The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
77
|
sequence length |
327
|
structure length |
320
|
Chain Sequence |
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb |
| molecule keywords |
pseudouridine synthase CBf5
|
| molecule tags |
Isomerase/rna
|
| source organism |
Pyrococcus furiosus
|
| total genus |
77
|
| structure length |
320
|
| sequence length |
327
|
| ec nomenclature |
ec
5.4.99.25: tRNA pseudouridine(55) synthase. |
| pdb deposition date | 2009-05-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01472 | PUA | PUA domain |
| A | PF01509 | TruB_N | TruB family pseudouridylate synthase (N terminal domain) |
| A | PF08068 | DKCLD | DKCLD (NUC011) domain |
| A | PF16198 | TruB_C_2 | tRNA pseudouridylate synthase B C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | ||
| Alpha Beta | 2-Layer Sandwich | Pseudouridine synthase | Pseudouridine synthase |
#chains in the Genus database with same CATH superfamily 3HAX A; 3MQK A; 3LWR A; 2AB4 A; 3LWP A; 1R3E A; 2IST A; 4LGT A; 3DH3 A; 1KSV A; 3LWV A; 2EY4 A; 1PRZ A; 2I82 A; 2HVY A; 3HJY A; 1K8W A; 1V9K A; 1SGV A; 3U28 A; 1V9F A; 3LWQ A; 3UAI A; 2AUS A; 2APO A; 1XPI A; 1KSL A; 1ZL3 A; 1R3F A; 1ZE2 A; 2RFK A; 1ZE1 A; 3HJW A; 1QYU A; 3ZV0 C; 3LWO A; 4LAB A; 1KSK A; #chains in the Genus database with same CATH topology 3MQK A; 3IUW A; 1J2B A; 2IST A; 1KSV A; 3LWV A; 1WXX A; 3U28 A; 1SQW A; 2KKU A; 1ZL3 A; 1Z2Z A; 2E5O A; 3ZV0 C; 2AS0 A; 1SI7 A; 4LAB A; 1IT7 A; 1S04 A; 1R3E A; 3M65 A; 4LGT A; 2B78 A; 4DMG A; 3HJY A; 1V9K A; 4TZ4 C; 1SB7 A; 3UAI A; 2AUS A; 1XPI A; 1R3F A; 1ZE2 A; 4CI3 B; 3HJW A; 1IT8 A; 4CI2 B; 2DP9 A; 2Z0T A; 1ZBO A; 2J5V A; 1KSK A; 3M6W A; 3HAX A; 3LWR A; 2CWW A; 3LWP A; 2CX1 A; 1TE7 A; 3LJC A; 3LDF A; 3M4X A; 1WXW A; 1UOY A; 1IQ8 A; 2CX0 A; 1SZW A; 2I82 A; 3M6V A; 1K8W A; 1V9F A; 3LWQ A; 2APO A; 1KSL A; 2RFK A; 4CI1 B; 1Q7H A; 2ANE A; 1T5Y A; 3M6X A; 4Q1T A; 3VSE A; 2AB4 A; 2FRX A; 3M6U A; 3DH3 A; 1PRZ A; 2EY4 A; 2Q07 A; 2HVY A; 1SGV A; 1ZS7 A; 2J5T A; 1WK2 A; 3D79 A; 1ZE1 A; 1QYU A; 2P38 A; 3C0K A; 1XNE A; 3LWO A; #chains in the Genus database with same CATH homology 3M6X A; 3M6W A; 3HAX A; 3MQK A; 3LWR A; 2AB4 A; 3LWP A; 1R3E A; 2FRX A; 3M4X A; 3M6U A; 1UOY A; 2IST A; 4LGT A; 3DH3 A; 1KSV A; 3LWV A; 2EY4 A; 1PRZ A; 1SZW A; 2I82 A; 3M6V A; 2HVY A; 3HJY A; 1K8W A; 1V9K A; 1SGV A; 3U28 A; 1SB7 A; 1V9F A; 3LWQ A; 3UAI A; 2AUS A; 2APO A; 1XPI A; 1KSL A; 1ZL3 A; 1Z2Z A; 1R3F A; 1ZE2 A; 2RFK A; 1ZE1 A; 3HJW A; 1QYU A; 3ZV0 C; 3LWO A; 1SI7 A; 4LAB A; 1KSK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...