4KY4A

Crystal structure of non-classical ts inhibitor 2 in complex with toxoplasma gondii ts-dhfr
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
608
structure length
489
Chain Sequence
KPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKVCASLPAALSLLEEEYKDSVDQIFVVGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKEATYRPIFISKTFSDNGVPYDFVVLEKRSSAAAIAPVLAWMDEKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, transferase
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
publication title Discovery of potent and selective inhibitors of Toxoplasma gondii thymidylate synthase for opportunistic infections.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 143
structure length 489
sequence length 608
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4ky4A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4ky4A01
2CD2A 1BJGA 1RE7A 2ITHA 4G8ZX 2O7PA 1DRAA 3EEMA 3QG2A 1JTUA 4ELEA 2HM9A 3JSUA 1NJBA 2BBQA 3EEJA 1TDAA 2C2TA 4XSEA 1AI9A 5ECXA 3NZCX 5DFRA 1BQ1A 1JMGA 4Q0DA 1TDCA 1U72A 1DNAA 2FZHA 1RX5A 1RX6A 2JYBA 5H39A 3QGTA 4EILA 1RB2A 2FTOX 1TSZA 1DR6A 1LY4A 3NXYA 3SRSX 1TSMA 3HB8A 3DRCA 3SH2A 1BSFA 3FQVA 2KGKA 4X5HA 3HJ3A 1DDUA 4P68A 3HBBA 3F8ZA 3C0AA 1RA9A 3NTZA 2HXVA 1DREA 3V8HA 2INQA 1M7AA 4Q6AA 4H1IA 2DRCA 4XT7A 1HVYA 4IQQA 3QLYA 5JG0X 3SA2A 1S3WA 2W3WA 3DFRA 4X5IA 1RX3A 1J3JA 1TISA 4KJJA 3N5GA 3CSEA 1F4BA 1VZCA 3LG4A 5EAJA 1QZFA 2ANQA 1TLSA 1DLRA 1TYSA 4M7UA 1PD8A 3N0HA 4FOGA 1JTQA 1JMIA 3VCOA 3GHCA 3I8AX 2FZIA 4EB4A 5BY6A 3IA5A 1QQQA 4OSGA 1HW4A 4QI9A 1AIQA 4X5JA 1BP6A 1TSDA 3RG9A 2G89A 2OBCA 3IX6A 4XSCA 3TQBA 1U71A 4Q67A 1TVVA 1U70A 4KJKA 4LAEX 1J3IC 4IRRA 3EHIX 3SQYX 1B02A 1DRFA 3BGXA 3CL9A 4ELFA 1KZIA 4G95A 4HOFA 2W9HA 8DFRA 3E0BA 3FQZA 4HOEA 4EINA 2FTNA 1BO7A 1F28A 4FQSA 3INVA 1DR5A 1RH3A 3IHIA 4H0UA 1DG7A 1RB3A 3ZPGA 1CI7A 4UP1A 3FQFA 1F4CA 1TSWA 1LUDA 2D0KA 2W9TA 4PSTA 1DR2A 4IXGX 2FZJA 1BIDA 4XT6A 4G3MA 5JA3A 3FQOA 3H9KA 1HFQA 3IRNA 3S7AA 4ELHA 1TVWA 4KNZA 4KY4A 1TSLA 3EX8A 4F2VA 1S3YA 2TDMA 5FCTA 3IROA 3GHVA 1SYNA 3TMSA 3F0SX 4X5FA 1RX9A 1DIUA 5H3AA 3FYVX 1IA3A 1KLKA 5HVEA 3IK1A 5H38A 2W3VA 4PTHA 1DAJA 3SRRX 1DRBA 1IA1A 2TSRA 3ROAA 4KJLA 1E26A 1JOMA 1YPVA 3K74A 1RD7A 4M2XA 1EV8A 1VDRA 3JWMA 4IXFX 2BLBA 1OHKA 4QLEA 3TQAA 1SEJA 4HA7A 1TSXA 4LRRA 2BLAA 1BO8A 1JMHA 1IA2A 1DDSA 2ANOA 3Q1HA 4NX7A 1BDUA 3S9UA 3QYLA 3FREX 4DPHA 2W9SA 4M6KA 3DG8A 2B3ZA 2FTQA 1LCBA 3QLRA 1DYRA 3NU0A 3EIGA 4KY8A 3EDWX 3KJRA 1RX2A 1BOZA 3RO9A 3EJLA 1LCAA 3JTWA 3ZPCA 1AXWA 3QLSA 1M79A 4KNEA 3TQ9A 4XT8A 6DFRA 4Q0EA 1VZAA 1HFPA 2C2SA 1F4EA 1RF7A 4DQ1A 2BL9A 3NXVA 4O1XA 1J3KC 4PSGA 3F8YA 3C06A 3F0XX 4KL9A 1PDBA 1TDUA 4H0RA 4LAGX 2RD8A 4GEVA 4FGTA 1RX7A 3GH2X 3S3VA 4I1NA 2G8AA 1B5EA 3UM5A 2VETA 2OIPA 1HFRA 4QHVA 2RD8B 5U27A 5HVBA 4ELGA 1F4GA 5E8QA 3FQ0A 4KAKA 4ELBA 1DHFA 5HUIA 1DLSA 1M78A 3GYFA 1BPJA 1TSVA 2G8XA 4KM2A 1BKOA 4XSDA 4FHBA 4FGHA 5HT5A 4P66A 1VZBA 1FWMA 3UM8A 1BKPA 1DR7A 2P4GA 2DHFA 1TJSA 3QJ7A 1BP0A 1FFLA 1TRGA 4H96A 1AJMA 1B5DA 1LCEA 2G86A 1JUJA 4FOAA 3D84X 3IX9A 3GHWA 1EVFA 3L3RA 4KBNA 1NJAA 3IRMA 3QFXA 3BHRA 3I3RA 3SA1A 3TQ8A 2L28A 3F0UX 5J7WA 1JUVA 3JWCA 4GH8A 5HPBA 4O1XD 3JVXA 4LAHX 1RA1A 3SGYA 4H98A 4X5GA 3IK0A 3NZBX 4IQBA 4XECX 1DYHA 1NCEA 1HZWA 1NJCA 4M7VA 3SRQX 4KFJA 1DR3A 4ISKA 4KYAA 3NZDA 1THYA 3GH0A 1DR4A 1J3IA 1OHJA 5HF0X 3KFYA 4PSYA 4G6WX 1DYIA 3K45A 4PTJA 3SRUX 2W9GA 4XE6X 3KJSA 3M09A 4DFRA 4XT4A 1JU6A 4KEBA 4P3QA 1ZPRA 4KM0A 1B49A 3DAUA 1DF7A 4FGGA 1RX4A 3UM6A 3F0VX 3M08A 1F4DA 4G2OX 4KLXA 1JG0A 1AOEA 3UWLA 3EGYX 2H2QA 1LY3A 4XRBA 4ECKA 1RC4A 4E5OA 3JW3A 5HQZA 1JOLA 4GYHA 3QLXA 3UWLB 2G8DA 3BZ0A 1MVSA 3NZ6X 4PDJA 3BHLA 3FY9X 1CD2A 3OCHA 1BZFA 4P3RA 4M6JA 3JW5A 3N5EA 2W3BA 2RDAA 3FS6A 5DXVA 3F0QX 1VZDA 3D80A 2ZZAA 2GD9A 5HF2X 1EVGA 3NRRA 1J3JC 2TSCA 3N5EB 1F4FA 3NXOA 3FRBX 4XT5A 4QJZD 3B9HA 1MVTA 4DPDA 3KY8A 3FYWX 3DL5A 4IXED 3FL9A 1KCEA 4H95A 3CD2A 2TDDA 5HI6A 2W3MA 3CLBA 3NZ9X 3FY8X 3DATA 3K2HA 4EIGA 1S3VA 4PSSA 3GG5A 5HS3A 1DHJA 7DFRA 1AN5A 4O1UA 1IA4A 1YHOA 1RA8A 3B5BA 3OB7A 2LF1A 3KGYA 1BSPA 4EJ1A 4ISWA 2XW7A 1RX8A 2HQPA 5ECCA 1DR1A 1DYJA 3QLZA 3KGBA 1AO8A 1VJ3A 5WRNA 1DHIA 1RX1A 1RG7A 3BYXA 4RGCA 3SR5X 4DDRA 4KPWA 3FL8A 3SRWX 3NXXA 3IA4A 1KMVA 1DDRA 1D1GA 5CCCA 4TMSA 1JUTA 3DL6A 3QL0A 3BNZA 3JWFA 3JWKA 2ONBA 4GD7A 1J3KA 1I00A 3FRFX 2BLCA 1HW3A 1KZJA 4QJCA 1RA2A 2VF0A 3BFIA 5HT4A 1VZEA 3FRAX 4NX6A 4TU5X 5FDAA 4H97A 3EF9A 4DP3A 1TSNA 3EEKA 1DG5A 1S3UA 1CZ3A 2AAZA 4HA9A 3K47A 2D5NA 3NXRA 2W3AA 3GI2A 1ZDRA 3SAIA 1TDBA 4CD2A 1NJEA 1TVUA 3ED7A 3FRDX 2AZNA 4FOXA 1EV5A 3DGAC 1RA3A 5HQYA 1DISA 3FQCA 5CC9A 3QL3A 3QYOA 1AOBA 3OAFA 4KD7A 5U26A 2A9WA 3NZAX 4QLFA 3IJZA 4HOGA 3EBUA 1RTSA 4EIZA 1TSYA 2KCEA 1TDRA 3EELA 1TLCA 3TD8A 4JEFA 3F91A 1DG8A 3EAWX 3NXTA 4M6LA 3F0BX 1DRHA 4QLGA 4OR7A 1JMFA 1PD9A 1NJDA 3QLWA 5HSRA 3R33A 5HSUA 1BQ2A 4I13A 4EZ8A 2G6VA 1KMSA 3DG8C 4LEKX 4E28A 4O7UA 3DGAA 2QK8A 2CIGA
chains in the Genus database with same CATH superfamily
2CD2A 1BJGA 1RE7A 2ITHA 4G8ZX 2O7PA 1DRAA 3EEMA 3QG2A 1JTUA 4ELEA 2HM9A 3JSUA 1NJBA 2BBQA 3EEJA 1TDAA 2C2TA 4XSEA 1AI9A 5ECXA 3NZCX 5DFRA 1BQ1A 1JMGA 4Q0DA 1TDCA 1U72A 1DNAA 2FZHA 1RX5A 1RX6A 2JYBA 5H39A 3QGTA 4EILA 1RB2A 2FTOX 1TSZA 1DR6A 1LY4A 3NXYA 3SRSX 1TSMA 3HB8A 3DRCA 3SH2A 1BSFA 3FQVA 2KGKA 4X5HA 3HJ3A 1DDUA 4P68A 3HBBA 3F8ZA 3C0AA 1RA9A 3NTZA 2HXVA 1DREA 3V8HA 2INQA 1M7AA 4Q6AA 4H1IA 2DRCA 4XT7A 1HVYA 4IQQA 3QLYA 5JG0X 3SA2A 1S3WA 2W3WA 3DFRA 4X5IA 1RX3A 1J3JA 1TISA 4KJJA 3N5GA 3CSEA 1F4BA 1VZCA 3LG4A 5EAJA 1QZFA 2ANQA 1TLSA 1DLRA 1TYSA 4M7UA 1PD8A 3N0HA 4FOGA 1JTQA 1JMIA 3VCOA 3GHCA 3I8AX 2FZIA 4EB4A 5BY6A 3IA5A 1QQQA 4OSGA 1HW4A 4QI9A 1AIQA 4X5JA 1BP6A 1TSDA 3RG9A 2G89A 2OBCA 3IX6A 4XSCA 3TQBA 1U71A 4Q67A 1TVVA 1U70A 4KJKA 4LAEX 1J3IC 4IRRA 3EHIX 3SQYX 1B02A 1DRFA 3BGXA 3CL9A 4ELFA 1KZIA 4G95A 4HOFA 2W9HA 8DFRA 3E0BA 3FQZA 4HOEA 4EINA 2FTNA 1BO7A 1F28A 4FQSA 3INVA 1DR5A 1RH3A 3IHIA 4H0UA 1DG7A 1RB3A 3ZPGA 1CI7A 4UP1A 3FQFA 1F4CA 1TSWA 1LUDA 2D0KA 2W9TA 4PSTA 1DR2A 4IXGX 2FZJA 1BIDA 4XT6A 4G3MA 5JA3A 3FQOA 3H9KA 1HFQA 3IRNA 3S7AA 4ELHA 1TVWA 4KNZA 4KY4A 1TSLA 3EX8A 4F2VA 1S3YA 2TDMA 5FCTA 3IROA 3GHVA 1SYNA 3TMSA 3F0SX 4X5FA 1RX9A 1DIUA 5H3AA 3FYVX 1IA3A 1KLKA 5HVEA 3IK1A 5H38A 2W3VA 4PTHA 1DAJA 3SRRX 1DRBA 1IA1A 2TSRA 3ROAA 4KJLA 1E26A 1JOMA 1YPVA 3K74A 1RD7A 4M2XA 1EV8A 1VDRA 3JWMA 4IXFX 2BLBA 1OHKA 4QLEA 3TQAA 1SEJA 4HA7A 1TSXA 4LRRA 2BLAA 1BO8A 1JMHA 1IA2A 1DDSA 2ANOA 3Q1HA 4NX7A 1BDUA 3S9UA 3QYLA 3FREX 4DPHA 2W9SA 4M6KA 3DG8A 2B3ZA 2FTQA 1LCBA 3QLRA 1DYRA 3NU0A 3EIGA 4KY8A 3EDWX 3KJRA 1RX2A 1BOZA 3RO9A 3EJLA 1LCAA 3JTWA 3ZPCA 1AXWA 3QLSA 1M79A 4KNEA 3TQ9A 4XT8A 6DFRA 4Q0EA 1VZAA 1HFPA 2C2SA 1F4EA 1RF7A 4DQ1A 2BL9A 3NXVA 4O1XA 1J3KC 4PSGA 3F8YA 3C06A 3F0XX 4KL9A 1PDBA 1TDUA 4H0RA 4LAGX 2RD8A 4GEVA 4FGTA 1RX7A 3GH2X 3S3VA 4I1NA 2G8AA 1B5EA 3UM5A 2VETA 2OIPA 1HFRA 4QHVA 2RD8B 5U27A 5HVBA 4ELGA 1F4GA 5E8QA 3FQ0A 4KAKA 4ELBA 1DHFA 5HUIA 1DLSA 1M78A 3GYFA 1BPJA 1TSVA 2G8XA 4KM2A 1BKOA 4XSDA 4FHBA 4FGHA 5HT5A 4P66A 1VZBA 1FWMA 3UM8A 1BKPA 1DR7A 2P4GA 2DHFA 1TJSA 3QJ7A 1BP0A 1FFLA 1TRGA 4H96A 1AJMA 1B5DA 1LCEA 2G86A 1JUJA 4FOAA 3D84X 3IX9A 3GHWA 1EVFA 3L3RA 4KBNA 1NJAA 3IRMA 3QFXA 3BHRA 3I3RA 3SA1A 3TQ8A 2L28A 3F0UX 5J7WA 1JUVA 3JWCA 4GH8A 5HPBA 4O1XD 3JVXA 4LAHX 1RA1A 3SGYA 4H98A 4X5GA 3IK0A 3NZBX 4IQBA 4XECX 1DYHA 1NCEA 1HZWA 1NJCA 4M7VA 3SRQX 4KFJA 1DR3A 4ISKA 4KYAA 3NZDA 1THYA 3GH0A 1DR4A 1J3IA 1OHJA 5HF0X 3KFYA 4PSYA 4G6WX 1DYIA 3K45A 4PTJA 3SRUX 2W9GA 4XE6X 3KJSA 3M09A 4DFRA 4XT4A 1JU6A 4KEBA 4P3QA 1ZPRA 4KM0A 1B49A 3DAUA 1DF7A 4FGGA 1RX4A 3UM6A 3F0VX 3M08A 1F4DA 4G2OX 4KLXA 1JG0A 1AOEA 3UWLA 3EGYX 2H2QA 1LY3A 4XRBA 4ECKA 1RC4A 4E5OA 3JW3A 5HQZA 1JOLA 4GYHA 3QLXA 3UWLB 2G8DA 3BZ0A 1MVSA 3NZ6X 4PDJA 3BHLA 3FY9X 1CD2A 3OCHA 1BZFA 4P3RA 4M6JA 3JW5A 3N5EA 2W3BA 2RDAA 3FS6A 5DXVA 3F0QX 1VZDA 3D80A 2ZZAA 2GD9A 5HF2X 1EVGA 3NRRA 1J3JC 2TSCA 3N5EB 1F4FA 3NXOA 3FRBX 4XT5A 4QJZD 3B9HA 1MVTA 4DPDA 3KY8A 3FYWX 3DL5A 4IXED 3FL9A 1KCEA 4H95A 3CD2A 2TDDA 5HI6A 2W3MA 3CLBA 3NZ9X 3FY8X 3DATA 3K2HA 4EIGA 1S3VA 4PSSA 3GG5A 5HS3A 1DHJA 7DFRA 1AN5A 4O1UA 1IA4A 1YHOA 1RA8A 3B5BA 3OB7A 2LF1A 3KGYA 1BSPA 4EJ1A 4ISWA 2XW7A 1RX8A 2HQPA 5ECCA 1DR1A 1DYJA 3QLZA 3KGBA 1AO8A 1VJ3A 5WRNA 1DHIA 1RX1A 1RG7A 3BYXA 4RGCA 3SR5X 4DDRA 4KPWA 3FL8A 3SRWX 3NXXA 3IA4A 1KMVA 1DDRA 1D1GA 5CCCA 4TMSA 1JUTA 3DL6A 3QL0A 3BNZA 3JWFA 3JWKA 2ONBA 4GD7A 1J3KA 1I00A 3FRFX 2BLCA 1HW3A 1KZJA 4QJCA 1RA2A 2VF0A 3BFIA 5HT4A 1VZEA 3FRAX 4NX6A 4TU5X 5FDAA 4H97A 3EF9A 4DP3A 1TSNA 3EEKA 1DG5A 1S3UA 1CZ3A 2AAZA 4HA9A 3K47A 2D5NA 3NXRA 2W3AA 3GI2A 1ZDRA 3SAIA 1TDBA 4CD2A 1NJEA 1TVUA 3ED7A 3FRDX 2AZNA 4FOXA 1EV5A 3DGAC 1RA3A 5HQYA 1DISA 3FQCA 5CC9A 3QL3A 3QYOA 1AOBA 3OAFA 4KD7A 5U26A 2A9WA 3NZAX 4QLFA 3IJZA 4HOGA 3EBUA 1RTSA 4EIZA 1TSYA 2KCEA 1TDRA 3EELA 1TLCA 3TD8A 4JEFA 3F91A 1DG8A 3EAWX 3NXTA 4M6LA 3F0BX 1DRHA 4QLGA 4OR7A 1JMFA 1PD9A 1NJDA 3QLWA 5HSRA 3R33A 5HSUA 1BQ2A 4I13A 4EZ8A 2G6VA 1KMSA 3DG8C 4LEKX 4E28A 4O7UA 3DGAA 2QK8A 2CIGA
chains in the Genus database with same CATH topology
2CD2A 1BJGA 1RE7A 2ITHA 4G8ZX 2O7PA 1DRAA 3EEMA 3QG2A 1JTUA 4ELEA 2HM9A 3JSUA 1NJBA 2BBQA 3EEJA 1TDAA 2C2TA 4XSEA 1AI9A 5ECXA 3NZCX 5DFRA 1BQ1A 1JMGA 4Q0DA 1TDCA 1U72A 1DNAA 2FZHA 1RX5A 1RX6A 2JYBA 5H39A 3QGTA 4EILA 1RB2A 2FTOX 1TSZA 1DR6A 1LY4A 3NXYA 3SRSX 1TSMA 3HB8A 3DRCA 3SH2A 1BSFA 3FQVA 2KGKA 4X5HA 3HJ3A 1DDUA 4P68A 3HBBA 3F8ZA 3C0AA 1RA9A 3NTZA 2HXVA 1DREA 3V8HA 2INQA 1M7AA 4Q6AA 4H1IA 2DRCA 4XT7A 1HVYA 4IQQA 3QLYA 5JG0X 3SA2A 1S3WA 2W3WA 3DFRA 4X5IA 1RX3A 1J3JA 1TISA 4KJJA 3N5GA 3CSEA 1F4BA 1VZCA 3LG4A 5EAJA 1QZFA 2ANQA 1TLSA 1DLRA 1TYSA 4M7UA 1PD8A 3N0HA 4FOGA 1JTQA 1JMIA 3VCOA 3GHCA 3I8AX 2FZIA 4EB4A 5BY6A 3IA5A 1QQQA 4OSGA 1HW4A 4QI9A 1AIQA 4X5JA 1BP6A 1TSDA 3RG9A 2G89A 2OBCA 3IX6A 4XSCA 3TQBA 1U71A 4Q67A 1TVVA 1U70A 4KJKA 4LAEX 1J3IC 4IRRA 3EHIX 3SQYX 1B02A 1DRFA 3BGXA 3CL9A 4ELFA 1KZIA 4G95A 4HOFA 2W9HA 8DFRA 3E0BA 3FQZA 4HOEA 4EINA 2FTNA 1BO7A 1F28A 4FQSA 3INVA 1DR5A 1RH3A 3IHIA 4H0UA 1DG7A 1RB3A 3ZPGA 1CI7A 4UP1A 3FQFA 1F4CA 1TSWA 1LUDA 2D0KA 2W9TA 4PSTA 1DR2A 4IXGX 2FZJA 1BIDA 4XT6A 4G3MA 5JA3A 3FQOA 3H9KA 1HFQA 3IRNA 3S7AA 4ELHA 1TVWA 4KNZA 4KY4A 1TSLA 3EX8A 4F2VA 1S3YA 2TDMA 5FCTA 3IROA 3GHVA 1SYNA 3TMSA 3F0SX 4X5FA 1RX9A 1DIUA 5H3AA 3FYVX 1IA3A 1KLKA 5HVEA 3IK1A 5H38A 2W3VA 4PTHA 1DAJA 3SRRX 1DRBA 1IA1A 2TSRA 3ROAA 4KJLA 1E26A 1JOMA 1YPVA 3K74A 1RD7A 4M2XA 1EV8A 1VDRA 3JWMA 4IXFX 2BLBA 1OHKA 4QLEA 3TQAA 1SEJA 4HA7A 1TSXA 4LRRA 2BLAA 1BO8A 1JMHA 1IA2A 1DDSA 2ANOA 3Q1HA 4NX7A 1BDUA 3S9UA 3QYLA 3FREX 4DPHA 2W9SA 4M6KA 3DG8A 2B3ZA 2FTQA 1LCBA 3QLRA 1DYRA 3NU0A 3EIGA 4KY8A 3EDWX 3KJRA 1RX2A 1BOZA 3RO9A 3EJLA 1LCAA 3JTWA 3ZPCA 1AXWA 3QLSA 1M79A 4KNEA 3TQ9A 4XT8A 6DFRA 4Q0EA 1VZAA 1HFPA 2C2SA 1F4EA 1RF7A 4DQ1A 2BL9A 3NXVA 4O1XA 1J3KC 4PSGA 3F8YA 3C06A 3F0XX 4KL9A 1PDBA 1TDUA 4H0RA 4LAGX 2RD8A 4GEVA 4FGTA 1RX7A 3GH2X 3S3VA 4I1NA 2G8AA 1B5EA 3UM5A 2VETA 2OIPA 1HFRA 4QHVA 2RD8B 5U27A 5HVBA 4ELGA 1F4GA 5E8QA 3FQ0A 4KAKA 4ELBA 1DHFA 5HUIA 1DLSA 1M78A 3GYFA 1BPJA 1TSVA 2G8XA 4KM2A 1BKOA 4XSDA 4FHBA 4FGHA 5HT5A 4P66A 1VZBA 1FWMA 3UM8A 1BKPA 1DR7A 2P4GA 2DHFA 1TJSA 3QJ7A 1BP0A 1FFLA 1TRGA 4H96A 1AJMA 1B5DA 1LCEA 2G86A 1JUJA 4FOAA 3D84X 3IX9A 3GHWA 1EVFA 3L3RA 4KBNA 1NJAA 3IRMA 3QFXA 3BHRA 3I3RA 3SA1A 3TQ8A 2L28A 3F0UX 5J7WA 1JUVA 3JWCA 4GH8A 5HPBA 4O1XD 3JVXA 4LAHX 1RA1A 3SGYA 4H98A 4X5GA 3IK0A 3NZBX 4IQBA 4XECX 1DYHA 1NCEA 1HZWA 1NJCA 4M7VA 3SRQX 4KFJA 1DR3A 4ISKA 4KYAA 3NZDA 1THYA 3GH0A 1DR4A 1J3IA 1OHJA 5HF0X 3KFYA 4PSYA 4G6WX 1DYIA 3K45A 4PTJA 3SRUX 2W9GA 4XE6X 3KJSA 3M09A 4DFRA 4XT4A 1JU6A 4KEBA 4P3QA 1ZPRA 4KM0A 1B49A 3DAUA 1DF7A 4FGGA 1RX4A 3UM6A 3F0VX 3M08A 1F4DA 4G2OX 4KLXA 1JG0A 1AOEA 3UWLA 3EGYX 2H2QA 1LY3A 4XRBA 4ECKA 1RC4A 4E5OA 3JW3A 5HQZA 1JOLA 4GYHA 3QLXA 3UWLB 2G8DA 3BZ0A 1MVSA 3NZ6X 4PDJA 3BHLA 3FY9X 1CD2A 3OCHA 1BZFA 4P3RA 4M6JA 3JW5A 3N5EA 2W3BA 2RDAA 3FS6A 5DXVA 3F0QX 1VZDA 3D80A 2ZZAA 2GD9A 5HF2X 1EVGA 3NRRA 1J3JC 2TSCA 3N5EB 1F4FA 3NXOA 3FRBX 4XT5A 4QJZD 3B9HA 1MVTA 4DPDA 3KY8A 3FYWX 3DL5A 4IXED 3FL9A 1KCEA 4H95A 3CD2A 2TDDA 5HI6A 2W3MA 3CLBA 3NZ9X 3FY8X 3DATA 3K2HA 4EIGA 1S3VA 4PSSA 3GG5A 5HS3A 1DHJA 7DFRA 1AN5A 4O1UA 1IA4A 1YHOA 1RA8A 3B5BA 3OB7A 2LF1A 3KGYA 1BSPA 4EJ1A 4ISWA 2XW7A 1RX8A 2HQPA 5ECCA 1DR1A 1DYJA 3QLZA 3KGBA 1AO8A 1VJ3A 5WRNA 1DHIA 1RX1A 1RG7A 3BYXA 4RGCA 3SR5X 4DDRA 4KPWA 3FL8A 3SRWX 3NXXA 3IA4A 1KMVA 1DDRA 1D1GA 5CCCA 4TMSA 1JUTA 3DL6A 3QL0A 3BNZA 3JWFA 3JWKA 2ONBA 4GD7A 1J3KA 1I00A 3FRFX 2BLCA 1HW3A 1KZJA 4QJCA 1RA2A 2VF0A 3BFIA 5HT4A 1VZEA 3FRAX 4NX6A 4TU5X 5FDAA 4H97A 3EF9A 4DP3A 1TSNA 3EEKA 1DG5A 1S3UA 1CZ3A 2AAZA 4HA9A 3K47A 2D5NA 3NXRA 2W3AA 3GI2A 1ZDRA 3SAIA 1TDBA 4CD2A 1NJEA 1TVUA 3ED7A 3FRDX 2AZNA 4FOXA 1EV5A 3DGAC 1RA3A 5HQYA 1DISA 3FQCA 5CC9A 3QL3A 3QYOA 1AOBA 3OAFA 4KD7A 5U26A 2A9WA 3NZAX 4QLFA 3IJZA 4HOGA 3EBUA 1RTSA 4EIZA 1TSYA 2KCEA 1TDRA 3EELA 1TLCA 3TD8A 4JEFA 3F91A 1DG8A 3EAWX 3NXTA 4M6LA 3F0BX 1DRHA 4QLGA 4OR7A 1JMFA 1PD9A 1NJDA 3QLWA 5HSRA 3R33A 5HSUA 1BQ2A 4I13A 4EZ8A 2G6VA 1KMSA 3DG8C 4LEKX 4E28A 4O7UA 3DGAA 2QK8A 2CIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CD2 A;  1BJG A;  1RE7 A;  2ITH A;  4G8Z X;  2O7P A;  1DRA A;  3EEM A;  3QG2 A;  1JTU A;  4ELE A;  2HM9 A;  3JSU A;  1NJB A;  2BBQ A;  3EEJ A;  1TDA A;  2C2T A;  4XSE A;  1AI9 A;  5ECX A;  3NZC X;  5DFR A;  1BQ1 A;  1JMG A;  4Q0D A;  1TDC A;  1U72 A;  1DNA A;  2FZH A;  1RX5 A;  1RX6 A;  2JYB A;  5H39 A;  3QGT A;  4EIL A;  1RB2 A;  2FTO X;  1TSZ A;  1DR6 A;  1LY4 A;  3NXY A;  3SRS X;  1TSM A;  3HB8 A;  3DRC A;  3SH2 A;  1BSF A;  3FQV A;  2KGK A;  4X5H A;  3HJ3 A;  1DDU A;  4P68 A;  3HBB A;  3F8Z A;  3C0A A;  1RA9 A;  3NTZ A;  2HXV A;  1DRE A;  3V8H A;  2INQ A;  1M7A A;  4Q6A A;  4H1I A;  2DRC A;  4XT7 A;  1HVY A;  4IQQ A;  3QLY A;  5JG0 X;  3SA2 A;  1S3W A;  2W3W A;  3DFR A;  4X5I A;  1RX3 A;  1J3J A;  1TIS A;  4KJJ A;  3N5G A;  3CSE A;  1F4B A;  1VZC A;  3LG4 A;  5EAJ A;  1QZF A;  2ANQ A;  1TLS A;  1DLR A;  1TYS A;  4M7U A;  1PD8 A;  3N0H A;  4FOG A;  1JTQ A;  1JMI A;  3VCO A;  3GHC A;  3I8A X;  2FZI A;  4EB4 A;  5BY6 A;  3IA5 A;  1QQQ A;  4OSG A;  1HW4 A;  4QI9 A;  1AIQ A;  4X5J A;  1BP6 A;  1TSD A;  3RG9 A;  2G89 A;  2OBC A;  3IX6 A;  4XSC A;  3TQB A;  1U71 A;  4Q67 A;  1TVV A;  1U70 A;  4KJK A;  4LAE X;  1J3I C;  4IRR A;  3EHI X;  3SQY X;  1B02 A;  1DRF A;  3BGX A;  3CL9 A;  4ELF A;  1KZI A;  4G95 A;  4HOF A;  2W9H A;  8DFR A;  3E0B A;  3FQZ A;  4HOE A;  4EIN A;  2FTN A;  1BO7 A;  1F28 A;  4FQS A;  3INV A;  1DR5 A;  1RH3 A;  3IHI A;  4H0U A;  1DG7 A;  1RB3 A;  3ZPG A;  1CI7 A;  4UP1 A;  3FQF A;  1F4C A;  1TSW A;  1LUD A;  2D0K A;  2W9T A;  4PST A;  1DR2 A;  4IXG X;  2FZJ A;  1BID A;  4XT6 A;  4G3M A;  5JA3 A;  3FQO A;  3H9K A;  1HFQ A;  3IRN A;  3S7A A;  4ELH A;  1TVW A;  4KNZ A;  4KY4 A;  1TSL A;  3EX8 A;  4F2V A;  1S3Y A;  2TDM A;  5FCT A;  3IRO A;  3GHV A;  1SYN A;  3TMS A;  3F0S X;  4X5F A;  1RX9 A;  1DIU A;  5H3A A;  3FYV X;  1IA3 A;  1KLK A;  5HVE A;  3IK1 A;  5H38 A;  2W3V A;  4PTH A;  1DAJ A;  3SRR X;  1DRB A;  1IA1 A;  2TSR A;  3ROA A;  4KJL A;  1E26 A;  1JOM A;  1YPV A;  3K74 A;  1RD7 A;  4M2X A;  1EV8 A;  1VDR A;  3JWM A;  4IXF X;  2BLB A;  1OHK A;  4QLE A;  3TQA A;  1SEJ A;  4HA7 A;  1TSX A;  4LRR A;  2BLA A;  1BO8 A;  1JMH A;  1IA2 A;  1DDS A;  2ANO A;  3Q1H A;  4NX7 A;  1BDU A;  3S9U A;  3QYL A;  3FRE X;  4DPH A;  2W9S A;  4M6K A;  3DG8 A;  2B3Z A;  2FTQ A;  1LCB A;  3QLR A;  1DYR A;  3NU0 A;  3EIG A;  4KY8 A;  3EDW X;  3KJR A;  1RX2 A;  1BOZ A;  3RO9 A;  3EJL A;  1LCA A;  3JTW A;  3ZPC A;  1AXW A;  3QLS A;  1M79 A;  4KNE A;  3TQ9 A;  4XT8 A;  6DFR A;  4Q0E A;  1VZA A;  1HFP A;  2C2S A;  1F4E A;  1RF7 A;  4DQ1 A;  2BL9 A;  3NXV A;  4O1X A;  1J3K C;  4PSG A;  3F8Y A;  3C06 A;  3F0X X;  4KL9 A;  1PDB A;  1TDU A;  4H0R A;  4LAG X;  2RD8 A;  4GEV A;  4FGT A;  1RX7 A;  3GH2 X;  3S3V A;  4I1N A;  2G8A A;  1B5E A;  3UM5 A;  2VET A;  2OIP A;  1HFR A;  4QHV A;  2RD8 B;  5U27 A;  5HVB A;  4ELG A;  1F4G A;  5E8Q A;  3FQ0 A;  4KAK A;  4ELB A;  1DHF A;  5HUI A;  1DLS A;  1M78 A;  3GYF A;  1BPJ A;  1TSV A;  2G8X A;  4KM2 A;  1BKO A;  4XSD A;  4FHB A;  4FGH A;  5HT5 A;  4P66 A;  1VZB A;  1FWM A;  3UM8 A;  1BKP A;  1DR7 A;  2P4G A;  2DHF A;  1TJS A;  3QJ7 A;  1BP0 A;  1FFL A;  1TRG A;  4H96 A;  1AJM A;  1B5D A;  1LCE A;  2G86 A;  1JUJ A;  4FOA A;  3D84 X;  3IX9 A;  3GHW A;  1EVF A;  3L3R A;  4KBN A;  1NJA A;  3IRM A;  3QFX A;  3BHR A;  3I3R A;  3SA1 A;  3TQ8 A;  2L28 A;  3F0U X;  5J7W A;  1JUV A;  3JWC A;  4GH8 A;  5HPB A;  4O1X D;  3JVX A;  4LAH X;  1RA1 A;  3SGY A;  4H98 A;  4X5G A;  3IK0 A;  3NZB X;  4IQB A;  4XEC X;  1DYH A;  1NCE A;  1HZW A;  1NJC A;  4M7V A;  3SRQ X;  4KFJ A;  1DR3 A;  4ISK A;  4KYA A;  3NZD A;  1THY A;  3GH0 A;  1DR4 A;  1J3I A;  1OHJ A;  5HF0 X;  3KFY A;  4PSY A;  4G6W X;  1DYI A;  3K45 A;  4PTJ A;  3SRU X;  2W9G A;  4XE6 X;  3KJS A;  3M09 A;  4DFR A;  4XT4 A;  1JU6 A;  4KEB A;  4P3Q A;  1ZPR A;  4KM0 A;  1B49 A;  3DAU A;  1DF7 A;  4FGG A;  1RX4 A;  3UM6 A;  3F0V X;  3M08 A;  1F4D A;  4G2O X;  4KLX A;  1JG0 A;  1AOE A;  3UWL A;  3EGY X;  2H2Q A;  1LY3 A;  4XRB A;  4ECK A;  1RC4 A;  4E5O A;  3JW3 A;  5HQZ A;  1JOL A;  4GYH A;  3QLX A;  3UWL B;  2G8D A;  3BZ0 A;  1MVS A;  3NZ6 X;  4PDJ A;  3BHL A;  3FY9 X;  1CD2 A;  3OCH A;  1BZF A;  4P3R A;  4M6J A;  3JW5 A;  3N5E A;  2W3B A;  2RDA A;  3FS6 A;  5DXV A;  3F0Q X;  1VZD A;  3D80 A;  2ZZA A;  2GD9 A;  5HF2 X;  1EVG A;  3NRR A;  1J3J C;  2TSC A;  3N5E B;  1F4F A;  3NXO A;  3FRB X;  4XT5 A;  4QJZ D;  3B9H A;  1MVT A;  4DPD A;  3KY8 A;  3FYW X;  3DL5 A;  4IXE D;  3FL9 A;  1KCE A;  4H95 A;  3CD2 A;  2TDD A;  5HI6 A;  2W3M A;  3CLB A;  3NZ9 X;  3FY8 X;  3DAT A;  3K2H A;  4EIG A;  1S3V A;  4PSS A;  3GG5 A;  5HS3 A;  1DHJ A;  7DFR A;  1AN5 A;  4O1U A;  1IA4 A;  1YHO A;  1RA8 A;  3B5B A;  3OB7 A;  2LF1 A;  3KGY A;  1BSP A;  4EJ1 A;  4ISW A;  2XW7 A;  1RX8 A;  2HQP A;  5ECC A;  1DR1 A;  1DYJ A;  3QLZ A;  3KGB A;  1AO8 A;  1VJ3 A;  5WRN A;  1DHI A;  1RX1 A;  1RG7 A;  3BYX A;  4RGC A;  3SR5 X;  4DDR A;  4KPW A;  3FL8 A;  3SRW X;  3NXX A;  3IA4 A;  1KMV A;  1DDR A;  1D1G A;  5CCC A;  4TMS A;  1JUT A;  3DL6 A;  3QL0 A;  3BNZ A;  3JWF A;  3JWK A;  2ONB A;  4GD7 A;  1J3K A;  1I00 A;  3FRF X;  2BLC A;  1HW3 A;  1KZJ A;  4QJC A;  1RA2 A;  2VF0 A;  3BFI A;  5HT4 A;  1VZE A;  3FRA X;  4NX6 A;  4TU5 X;  5FDA A;  4H97 A;  3EF9 A;  4DP3 A;  1TSN A;  3EEK A;  1DG5 A;  1S3U A;  1CZ3 A;  2AAZ A;  4HA9 A;  3K47 A;  2D5N A;  3NXR A;  2W3A A;  3GI2 A;  1ZDR A;  3SAI A;  1TDB A;  4CD2 A;  1NJE A;  1TVU A;  3ED7 A;  3FRD X;  2AZN A;  4FOX A;  1EV5 A;  3DGA C;  1RA3 A;  5HQY A;  1DIS A;  3FQC A;  5CC9 A;  3QL3 A;  3QYO A;  1AOB A;  3OAF A;  4KD7 A;  5U26 A;  2A9W A;  3NZA X;  4QLF A;  3IJZ A;  4HOG A;  3EBU A;  1RTS A;  4EIZ A;  1TSY A;  2KCE A;  1TDR A;  3EEL A;  1TLC A;  3TD8 A;  4JEF A;  3F91 A;  1DG8 A;  3EAW X;  3NXT A;  4M6L A;  3F0B X;  1DRH A;  4QLG A;  4OR7 A;  1JMF A;  1PD9 A;  1NJD A;  3QLW A;  5HSR A;  3R33 A;  5HSU A;  1BQ2 A;  4I13 A;  4EZ8 A;  2G6V A;  1KMS A;  3DG8 C;  4LEK X;  4E28 A;  4O7U A;  3DGA A;  2QK8 A;  2CIG A; 
#chains in the Genus database with same CATH topology
 2CD2 A;  1BJG A;  1RE7 A;  2ITH A;  4G8Z X;  2O7P A;  1DRA A;  3EEM A;  3QG2 A;  1JTU A;  4ELE A;  2HM9 A;  3JSU A;  1NJB A;  2BBQ A;  3EEJ A;  1TDA A;  2C2T A;  4XSE A;  1AI9 A;  5ECX A;  3NZC X;  5DFR A;  1BQ1 A;  1JMG A;  4Q0D A;  1TDC A;  1U72 A;  1DNA A;  2FZH A;  1RX5 A;  1RX6 A;  2JYB A;  5H39 A;  3QGT A;  4EIL A;  1RB2 A;  2FTO X;  1TSZ A;  1DR6 A;  1LY4 A;  3NXY A;  3SRS X;  1TSM A;  3HB8 A;  3DRC A;  3SH2 A;  1BSF A;  3FQV A;  2KGK A;  4X5H A;  3HJ3 A;  1DDU A;  4P68 A;  3HBB A;  3F8Z A;  3C0A A;  1RA9 A;  3NTZ A;  2HXV A;  1DRE A;  3V8H A;  2INQ A;  1M7A A;  4Q6A A;  4H1I A;  2DRC A;  4XT7 A;  1HVY A;  4IQQ A;  3QLY A;  5JG0 X;  3SA2 A;  1S3W A;  2W3W A;  3DFR A;  4X5I A;  1RX3 A;  1J3J A;  1TIS A;  4KJJ A;  3N5G A;  3CSE A;  1F4B A;  1VZC A;  3LG4 A;  5EAJ A;  1QZF A;  2ANQ A;  1TLS A;  1DLR A;  1TYS A;  4M7U A;  1PD8 A;  3N0H A;  4FOG A;  1JTQ A;  1JMI A;  3VCO A;  3GHC A;  3I8A X;  2FZI A;  4EB4 A;  5BY6 A;  3IA5 A;  1QQQ A;  4OSG A;  1HW4 A;  4QI9 A;  1AIQ A;  4X5J A;  1BP6 A;  1TSD A;  3RG9 A;  2G89 A;  2OBC A;  3IX6 A;  4XSC A;  3TQB A;  1U71 A;  4Q67 A;  1TVV A;  1U70 A;  4KJK A;  4LAE X;  1J3I C;  4IRR A;  3EHI X;  3SQY X;  1B02 A;  1DRF A;  3BGX A;  3CL9 A;  4ELF A;  1KZI A;  4G95 A;  4HOF A;  2W9H A;  8DFR A;  3E0B A;  3FQZ A;  4HOE A;  4EIN A;  2FTN A;  1BO7 A;  1F28 A;  4FQS A;  3INV A;  1DR5 A;  1RH3 A;  3IHI A;  4H0U A;  1DG7 A;  1RB3 A;  3ZPG A;  1CI7 A;  4UP1 A;  3FQF A;  1F4C A;  1TSW A;  1LUD A;  2D0K A;  2W9T A;  4PST A;  1DR2 A;  4IXG X;  2FZJ A;  1BID A;  4XT6 A;  4G3M A;  5JA3 A;  3FQO A;  3H9K A;  1HFQ A;  3IRN A;  3S7A A;  4ELH A;  1TVW A;  4KNZ A;  4KY4 A;  1TSL A;  3EX8 A;  4F2V A;  1S3Y A;  2TDM A;  5FCT A;  3IRO A;  3GHV A;  1SYN A;  3TMS A;  3F0S X;  4X5F A;  1RX9 A;  1DIU A;  5H3A A;  3FYV X;  1IA3 A;  1KLK A;  5HVE A;  3IK1 A;  5H38 A;  2W3V A;  4PTH A;  1DAJ A;  3SRR X;  1DRB A;  1IA1 A;  2TSR A;  3ROA A;  4KJL A;  1E26 A;  1JOM A;  1YPV A;  3K74 A;  1RD7 A;  4M2X A;  1EV8 A;  1VDR A;  3JWM A;  4IXF X;  2BLB A;  1OHK A;  4QLE A;  3TQA A;  1SEJ A;  4HA7 A;  1TSX A;  4LRR A;  2BLA A;  1BO8 A;  1JMH A;  1IA2 A;  1DDS A;  2ANO A;  3Q1H A;  4NX7 A;  1BDU A;  3S9U A;  3QYL A;  3FRE X;  4DPH A;  2W9S A;  4M6K A;  3DG8 A;  2B3Z A;  2FTQ A;  1LCB A;  3QLR A;  1DYR A;  3NU0 A;  3EIG A;  4KY8 A;  3EDW X;  3KJR A;  1RX2 A;  1BOZ A;  3RO9 A;  3EJL A;  1LCA A;  3JTW A;  3ZPC A;  1AXW A;  3QLS A;  1M79 A;  4KNE A;  3TQ9 A;  4XT8 A;  6DFR A;  4Q0E A;  1VZA A;  1HFP A;  2C2S A;  1F4E A;  1RF7 A;  4DQ1 A;  2BL9 A;  3NXV A;  4O1X A;  1J3K C;  4PSG A;  3F8Y A;  3C06 A;  3F0X X;  4KL9 A;  1PDB A;  1TDU A;  4H0R A;  4LAG X;  2RD8 A;  4GEV A;  4FGT A;  1RX7 A;  3GH2 X;  3S3V A;  4I1N A;  2G8A A;  1B5E A;  3UM5 A;  2VET A;  2OIP A;  1HFR A;  4QHV A;  2RD8 B;  5U27 A;  5HVB A;  4ELG A;  1F4G A;  5E8Q A;  3FQ0 A;  4KAK A;  4ELB A;  1DHF A;  5HUI A;  1DLS A;  1M78 A;  3GYF A;  1BPJ A;  1TSV A;  2G8X A;  4KM2 A;  1BKO A;  4XSD A;  4FHB A;  4FGH A;  5HT5 A;  4P66 A;  1VZB A;  1FWM A;  3UM8 A;  1BKP A;  1DR7 A;  2P4G A;  2DHF A;  1TJS A;  3QJ7 A;  1BP0 A;  1FFL A;  1TRG A;  4H96 A;  1AJM A;  1B5D A;  1LCE A;  2G86 A;  1JUJ A;  4FOA A;  3D84 X;  3IX9 A;  3GHW A;  1EVF A;  3L3R A;  4KBN A;  1NJA A;  3IRM A;  3QFX A;  3BHR A;  3I3R A;  3SA1 A;  3TQ8 A;  2L28 A;  3F0U X;  5J7W A;  1JUV A;  3JWC A;  4GH8 A;  5HPB A;  4O1X D;  3JVX A;  4LAH X;  1RA1 A;  3SGY A;  4H98 A;  4X5G A;  3IK0 A;  3NZB X;  4IQB A;  4XEC X;  1DYH A;  1NCE A;  1HZW A;  1NJC A;  4M7V A;  3SRQ X;  4KFJ A;  1DR3 A;  4ISK A;  4KYA A;  3NZD A;  1THY A;  3GH0 A;  1DR4 A;  1J3I A;  1OHJ A;  5HF0 X;  3KFY A;  4PSY A;  4G6W X;  1DYI A;  3K45 A;  4PTJ A;  3SRU X;  2W9G A;  4XE6 X;  3KJS A;  3M09 A;  4DFR A;  4XT4 A;  1JU6 A;  4KEB A;  4P3Q A;  1ZPR A;  4KM0 A;  1B49 A;  3DAU A;  1DF7 A;  4FGG A;  1RX4 A;  3UM6 A;  3F0V X;  3M08 A;  1F4D A;  4G2O X;  4KLX A;  1JG0 A;  1AOE A;  3UWL A;  3EGY X;  2H2Q A;  1LY3 A;  4XRB A;  4ECK A;  1RC4 A;  4E5O A;  3JW3 A;  5HQZ A;  1JOL A;  4GYH A;  3QLX A;  3UWL B;  2G8D A;  3BZ0 A;  1MVS A;  3NZ6 X;  4PDJ A;  3BHL A;  3FY9 X;  1CD2 A;  3OCH A;  1BZF A;  4P3R A;  4M6J A;  3JW5 A;  3N5E A;  2W3B A;  2RDA A;  3FS6 A;  5DXV A;  3F0Q X;  1VZD A;  3D80 A;  2ZZA A;  2GD9 A;  5HF2 X;  1EVG A;  3NRR A;  1J3J C;  2TSC A;  3N5E B;  1F4F A;  3NXO A;  3FRB X;  4XT5 A;  4QJZ D;  3B9H A;  1MVT A;  4DPD A;  3KY8 A;  3FYW X;  3DL5 A;  4IXE D;  3FL9 A;  1KCE A;  4H95 A;  3CD2 A;  2TDD A;  5HI6 A;  2W3M A;  3CLB A;  3NZ9 X;  3FY8 X;  3DAT A;  3K2H A;  4EIG A;  1S3V A;  4PSS A;  3GG5 A;  5HS3 A;  1DHJ A;  7DFR A;  1AN5 A;  4O1U A;  1IA4 A;  1YHO A;  1RA8 A;  3B5B A;  3OB7 A;  2LF1 A;  3KGY A;  1BSP A;  4EJ1 A;  4ISW A;  2XW7 A;  1RX8 A;  2HQP A;  5ECC A;  1DR1 A;  1DYJ A;  3QLZ A;  3KGB A;  1AO8 A;  1VJ3 A;  5WRN A;  1DHI A;  1RX1 A;  1RG7 A;  3BYX A;  4RGC A;  3SR5 X;  4DDR A;  4KPW A;  3FL8 A;  3SRW X;  3NXX A;  3IA4 A;  1KMV A;  1DDR A;  1D1G A;  5CCC A;  4TMS A;  1JUT A;  3DL6 A;  3QL0 A;  3BNZ A;  3JWF A;  3JWK A;  2ONB A;  4GD7 A;  1J3K A;  1I00 A;  3FRF X;  2BLC A;  1HW3 A;  1KZJ A;  4QJC A;  1RA2 A;  2VF0 A;  3BFI A;  5HT4 A;  1VZE A;  3FRA X;  4NX6 A;  4TU5 X;  5FDA A;  4H97 A;  3EF9 A;  4DP3 A;  1TSN A;  3EEK A;  1DG5 A;  1S3U A;  1CZ3 A;  2AAZ A;  4HA9 A;  3K47 A;  2D5N A;  3NXR A;  2W3A A;  3GI2 A;  1ZDR A;  3SAI A;  1TDB A;  4CD2 A;  1NJE A;  1TVU A;  3ED7 A;  3FRD X;  2AZN A;  4FOX A;  1EV5 A;  3DGA C;  1RA3 A;  5HQY A;  1DIS A;  3FQC A;  5CC9 A;  3QL3 A;  3QYO A;  1AOB A;  3OAF A;  4KD7 A;  5U26 A;  2A9W A;  3NZA X;  4QLF A;  3IJZ A;  4HOG A;  3EBU A;  1RTS A;  4EIZ A;  1TSY A;  2KCE A;  1TDR A;  3EEL A;  1TLC A;  3TD8 A;  4JEF A;  3F91 A;  1DG8 A;  3EAW X;  3NXT A;  4M6L A;  3F0B X;  1DRH A;  4QLG A;  4OR7 A;  1JMF A;  1PD9 A;  1NJD A;  3QLW A;  5HSR A;  3R33 A;  5HSU A;  1BQ2 A;  4I13 A;  4EZ8 A;  2G6V A;  1KMS A;  3DG8 C;  4LEK X;  4E28 A;  4O7U A;  3DGA A;  2QK8 A;  2CIG A; 
#chains in the Genus database with same CATH homology
 2CD2 A;  1BJG A;  1RE7 A;  2ITH A;  4G8Z X;  2O7P A;  1DRA A;  3EEM A;  3QG2 A;  1JTU A;  4ELE A;  2HM9 A;  3JSU A;  1NJB A;  2BBQ A;  3EEJ A;  1TDA A;  2C2T A;  4XSE A;  1AI9 A;  5ECX A;  3NZC X;  5DFR A;  1BQ1 A;  1JMG A;  4Q0D A;  1TDC A;  1U72 A;  1DNA A;  2FZH A;  1RX5 A;  1RX6 A;  2JYB A;  5H39 A;  3QGT A;  4EIL A;  1RB2 A;  2FTO X;  1TSZ A;  1DR6 A;  1LY4 A;  3NXY A;  3SRS X;  1TSM A;  3HB8 A;  3DRC A;  3SH2 A;  1BSF A;  3FQV A;  2KGK A;  4X5H A;  3HJ3 A;  1DDU A;  4P68 A;  3HBB A;  3F8Z A;  3C0A A;  1RA9 A;  3NTZ A;  2HXV A;  1DRE A;  3V8H A;  2INQ A;  1M7A A;  4Q6A A;  4H1I A;  2DRC A;  4XT7 A;  1HVY A;  4IQQ A;  3QLY A;  5JG0 X;  3SA2 A;  1S3W A;  2W3W A;  3DFR A;  4X5I A;  1RX3 A;  1J3J A;  1TIS A;  4KJJ A;  3N5G A;  3CSE A;  1F4B A;  1VZC A;  3LG4 A;  5EAJ A;  1QZF A;  2ANQ A;  1TLS A;  1DLR A;  1TYS A;  4M7U A;  1PD8 A;  3N0H A;  4FOG A;  1JTQ A;  1JMI A;  3VCO A;  3GHC A;  3I8A X;  2FZI A;  4EB4 A;  5BY6 A;  3IA5 A;  1QQQ A;  4OSG A;  1HW4 A;  4QI9 A;  1AIQ A;  4X5J A;  1BP6 A;  1TSD A;  3RG9 A;  2G89 A;  2OBC A;  3IX6 A;  4XSC A;  3TQB A;  1U71 A;  4Q67 A;  1TVV A;  1U70 A;  4KJK A;  4LAE X;  1J3I C;  4IRR A;  3EHI X;  3SQY X;  1B02 A;  1DRF A;  3BGX A;  3CL9 A;  4ELF A;  1KZI A;  4G95 A;  4HOF A;  2W9H A;  8DFR A;  3E0B A;  3FQZ A;  4HOE A;  4EIN A;  2FTN A;  1BO7 A;  1F28 A;  4FQS A;  3INV A;  1DR5 A;  1RH3 A;  3IHI A;  4H0U A;  1DG7 A;  1RB3 A;  3ZPG A;  1CI7 A;  4UP1 A;  3FQF A;  1F4C A;  1TSW A;  1LUD A;  2D0K A;  2W9T A;  4PST A;  1DR2 A;  4IXG X;  2FZJ A;  1BID A;  4XT6 A;  4G3M A;  5JA3 A;  3FQO A;  3H9K A;  1HFQ A;  3IRN A;  3S7A A;  4ELH A;  1TVW A;  4KNZ A;  4KY4 A;  1TSL A;  3EX8 A;  4F2V A;  1S3Y A;  2TDM A;  5FCT A;  3IRO A;  3GHV A;  1SYN A;  3TMS A;  3F0S X;  4X5F A;  1RX9 A;  1DIU A;  5H3A A;  3FYV X;  1IA3 A;  1KLK A;  5HVE A;  3IK1 A;  5H38 A;  2W3V A;  4PTH A;  1DAJ A;  3SRR X;  1DRB A;  1IA1 A;  2TSR A;  3ROA A;  4KJL A;  1E26 A;  1JOM A;  1YPV A;  3K74 A;  1RD7 A;  4M2X A;  1EV8 A;  1VDR A;  3JWM A;  4IXF X;  2BLB A;  1OHK A;  4QLE A;  3TQA A;  1SEJ A;  4HA7 A;  1TSX A;  4LRR A;  2BLA A;  1BO8 A;  1JMH A;  1IA2 A;  1DDS A;  2ANO A;  3Q1H A;  4NX7 A;  1BDU A;  3S9U A;  3QYL A;  3FRE X;  4DPH A;  2W9S A;  4M6K A;  3DG8 A;  2B3Z A;  2FTQ A;  1LCB A;  3QLR A;  1DYR A;  3NU0 A;  3EIG A;  4KY8 A;  3EDW X;  3KJR A;  1RX2 A;  1BOZ A;  3RO9 A;  3EJL A;  1LCA A;  3JTW A;  3ZPC A;  1AXW A;  3QLS A;  1M79 A;  4KNE A;  3TQ9 A;  4XT8 A;  6DFR A;  4Q0E A;  1VZA A;  1HFP A;  2C2S A;  1F4E A;  1RF7 A;  4DQ1 A;  2BL9 A;  3NXV A;  4O1X A;  1J3K C;  4PSG A;  3F8Y A;  3C06 A;  3F0X X;  4KL9 A;  1PDB A;  1TDU A;  4H0R A;  4LAG X;  2RD8 A;  4GEV A;  4FGT A;  1RX7 A;  3GH2 X;  3S3V A;  4I1N A;  2G8A A;  1B5E A;  3UM5 A;  2VET A;  2OIP A;  1HFR A;  4QHV A;  2RD8 B;  5U27 A;  5HVB A;  4ELG A;  1F4G A;  5E8Q A;  3FQ0 A;  4KAK A;  4ELB A;  1DHF A;  5HUI A;  1DLS A;  1M78 A;  3GYF A;  1BPJ A;  1TSV A;  2G8X A;  4KM2 A;  1BKO A;  4XSD A;  4FHB A;  4FGH A;  5HT5 A;  4P66 A;  1VZB A;  1FWM A;  3UM8 A;  1BKP A;  1DR7 A;  2P4G A;  2DHF A;  1TJS A;  3QJ7 A;  1BP0 A;  1FFL A;  1TRG A;  4H96 A;  1AJM A;  1B5D A;  1LCE A;  2G86 A;  1JUJ A;  4FOA A;  3D84 X;  3IX9 A;  3GHW A;  1EVF A;  3L3R A;  4KBN A;  1NJA A;  3IRM A;  3QFX A;  3BHR A;  3I3R A;  3SA1 A;  3TQ8 A;  2L28 A;  3F0U X;  5J7W A;  1JUV A;  3JWC A;  4GH8 A;  5HPB A;  4O1X D;  3JVX A;  4LAH X;  1RA1 A;  3SGY A;  4H98 A;  4X5G A;  3IK0 A;  3NZB X;  4IQB A;  4XEC X;  1DYH A;  1NCE A;  1HZW A;  1NJC A;  4M7V A;  3SRQ X;  4KFJ A;  1DR3 A;  4ISK A;  4KYA A;  3NZD A;  1THY A;  3GH0 A;  1DR4 A;  1J3I A;  1OHJ A;  5HF0 X;  3KFY A;  4PSY A;  4G6W X;  1DYI A;  3K45 A;  4PTJ A;  3SRU X;  2W9G A;  4XE6 X;  3KJS A;  3M09 A;  4DFR A;  4XT4 A;  1JU6 A;  4KEB A;  4P3Q A;  1ZPR A;  4KM0 A;  1B49 A;  3DAU A;  1DF7 A;  4FGG A;  1RX4 A;  3UM6 A;  3F0V X;  3M08 A;  1F4D A;  4G2O X;  4KLX A;  1JG0 A;  1AOE A;  3UWL A;  3EGY X;  2H2Q A;  1LY3 A;  4XRB A;  4ECK A;  1RC4 A;  4E5O A;  3JW3 A;  5HQZ A;  1JOL A;  4GYH A;  3QLX A;  3UWL B;  2G8D A;  3BZ0 A;  1MVS A;  3NZ6 X;  4PDJ A;  3BHL A;  3FY9 X;  1CD2 A;  3OCH A;  1BZF A;  4P3R A;  4M6J A;  3JW5 A;  3N5E A;  2W3B A;  2RDA A;  3FS6 A;  5DXV A;  3F0Q X;  1VZD A;  3D80 A;  2ZZA A;  2GD9 A;  5HF2 X;  1EVG A;  3NRR A;  1J3J C;  2TSC A;  3N5E B;  1F4F A;  3NXO A;  3FRB X;  4XT5 A;  4QJZ D;  3B9H A;  1MVT A;  4DPD A;  3KY8 A;  3FYW X;  3DL5 A;  4IXE D;  3FL9 A;  1KCE A;  4H95 A;  3CD2 A;  2TDD A;  5HI6 A;  2W3M A;  3CLB A;  3NZ9 X;  3FY8 X;  3DAT A;  3K2H A;  4EIG A;  1S3V A;  4PSS A;  3GG5 A;  5HS3 A;  1DHJ A;  7DFR A;  1AN5 A;  4O1U A;  1IA4 A;  1YHO A;  1RA8 A;  3B5B A;  3OB7 A;  2LF1 A;  3KGY A;  1BSP A;  4EJ1 A;  4ISW A;  2XW7 A;  1RX8 A;  2HQP A;  5ECC A;  1DR1 A;  1DYJ A;  3QLZ A;  3KGB A;  1AO8 A;  1VJ3 A;  5WRN A;  1DHI A;  1RX1 A;  1RG7 A;  3BYX A;  4RGC A;  3SR5 X;  4DDR A;  4KPW A;  3FL8 A;  3SRW X;  3NXX A;  3IA4 A;  1KMV A;  1DDR A;  1D1G A;  5CCC A;  4TMS A;  1JUT A;  3DL6 A;  3QL0 A;  3BNZ A;  3JWF A;  3JWK A;  2ONB A;  4GD7 A;  1J3K A;  1I00 A;  3FRF X;  2BLC A;  1HW3 A;  1KZJ A;  4QJC A;  1RA2 A;  2VF0 A;  3BFI A;  5HT4 A;  1VZE A;  3FRA X;  4NX6 A;  4TU5 X;  5FDA A;  4H97 A;  3EF9 A;  4DP3 A;  1TSN A;  3EEK A;  1DG5 A;  1S3U A;  1CZ3 A;  2AAZ A;  4HA9 A;  3K47 A;  2D5N A;  3NXR A;  2W3A A;  3GI2 A;  1ZDR A;  3SAI A;  1TDB A;  4CD2 A;  1NJE A;  1TVU A;  3ED7 A;  3FRD X;  2AZN A;  4FOX A;  1EV5 A;  3DGA C;  1RA3 A;  5HQY A;  1DIS A;  3FQC A;  5CC9 A;  3QL3 A;  3QYO A;  1AOB A;  3OAF A;  4KD7 A;  5U26 A;  2A9W A;  3NZA X;  4QLF A;  3IJZ A;  4HOG A;  3EBU A;  1RTS A;  4EIZ A;  1TSY A;  2KCE A;  1TDR A;  3EEL A;  1TLC A;  3TD8 A;  4JEF A;  3F91 A;  1DG8 A;  3EAW X;  3NXT A;  4M6L A;  3F0B X;  1DRH A;  4QLG A;  4OR7 A;  1JMF A;  1PD9 A;  1NJD A;  3QLW A;  5HSR A;  3R33 A;  5HSU A;  1BQ2 A;  4I13 A;  4EZ8 A;  2G6V A;  1KMS A;  3DG8 C;  4LEK X;  4E28 A;  4O7U A;  3DGA A;  2QK8 A;  2CIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...