;  5FDA A;  1NJD A;  3IRO A;  1TLS A;  1S3V A;  3FQZ A;  1RA1 A;  1I00 A;  5HF2 X;  1DG7 A;  3TQ9 A;  1DF7 A;  1QZF A;  1DR6 A;  4IXG X;  3NXR A;  3SRR X;  3LG4 A;  5HI6 A;  1PDB A;  4DPD A;  3JWF A;  2A9W A;  3OCH A;  3K74 A;  1PD8 A;  4FOG A;  4IQB A;  2XW7 A;  4M2X A;  1TDA A;  1TJS A;  5BY6 A;  3QLX A;  3NZC X;  3SGY A;  4FGG A;  4M6K A;  1OHK A;  2G6V A;  2W9G A;  3IX9 A;  3TMS A;  1VZE A;  4KNZ A;  4KYA A;  4XEC X;  1JTQ A;  3VCO A;  3EF9 A;  2INQ A;  3JTW A;  3BHL A;  1RX6 A;  3N5E B;  1TYS A;  1TSD A;  2W3W A;  1IA3 A;  1U71 A;  4KFJ A;  4QLE A;  1AI9 A; 
#chains in the Genus database with same CATH topology
 4XT7 A;  3NXX A;  4EZ8 A;  1YPV A;  1RX7 A;  3IJZ A;  3GI2 A;  2RD8 B;  2FTN A;  3FRD X;  3FY8 X;  2HXV A;  2B3Z A;  2W3B A;  1MVT A;  4O1X A;  1LCE A;  4Q0D A;  4LAE X;  2FTO X;  3V8H A;  3FYV X;  3NZB X;  4M7V A;  1DR1 A;  2W9T A;  1BP0 A;  3UM8 A;  2G8D A;  1EVF A;  2KCE A;  1VDR A;  2QK8 A;  1BJG A;  1HFP A;  1KZJ A;  1SEJ A;  4M6J A;  5HF0 X;  3EGY X;  2G8A A;  3KY8 A;  2FZH A;  3SRW X;  3TQ8 A;  4LRR A;  5HUI A;  4FOA A;  4G3M A;  4KJK A;  2FZI A;  2FTQ A;  3FQC A;  3ZPC A;  1BOZ A;  4HA7 A;  3QGT A;  1IA2 A;  4KLX A;  4M6L A;  3EDW X;  3E0B A;  4E28 A;  3I3R A;  3BFI A;  2W9H A;  3DL6 A;  5HPB A;  1B02 A;  4Q0E A;  3L3R A;  2ZZA A;  3SH2 A;  4XT6 A;  3DG8 C;  1DIS A;  1U70 A;  2DRC A;  3Q1H A;  1NJA A;  3CLB A;  2BL9 A;  4IRR A;  3SA1 A;  3BNZ A;  3M09 A;  2OIP A;  1DR5 A;  2VET A;  3IK0 A;  1S3Y A;  1TSM A;  1BKP A;  3S7A A;  1DHJ A;  1TLC A;  1DYJ A;  4HOF A;  1JUT A;  2TSR A;  4GH8 A;  3M08 A;  1JMF A;  3UWL B;  1AOB A;  1DRA A;  1RX3 A;  3NZA X;  3F0S X;  3K47 A;  1TSZ A;  3EEL A;  5DXV A;  5HQY A;  1DRF A;  1RX2 A;  3IHI A;  3EIG A;  1S3U A;  1RX9 A;  1RA2 A;  4HA9 A;  3S3V A;  3NZ9 X;  1VZD A;  1BP6 A;  1BQ2 A;  1LCA A;  2VF0 A;  4FOX A;  2ANQ A;  1ZPR A;  3EEM A;  1TDB A;  4PSY A;  2TDD A;  1DAJ A;  1DNA A;  5H3A A;  1RB2 A;  3C06 A;  4HOG A;  4O1X D;  4X5I A;  4FQS A;  3GHW A;  4O1U A;  4IQQ A;  2FZJ A;  3FRF X;  1NJC A;  1JG0 A;  1KCE A;  1DR7 A;  4ELG A;  1F4C A;  1J3K A;  3SR5 X;  4PST A;  4PTH A;  3ZPG A;  3HB8 A;  1RE7 A;  3SRS X;  4KBN A;  4KAK A;  3N5E A;  2W3M A;  3GHV A;  5FCT A;  1EV5 A;  3DGA A;  1KMS A;  3EX8 A;  3R33 A;  2RD8 A;  1DRB A;  1VZC A;  1AJM A;  3CSE A;  6DFR A;  1AO8 A;  1RX8 A;  3QLR A;  1PD9 A;  2O7P A;  1EVG A;  4XRB A;  3BYX A;  1LY4 A;  5U26 A;  4CD2 A;  1RD7 A;  2D0K A;  2W3V A;  3FRE X;  4QJZ D;  1M79 A;  4H97 A;  1TSX A;  4QLF A;  2BBQ A;  4E5O A;  1RB3 A;  1RC4 A;  3FS6 A;  2CIG A;  1JMG A;  3SA2 A;  1B5E A;  5H39 A;  1TVV A;  1JUV A;  4RGC A;  1HFQ A;  1RF7 A;  5J7W A;  3NU0 A;  4Q67 A;  2OBC A;  4H96 A;  3QJ7 A;  4I13 A;  1RX5 A;  4ISK A;  3KJR A;  3UM6 A;  5ECX A;  4UP1 A;  5HSU A;  3SRU X;  4H0U A;  2C2T A;  4KNE A;  4X5J A;  4FGH A;  1JU6 A;  1TDC A;  1J3J A;  3GYF A;  3NZD A;  3QLS A;  4NX6 A;  2LF1 A;  1NJB A;  3NTZ A;  1RA9 A;  5E8Q A;  4XE6 X;  1JMH A;  4NX7 A;  4OR7 A;  4P68 A;  3JWC A;  4EIN A;  3DFR A;  4ELE A;  1J3I C;  3DAT A;  3RO9 A;  4G8Z X;  1TDU A;  1DYH A;  1DDU A;  3NXO A;  3OAF A;  2HQP A;  3D84 X;  1RTS A;  2G86 A;  1QQQ A;  4KY4 A;  3INV A;  3IX6 A;  3NZ6 X;  4X5F A;  3KFY A;  3S9U A;  1YHO A;  3HBB A;  3JW5 A;  1BSP A;  1E26 A;  3BGX A;  4HOE A;  3EBU A;  4P3Q A;  3IA4 A;  1CI7 A;  2ITH A;  4G6W X;  1VZB A;  3H9K A;  1HW4 A;  4O7U A;  4QJC A;  4PTJ A;  3K45 A;  1BO7 A;  1DHF A;  1DR4 A;  2BLC A;  3TD8 A;  1LUD A;  2TSC A;  4M7U A;  4EIG A;  3CD2 A;  4X5G A;  1M78 A;  1NCE A;  4EB4 A;  7DFR A;  3I8A X;  1KZI A;  4PSG A;  1AXW A;  3FY9 X;  3FL9 A;  1DYI A;  1SYN A;  2GD9 A;  4ELF A;  3QLZ A;  2RDA A;  1KLK A;  3F91 A;  1F4E A;  3QL0 A;  3KGB A;  1HVY A;  4X5H A;  5U27 A;  1DG8 A;  4DP3 A;  1LY3 A;  4ECK A;  3SQY X;  1F4G A;  3DRC A;  3RG9 A;  3F0B X;  4DPH A;  4IXF X;  2DHF A;  1TRG A;  1RG7 A;  1VZA A;  3CL9 A;  3IRN A;  1D1G A;  2W9S A;  3QYO A;  4KY8 A;  2JYB A;  4KD7 A;  3DG8 A;  3FQ0 A;  5EAJ A;  1HW3 A;  2ANO A;  4H98 A;  3F0U X;  2KGK A;  4KM2 A;  1RX1 A;  5JA3 A;  1JTU A;  5DFR A;  1TSW A;  4XSE A;  4EIZ A;  1F28 A;  5CC9 A;  3HJ3 A;  2H2Q A;  5WRN A;  3F0V X;  4H1I A;  3BHR A;  4DFR A;  3GH0 A;  3FQV A;  4KJJ A;  4I1N A;  4QHV A;  1FFL A;  1F4B A;  8DFR A;  1DG5 A;  4ISW A;  2BLA A;  1RH3 A;  5CCC A;  5HVB A;  2L28 A;  1FWM A;  3JWM A;  4OSG A;  5HVE A;  3TQB A;  1TIS A;  3K2H A;  4FGT A;  3DAU A;  1TVU A;  1DLS A;  3B5B A;  1F4F A;  3B9H A;  4GEV A;  1JMI A;  4QLG A;  1TDR A;  1OHJ A;  4GYH A;  4EJ1 A;  3QFX A;  3FL8 A;  3QL3 A;  3FQO A;  4KEB A;  3FYW X;  5H38 A;  3GG5 A;  1BZF A;  1DDS A;  4XSC A;  3F0Q X;  1NJE A;  1BO8 A;  3QYL A;  4KL9 A;  4PSS A;  1JUJ A;  3UM5 A;  3GH2 X;  3JSU A;  1RA3 A;  2HM9 A;  1BDU A;  1DLR A;  3F0X X;  2P4G A;  2TDM A;  3NXT A;  2G89 A;  4TU5 X;  1KMV A;  4Q6A A;  3DL5 A;  4FHB A;  5ECC A;  3GHC A;  1DR3 A;  1JOL A;  1ZDR A;  3ED7 A;  3FRB X;  3QG2 A;  1TSV A;  5JG0 X;  4XT8 A;  4LAH X;  1BQ1 A;  3NXV A;  4ELH A;  1M7A A;  3UWL A;  1HZW A;  1DR2 A;  4EIL A;  1CD2 A;  2AZN A;  4ELB A;  3QLY A;  1HFR A;  1J3K C;  1BPJ A;  1DRH A;  3IRM A;  2CD2 A;  1EV8 A;  4KPW A;  3OB7 A;  1DIU A;  3ROA A;  1TVW A;  1AN5 A;  1TSY A;  1F4D A;  1DHI A;  1VJ3 A;  1B5D A;  2AAZ A;  5HS3 A;  3QLW A;  3BZ0 A;  3DGA C;  4H95 A;  1BID A;  1DRE A;  1RX4 A;  1THY A;  3F8Y A;  3F8Z A;  1CZ3 A;  1JOM A;  3SAI A;  1B49 A;  5HSR A;  3TQA A;  1AIQ A;  4DDR A;  2C2S A;  2G8X A;  4KJL A;  1IA1 A;  1S3W A;  1LCB A;  2ONB A;  3D80 A;  3EEK A;  1BSF A;  1RA8 A;  4KM0 A;  4IXE D;  3EEJ A;  4XT4 A;  4P3R A;  1BKO A;  1IA4 A;  3KJS A;  4LEK X;  4PDJ A;  5HT5 A;  4F2V A;  3IK1 A;  3N5G A;  1DDR A;  4H0R A;  3JW3 A;  4P66 A;  3C0A A;  4XT5 A;  3JWK A;  4DQ1 A;  5HT4 A;  2BLB A;  3EHI X;  4GD7 A;  1AOE A;  4JEF A;  4XSD A;  4G2O X;  3EJL A;  2D5N A;  3NXY A;  3KGY A;  4LAG X;  3JVX A;  2W3A A;  1MVS A;  3EAW X;  3FRA X;  3SRQ X;  3FQF A;  4QI9 A;  1U72 A;  1J3I A;  3N0H A;  1TSN A;  1J3J C;  3NRR A;  4TMS A;  5HQZ A;  1TSL A;  1DYR A;  4G95 A;  3IA5 A;  5FDA A;  1NJD A;  3IRO A;  1TLS A;  1S3V A;  3FQZ A;  1RA1 A;  1I00 A;  5HF2 X;  1DG7 A;  3TQ9 A;  1DF7 A;  1QZF A;  1DR6 A;  4IXG X;  3NXR A;  3SRR X;  3LG4 A;  5HI6 A;  1PDB A;  4DPD A;  3JWF A;  2A9W A;  3OCH A;  3K74 A;  1PD8 A;  4FOG A;  4IQB A;  2XW7 A;  4M2X A;  1TDA A;  1TJS A;  5BY6 A;  3QLX A;  3NZC X;  3SGY A;  4FGG A;  4M6K A;  1OHK A;  2G6V A;  2W9G A;  3IX9 A;  3TMS A;  1VZE A;  4KNZ A;  4KYA A;  4XEC X;  1JTQ A;  3VCO A;  3EF9 A;  2INQ A;  3JTW A;  3BHL A;  1RX6 A;  3N5E B;  1TYS A;  1TSD A;  2W3W A;  1IA3 A;  1U71 A;  4KFJ A;  4QLE A;  1AI9 A; 
#chains in the Genus database with same CATH homology
 4XT7 A;  3NXX A;  4EZ8 A;  1YPV A;  1RX7 A;  3IJZ A;  3GI2 A;  2RD8 B;  2FTN A;  3FRD X;  3FY8 X;  2HXV A;  2B3Z A;  2W3B A;  1MVT A;  4O1X A;  1LCE A;  4Q0D A;  4LAE X;  2FTO X;  3V8H A;  3FYV X;  3NZB X;  4M7V A;  1DR1 A;  2W9T A;  1BP0 A;  3UM8 A;  2G8D A;  1EVF A;  2KCE A;  1VDR A;  2QK8 A;  1BJG A;  1HFP A;  1KZJ A;  1SEJ A;  4M6J A;  5HF0 X;  3EGY X;  2G8A A;  3KY8 A;  2FZH A;  3SRW X;  3TQ8 A;  4LRR A;  5HUI A;  4FOA A;  4G3M A;  4KJK A;  2FZI A;  2FTQ A;  3FQC A;  3ZPC A;  1BOZ A;  4HA7 A;  3QGT A;  1IA2 A;  4KLX A;  4M6L A;  3EDW X;  3E0B A;  4E28 A;  3I3R A;  3BFI A;  2W9H A;  3DL6 A;  5HPB A;  1B02 A;  4Q0E A;  3L3R A;  2ZZA A;  3SH2 A;  4XT6 A;  3DG8 C;  1DIS A;  1U70 A;  2DRC A;  3Q1H A;  1NJA A;  3CLB A;  2BL9 A;  4IRR A;  3SA1 A;  3BNZ A;  3M09 A;  2OIP A;  1DR5 A;  2VET A;  3IK0 A;  1S3Y A;  1TSM A;  1BKP A;  3S7A A;  1DHJ A;  1TLC A;  1DYJ A;  4HOF A;  1JUT A;  2TSR A;  4GH8 A;  3M08 A;  1JMF A;  3UWL B;  1AOB A;  1DRA A;  1RX3 A;  3NZA X;  3F0S X;  3K47 A;  1TSZ A;  3EEL A;  5DXV A;  5HQY A;  1DRF A;  1RX2 A;  3IHI A;  3EIG A;  1S3U A;  1RX9 A;  1RA2 A;  4HA9 A;  3S3V A;  3NZ9 X;  1VZD A;  1BP6 A;  1BQ2 A;  1LCA A;  2VF0 A;  4FOX A;  2ANQ A;  1ZPR A;  3EEM A;  1TDB A;  4PSY A;  2TDD A;  1DAJ A;  1DNA A;  5H3A A;  1RB2 A;  3C06 A;  4HOG A;  4O1X D;  4X5I A;  4FQS A;  3GHW A;  4O1U A;  4IQQ A;  2FZJ A;  3FRF X;  1NJC A;  1JG0 A;  1KCE A;  1DR7 A;  4ELG A;  1F4C A;  1J3K A;  3SR5 X;  4PST A;  4PTH A;  3ZPG A;  3HB8 A;  1RE7 A;  3SRS X;  4KBN A;  4KAK A;  3N5E A;  2W3M A;  3GHV A;  5FCT A;  1EV5 A;  3DGA A;  1KMS A;  3EX8 A;  3R33 A;  2RD8 A;  1DRB A;  1VZC A;  1AJM A;  3CSE A;  6DFR A;  1AO8 A;  1RX8 A;  3QLR A;  1PD9 A;  2O7P A;  1EVG A;  4XRB A;  3BYX A;  1LY4 A;  5U26 A;  4CD2 A;  1RD7 A;  2D0K A;  2W3V A;  3FRE X;  4QJZ D;  1M79 A;  4H97 A;  1TSX A;  4QLF A;  2BBQ A;  4E5O A;  1RB3 A;  1RC4 A;  3FS6 A;  2CIG A;  1JMG A;  3SA2 A;  1B5E A;  5H39 A;  1TVV A;  1JUV A;  4RGC A;  1HFQ A;  1RF7 A;  5J7W A;  3NU0 A;  4Q67 A;  2OBC A;  4H96 A;  3QJ7 A;  4I13 A;  1RX5 A;  4ISK A;  3KJR A;  3UM6 A;  5ECX A;  4UP1 A;  5HSU A;  3SRU X;  4H0U A;  2C2T A;  4KNE A;  4X5J A;  4FGH A;  1JU6 A;  1TDC A;  1J3J A;  3GYF A;  3NZD A;  3QLS A;  4NX6 A;  2LF1 A;  1NJB A;  3NTZ A;  1RA9 A;  5E8Q A;  4XE6 X;  1JMH A;  4NX7 A;  4OR7 A;  4P68 A;  3JWC A;  4EIN A;  3DFR A;  4ELE A;  1J3I C;  3DAT A;  3RO9 A;  4G8Z X;  1TDU A;  1DYH A;  1DDU A;  3NXO A;  3OAF A;  2HQP A;  3D84 X;  1RTS A;  2G86 A;  1QQQ A;  4KY4 A;  3INV A;  3IX6 A;  3NZ6 X;  4X5F A;  3KFY A;  3S9U A;  1YHO A;  3HBB A;  3JW5 A;  1BSP A;  1E26 A;  3BGX A;  4HOE A;  3EBU A;  4P3Q A;  3IA4 A;  1CI7 A;  2ITH A;  4G6W X;  1VZB A;  3H9K A;  1HW4 A;  4O7U A;  4QJC A;  4PTJ A;  3K45 A;  1BO7 A;  1DHF A;  1DR4 A;  2BLC A;  3TD8 A;  1LUD A;  2TSC A;  4M7U A;  4EIG A;  3CD2 A;  4X5G A;  1M78 A;  1NCE A;  4EB4 A;  7DFR A;  3I8A X;  1KZI A;  4PSG A;  1AXW A;  3FY9 X;  3FL9 A;  1DYI A;  1SYN A;  2GD9 A;  4ELF A;  3QLZ A;  2RDA A;  1KLK A;  3F91 A;  1F4E A;  3QL0 A;  3KGB A;  1HVY A;  4X5H A;  5U27 A;  1DG8 A;  4DP3 A;  1LY3 A;  4ECK A;  3SQY X;  1F4G A;  3DRC A;  3RG9 A;  3F0B X;  4DPH A;  4IXF X;  2DHF A;  1TRG A;  1RG7 A;  1VZA A;  3CL9 A;  3IRN A;  1D1G A;  2W9S A;  3QYO A;  4KY8 A;  2JYB A;  4KD7 A;  3DG8 A;  3FQ0 A;  5EAJ A;  1HW3 A;  2ANO A;  4H98 A;  3F0U X;  2KGK A;  4KM2 A;  1RX1 A;  5JA3 A;  1JTU A;  5DFR A;  1TSW A;  4XSE A;  4EIZ A;  1F28 A;  5CC9 A;  3HJ3 A;  2H2Q A;  5WRN A;  3F0V X;  4H1I A;  3BHR A;  4DFR A;  3GH0 A;  3FQV A;  4KJJ A;  4I1N A;  4QHV A;  1FFL A;  1F4B A;  8DFR A;  1DG5 A;  4ISW A;  2BLA A;  1RH3 A;  5CCC A;  5HVB A;  2L28 A;  1FWM A;  3JWM A;  4OSG A;  5HVE A;  3TQB A;  1TIS A;  3K2H A;  4FGT A;  3DAU A;  1TVU A;  1DLS A;  3B5B A;  1F4F A;  3B9H A;  4GEV A;  1JMI A;  4QLG A;  1TDR A;  1OHJ A;  4GYH A;  4EJ1 A;  3QFX A;  3FL8 A;  3QL3 A;  3FQO A;  4KEB A;  3FYW X;  5H38 A;  3GG5 A;  1BZF A;  1DDS A;  4XSC A;  3F0Q X;  1NJE A;  1BO8 A;  3QYL A;  4KL9 A;  4PSS A;  1JUJ A;  3UM5 A;  3GH2 X;  3JSU A;  1RA3 A;  2HM9 A;  1BDU A;  1DLR A;  3F0X X;  2P4G A;  2TDM A;  3NXT A;  2G89 A;  4TU5 X;  1KMV A;  4Q6A A;  3DL5 A;  4FHB A;  5ECC A;  3GHC A;  1DR3 A;  1JOL A;  1ZDR A;  3ED7 A;  3FRB X;  3QG2 A;  1TSV A;  5JG0 X;  4XT8 A;  4LAH X;  1BQ1 A;  3NXV A;  4ELH A;  1M7A A;  3UWL A;  1HZW A;  1DR2 A;  4EIL A;  1CD2 A;  2AZN A;  4ELB A;  3QLY A;  1HFR A;  1J3K C;  1BPJ A;  1DRH A;  3IRM A;  2CD2 A;  1EV8 A;  4KPW A;  3OB7 A;  1DIU A;  3ROA A;  1TVW A;  1AN5 A;  1TSY A;  1F4D A;  1DHI A;  1VJ3 A;  1B5D A;  2AAZ A;  5HS3 A;  3QLW A;  3BZ0 A;  3DGA C;  4H95 A;  1BID A;  1DRE A;  1RX4 A;  1THY A;  3F8Y A;  3F8Z A;  1CZ3 A;  1JOM A;  3SAI A;  1B49 A;  5HSR A;  3TQA A;  1AIQ A;  4DDR A;  2C2S A;  2G8X A;  4KJL A;  1IA1 A;  1S3W A;  1LCB A;  2ONB A;  3D80 A;  3EEK A;  1BSF A;  1RA8 A;  4KM0 A;  4IXE D;  3EEJ A;  4XT4 A;  4P3R A;  1BKO A;  1IA4 A;  3KJS A;  4LEK X;  4PDJ A;  5HT5 A;  4F2V A;  3IK1 A;  3N5G A;  1DDR A;  4H0R A;  3JW3 A;  4P66 A;  3C0A A;  4XT5 A;  3JWK A;  4DQ1 A;  5HT4 A;  2BLB A;  3EHI X;  4GD7 A;  1AOE A;  4JEF A;  4XSD A;  4G2O X;  3EJL A;  2D5N A;  3NXY A;  3KGY A;  4LAG X;  3JVX A;  2W3A A;  1MVS A;  3EAW X;  3FRA X;  3SRQ X;  3FQF A;  4QI9 A;  1U72 A;  1J3I A;  3N0H A;  1TSN A;  1J3J C;  3NRR A;  4TMS A;  5HQZ A;  1TSL A;  1DYR A;  4G95 A;  3IA5 A;  5FDA A;  1NJD A;  3IRO A;  1TLS A;  1S3V A;  3FQZ A;  1RA1 A;  1I00 A;  5HF2 X;  1DG7 A;  3TQ9 A;  1DF7 A;  1QZF A;  1DR6 A;  4IXG X;  3NXR A;  3SRR X;  3LG4 A;  5HI6 A;  1PDB A;  4DPD A;  3JWF A;  2A9W A;  3OCH A;  3K74 A;  1PD8 A;  4FOG A;  4IQB A;  2XW7 A;  4M2X A;  1TDA A;  1TJS A;  5BY6 A;  3QLX A;  3NZC X;  3SGY A;  4FGG A;  4M6K A;  1OHK A;  2G6V A;  2W9G A;  3IX9 A;  3TMS A;  1VZE A;  4KNZ A;  4KYA A;  4XEC X;  1JTQ A;  3VCO A;  3EF9 A;  2INQ A;  3JTW A;  3BHL A;  1RX6 A;  3N5E B;  1TYS A;  1TSD A;  2W3W A;  1IA3 A;  1U71 A;  4KFJ A;  4QLE A;  1AI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...