1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHONOACETATE HYDROLASE
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
5IJQA 1N2KA 3M8ZA 4ZG6A 4ZGAA 1SHQA 1EQJA 4CXKA 4MY4A 1K7HA 5LRMA 4CXUA 4UOOA 3NKQA 1O98A 3NKPA 4QAXA 3UNYA 1KHLA 3UN5A 4TN0A 1AJDA 1KH4A 4LR8A 1HQAA 5LRNA 1ZEFA 5GOVA 1E1ZP 4UPHA 4GTYA 1KHKA 4KJDA 4LRCA 2IUCB 4LRBA 1ZEBA 3BDFA 3SZYA 1ALJA 4FDIA 3WAWA 1KH7A 1ELXA 2X98A 1HDHA 2W8SA 3KD8A 3T01A 3NKOA 1AJAA 3TWZA 3B5QA 3BDHA 4CYRA 1URBA 4LRAA 5INHA 3WBHA 3NKMA 1Y6VA 4KAYA 4KAVA 3BDGB 4UOPA 4B56A 4ZG7A 4KM4A 2W5RA 5C66A 3TG0A 3A52A 3NKNA 3LXQA 5DLVA 4UPIA 2W5WA 4LREA 4LRFA 4KJGA 2W5VA 3SZZA 4CXSA 2GA3A 3M8WA 1O99A 1SHNA 2QZUA 1AUKA 1EW2A 1HJKA 2W5XA 4UORA 5HRTA 3DPCA 2G9YA 1E2SP 2ZKTA 3NKRA 3DYCA 1ED8A 4LRDA 4LR2A 5EGHA 5TJ3A 3E2DA 1FSUA 3T00A 5L0BA 3IDDA 2D1GA 3MK2A 3WAYA 1EI6A 5DLTA 2XRGA 5L0EA 3MK1A 1AJCA 3WAXA 2IUCA 1P49A 1B8JA 4UPLA 5KXAA 4N7TA 5DLWA 2VQRA 2W5SA 5AJ9A 3WAVA 1ANJA 1EW8A 2RH6A 3MK0A 5GRRA 1ELYA 3T02A 3IGZB 1N2LA 5K4PA 5LQQA 2ANHA 1URAA 2GSNA 1Y7AA 3UN3A 1EJJA 2GSOA 3UN2A 2W5QA 3IGYB 3M8YA 2GLQA 2W8DA 3CMRA 1KH5A 3OT9A 1EW9A 3UO0A 2IFYA 4GTWA 1ALKA 1KHNA 4YR1A 4GTZA 1ELZA 4LQYA 1ALHA 5L0KA 4LR9A 1ANIA 4MHXA 4GTXA 3ED4A 4FDJA 1ED9A 1KH9A 1KHJA 1ALIA 4CYSA 3BDGA 3TX0A 5EGEA 5IJSA 3Q3QA 3NVLA 2XR9A 4NWXA 4UPKA 5LIAA 1E3CP 4NWJA 4ZG9A 4LR7A 1E33P 1ZEDA 2GSUA 4MIVA 1AJBA 3M7VA 2W5TA
chains in the Genus database with same CATH superfamily
4WJ4A 3M8ZA 1SHQA 3S0XA 3FKIC 4KMDA 4A3CK 1O2AA 2R7ZK 4KN4A 1XZQA 2ZFZA 3CQZC 2KWAA 2R93K 2JA7C 1J6VA 2B63A 4LOWA 4BY7K 1XXAA 4LR8A 3UN5A 5LRNA 1O24A 4FM9A 2Y0SD 2D6FC 3HOUC 5D4DA 1E1ZP 3H0GC 3K7AC 1SFOA 1DCOA 5IYBC 3S15K 3DXJA 5IOTA 2IUCB 2W7VA 1ZVUA 5TMCA 4LRBA 5HL8A 1B4AA 3FHZA 3M3YK 4A3LC 3A8IA 2FQOA 4GT9A 1KH7A 2NVXK 4LK0A 4KMHA 3HOYC 4G7OA 2W8SA 2P5MA 2PMZD 3T01A 4A3KK 3GTJC 4GZYA 4WJ3M 1XXCA 1URBA 5INHA 3A8KA 4KAYA 4ZG7A 4B56A 5M5YK 2YU9C 3FOFA 1YCLA 2E2IA 3A52A 3NKNA 3LXQA 5DLVA 4UPIA 3G4CA 1V5VA 1WSRA 1DCHA 1WORA 4CXSA 2GA3A 1O99A 4BBSK 1O27A 2JA8C 2QZUA 5HRTA 4DDQA 3TFHA 1WOOA 3RZDK 3GEEA 4A3BC 3MMLB 2PA8D 4C2MK 3E2DA 4X6AK 4G0WA 3T00A 1PJ5A 3NUHA 4G0VA 5L0BA 3S16K 4A3EK 3ADAC 2XRGA 4A3MC 5C4XC 4BY1K 1KQ4A 3S2HK 1IW7A 2Y3PA 3MK1A 2E2JC 1AJCA 3FKIK 4MEYA 5M5WK 2R93C 5KXAA 1R9TC 4Y52C 3IPJA 1I6HK 3N0BA 2VQRA 2PMZL 4GTEA 2RH6A 3GTOC 3LAJA 5K4PA 2NVYC 3OPFA 1Y1WA 2JH3A 2GSNA 5M5XK 1EJJA 1JQWA 2GSOA 1L0WA 4KMAA 2W5QA 2A6EA 2WB1L 3GTKA 3GTMC 1KH5A 4GTWA 3AD8C 1O25A 3AD7C 1ALKA 1KHNA 3GTQC 3GEIA 1ANIA 4OIRA 3GTPC 1ED9A 1I3QA 5IP9C 2R92K 3BDGA 3TX0A 3H3VL 2Y0SL 2XR9A 4UPKA 1E3CP 4NWJA 3S1RC 3PO2K 2CW0A 1WCMC 4A3DK 1ZEDA 2A68A 1YNNA 5CHPA 5JVOA 3FKIA 3L4JA 1K7HA 3HKZL 3VA7A 1TWGK 3OREA 3CQZA 3FOEA 4G7ZA 2NVXA 4UOOA 2JA7A 4A3GK 1KHLA 3S1QC 3HOWK 4GTFA 1J6XA 1ZEFA 5C4XK 4BY1C 5GOVA 4BKWA 1SFOC 4UPHA 5IP7C 1EFWA 3HOVK 1IS1A 4KJDA 1VJEA 2RGRA 1R9TK 2V6UA 5C44K 5L46A 3BDFA 1ALJA 4YFNA 3M4OK 1ELXA 4GTAA 3NKOA 2JA6K 3B5QA 1GE9A 3NKMA 1Y6VA 2CFAA 4UOPA 5IYDC 2YU9A 5C66A 4C3IK 1SMYA 3S17C 1I3QK 4YFXA 3HOZC 4KC6A 1TWAA 3LPXA 4LRFA 4KJGA 4KB2A 4BLAA 1IBAA 2W5VA 4KM9A 4C3JC 1O28A 3M8WA 4Y7NC 1AUKA 2VUMK 1ZQ1C 2G9YA 3S14C 4PAAA 3GTLK 1ED8A 1TWHA 4BXXK 2JA5K 1Y1WK 1TWGA 2GAGC 5IYCC 1FSUA 3GTGA 2E2HK 3IDDA 3WAYA 5IORA 5DLTA 4A3LK 5IOSA 2R7ZA 3A8JA 4KDDA 3WAXA 3AQPA 3AH5A 2V6SA 3HOUK 3L4KA 3GDZA 4UPLA 1BDFA 2R93A 1R9TA 1I6VA 5AJ9A 3WAVA 3S2DK 1F93A 4QJVA 4M1XA 1Y1VK 2PA8L 4LJZA 5JFEA 5FLMC 1ELYA 3V4GA 3T02A 5IP7K 2NVYA 5LQQA 4OIPA 4OIOA 4O2DA 1BS2A 3GTJK 3H3VD 1UV7A 3GTKC 3M8YA 2GLQA 1G51A 1USMA 3OT9A 1EW9A 1TWAK 3TFIA 4GTZA 4LQYA 3GTQA 1IE0A 1ALHA 5L0KA 2EBBA 4LR9A 4XLPA 1K83A 3QX3A 1TWFK 2E2IK 4OIQA 3GTPA 3ED4A 3RZOK 5IYDK 5C3EK 4C3IC 4GTLA 3I4NK 2CFAB 4GTBA 3Q3QA 4Y52K 4NWXA 4KN7A 2O5IA 1INNA 4P9SA 5IYBK 3GTGK 2WAQL 1E33P 4WILA 2GSUA 2ZUEA 1AJBA 3M7VA 2W5TA 5C4JC 5IJQA 4BLBA 4CXKA 1EQJA 2NVYK 3PO3K 3N0CA 4J3NA 2E2JK 2NVXC 4LK1A 3NKPA 5M3MK 3UNYA 2JA5C 2ZUFA 2E2HC 3GTMK 4A3IC 4TN0A 1JVIA 1HQAA 1WSVA 1B4BA 1ZXOA 4GTYA 4ILDA 1KHKA 4KMUA 4C3HK 1WQFA 1TWFA 1XXBA 4KM8A 1ZEBA 2R92C 2XCQA 4A93K 1WOPA 1Y1VC 3WAWA 3LAPA 3RZDC 3KD8A 1O29A 1F7VA 3GTQK 3ERED 4Q5SA 3BDHA 3S1NK 4LRAA 4CYRA 4KAVA 2PPBA 3GTKK 2W5RA 2WAQD 3HXAA 3S2HC 1I50A 1TWAC 2A6HA 2W5WA 2BE5A 1VH2A 1TWCC 2WB1D 4A3FK 3SZZA 4G0UA 1I6HC 1SHNA 1AB4A 1XZQB 1HJKA 1BJTA 1SFOK 3HOVC 1E2SP 4KATA 4LRDA 1TWHC 4LR2A 2NVQC 1F9NA 1TWGC 3GSIA 4XSZA 2B63K 3GTGC 4A3GC 3EQLA 2D1GA 3MK2A 2GAHC 5L0EA 2R7ZC 3BUEA 4Q4ZA 2IUCA 4P5AA 3PO3C 4KB4A 1P49A 1RU0A 1VRQC 1BGWA 3GIRA 2W5SA 1USOA 2JA8K 1ANJA 1EW8A 2XCRB 1EH1A 1WQGA 5IP9K 2VUMA 3MK0A 4G7HA 4A3BK 1ISEA 1N2LA 1IL2A 4A3CC 2ANHA 1Y7AA 3CQZK 4Y7NK 1XZPB 1WCMK 3S16C 3UN2A 4A3DC 4XSXA 3IGYB 2IFYA 3GTLC 4BXXC 1EK8A 3G4AA 2JA6A 4A3KC 5TMFA 2FQTA 4FZBA 4JK1A 3WODA 1K83C 3TFJA 3S1NC 4MHXA 4GTXA 4FDJA 1O2FB 3S1MC 4RMFA 4QIWD 1ALIA 1KHJA 4CYSA 3M3YC 1C0AA 4LR7A 3S2DC 4BBSC 5C44C 4MIVA 5FLMK 1JOEA 1WIHA 4A3JC 2NVTK 3HOXC 1N2KA 1VGXA 1ZBSA 4ZG6A 4ZGAA 5LRMA 4MY4A 2YU9K 4CXUA 3M4OC 2XCOA 3NKQA 4C2MC 1O98A 4QAXA 2NVQK 2JA5A 3BP8C 2B63C 2E2HA 1DD5A 1AJDA 1KH4A 5IOQA 3H0GA 1HQMA 4GTCA 4LLGA 1F7UA 4LRCA 4BBRC 1J6WA 1TWFC 2PHCB 1X31C 2V6TA 4X6AC 3SZYA 2R92A 4FDIA 1Y1VA 4A3EC 4OINA 1DCPA 4NOIA 3S14K 4QJVB 2X98A 2A69A 1HDHA 4AYBL 1AJAA 1ZYRA 3TWZA 4YG2A 3GTJA 3WBHA 3BDGB 4KM4A 3TG0A 3I4MK 1XZPA 2E2IC 4XLNA 5C3EC 1I50C 4LREA 1O2BA 3GTOK 3I4NC 4XCHA 1TWCA 4A3IK 3HKZD 3GTPK 5M3FK 1K83K 3BP3A 4MEXA 3N3YA 1EW2A 2W5XA 4UORA 3DPCA 3S1MK 5CJ9A 2ZKTA 3NKRA 3DYCA 2JA7K 5EGHA 5TJ3A 4KASA 1WOSA 4AH6A 4A93C 4BY7C 4C45A 4A3JK 2NVTC 3HOXK 3S17K 1IQ0A 4KARA 3OEPA 3H0GK 3K7AK 1YX2A 1B8JA 4GTDA 1HI9A 3S15C 4ZH4A 5E68A 3HOWC 4N7TA 4C3JK 5DLWA 3CAGA 1J98A 4AYBD 3S1RK 3PO2C 2VUMC 3RZOC 1VLOA 3GTOA 5GRRA 3IGZB 1TWCK 4A3FC 1EQRA 4PABA 3HOYK 4GFQA 1Y1WC 4MQ9A 3GEHA 1PJ7A 5IYCK 4BBRK 1URAA 3UN3A 4KAWX 4P5BA 3S1QK 3GTMA 2W8DA 3CMRA 5C4JK 3UO0A 2O5JA 1PJ6A 3GTLA 1TWHK 3AD9C 1XPPA 4YR1A 3JSTA 2JA6C 2P8TA 1ELZA 3AQOA 1I3QC 3HOZK 4QIWL 3I4MC 1KH9A 1WQHA 3TTGA 1I50K 5EGEA 5IJSA 3NVLA 5LIAA 4C3HC 4ZG9A 4YFKA 1O26A 1WCMA 1EI6A 1YNJA 5FJ8K 4A3MK
chains in the Genus database with same CATH topology
5IJQA 1N2KA 3M8ZA 4ZG6A 4ZGAA 1SHQA 1EQJA 4CXKA 4MY4A 1K7HA 5LRMA 4CXUA 4UOOA 3NKQA 1O98A 3NKPA 4QAXA 3UNYA 1KHLA 3UN5A 4TN0A 1AJDA 1KH4A 4LR8A 1HQAA 5LRNA 1ZEFA 5GOVA 1E1ZP 4UPHA 4GTYA 1KHKA 4KJDA 4LRCA 2IUCB 4LRBA 1ZEBA 3BDFA 3SZYA 1ALJA 4FDIA 3WAWA 1KH7A 1ELXA 2X98A 1HDHA 2W8SA 3KD8A 3T01A 3NKOA 1AJAA 3TWZA 3B5QA 3BDHA 4CYRA 1URBA 4LRAA 5INHA 3WBHA 3NKMA 1Y6VA 4KAYA 4KAVA 3BDGB 4UOPA 4B56A 4ZG7A 4KM4A 2W5RA 5C66A 3TG0A 3A52A 3NKNA 3LXQA 5DLVA 4UPIA 2W5WA 4LREA 4LRFA 4KJGA 2W5VA 3SZZA 4CXSA 2GA3A 3M8WA 1O99A 1SHNA 2QZUA 1AUKA 1EW2A 1HJKA 2W5XA 4UORA 5HRTA 3DPCA 2G9YA 1E2SP 2ZKTA 3NKRA 3DYCA 1ED8A 4LRDA 4LR2A 5EGHA 5TJ3A 3E2DA 1FSUA 3T00A 5L0BA 3IDDA 2D1GA 3MK2A 3WAYA 1EI6A 5DLTA 2XRGA 5L0EA 3MK1A 1AJCA 3WAXA 2IUCA 1P49A 1B8JA 4UPLA 5KXAA 4N7TA 5DLWA 2VQRA 2W5SA 5AJ9A 3WAVA 1ANJA 1EW8A 2RH6A 3MK0A 5GRRA 1ELYA 3T02A 3IGZB 1N2LA 5K4PA 5LQQA 2ANHA 1URAA 2GSNA 1Y7AA 3UN3A 1EJJA 2GSOA 3UN2A 2W5QA 3IGYB 3M8YA 2GLQA 2W8DA 3CMRA 1KH5A 3OT9A 1EW9A 3UO0A 2IFYA 4GTWA 1ALKA 1KHNA 4YR1A 4GTZA 1ELZA 4LQYA 1ALHA 5L0KA 4LR9A 1ANIA 4MHXA 4GTXA 3ED4A 4FDJA 1ED9A 1KH9A 1KHJA 1ALIA 4CYSA 3BDGA 3TX0A 5EGEA 5IJSA 3Q3QA 3NVLA 2XR9A 4NWXA 4UPKA 5LIAA 1E3CP 4NWJA 4ZG9A 4LR7A 1E33P 1ZEDA 2GSUA 4MIVA 1AJBA 3M7VA 2W5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IJQ A;  1N2K A;  3M8Z A;  4ZG6 A;  4ZGA A;  1SHQ A;  1EQJ A;  4CXK A;  4MY4 A;  1K7H A;  5LRM A;  4CXU A;  4UOO A;  3NKQ A;  1O98 A;  3NKP A;  4QAX A;  3UNY A;  1KHL A;  3UN5 A;  4TN0 A;  1AJD A;  1KH4 A;  4LR8 A;  1HQA A;  5LRN A;  1ZEF A;  5GOV A;  1E1Z P;  4UPH A;  4GTY A;  1KHK A;  4KJD A;  4LRC A;  2IUC B;  4LRB A;  1ZEB A;  3BDF A;  3SZY A;  1ALJ A;  4FDI A;  3WAW A;  1KH7 A;  1ELX A;  2X98 A;  1HDH A;  2W8S A;  3KD8 A;  3T01 A;  3NKO A;  1AJA A;  3TWZ A;  3B5Q A;  3BDH A;  4CYR A;  1URB A;  4LRA A;  5INH A;  3WBH A;  3NKM A;  1Y6V A;  4KAY A;  4KAV A;  3BDG B;  4UOP A;  4B56 A;  4ZG7 A;  4KM4 A;  2W5R A;  5C66 A;  3TG0 A;  3A52 A;  3NKN A;  3LXQ A;  5DLV A;  4UPI A;  2W5W A;  4LRE A;  4LRF A;  4KJG A;  2W5V A;  3SZZ A;  4CXS A;  2GA3 A;  3M8W A;  1O99 A;  1SHN A;  2QZU A;  1AUK A;  1EW2 A;  1HJK A;  2W5X A;  4UOR A;  5HRT A;  3DPC A;  2G9Y A;  1E2S P;  2ZKT A;  3NKR A;  3DYC A;  1ED8 A;  4LRD A;  4LR2 A;  5EGH A;  5TJ3 A;  3E2D A;  1FSU A;  3T00 A;  5L0B A;  3IDD A;  2D1G A;  3MK2 A;  3WAY A;  1EI6 A;  5DLT A;  2XRG A;  5L0E A;  3MK1 A;  1AJC A;  3WAX A;  2IUC A;  1P49 A;  1B8J A;  4UPL A;  5KXA A;  4N7T A;  5DLW A;  2VQR A;  2W5S A;  5AJ9 A;  3WAV A;  1ANJ A;  1EW8 A;  2RH6 A;  3MK0 A;  5GRR A;  1ELY A;  3T02 A;  3IGZ B;  1N2L A;  5K4P A;  5LQQ A;  2ANH A;  1URA A;  2GSN A;  1Y7A A;  3UN3 A;  1EJJ A;  2GSO A;  3UN2 A;  2W5Q A;  3IGY B;  3M8Y A;  2GLQ A;  2W8D A;  3CMR A;  1KH5 A;  3OT9 A;  1EW9 A;  3UO0 A;  2IFY A;  4GTW A;  1ALK A;  1KHN A;  4YR1 A;  4GTZ A;  1ELZ A;  4LQY A;  1ALH A;  5L0K A;  4LR9 A;  1ANI A;  4MHX A;  4GTX A;  3ED4 A;  4FDJ A;  1ED9 A;  1KH9 A;  1KHJ A;  1ALI A;  4CYS A;  3BDG A;  3TX0 A;  5EGE A;  5IJS A;  3Q3Q A;  3NVL A;  2XR9 A;  4NWX A;  4UPK A;  5LIA A;  1E3C P;  4NWJ A;  4ZG9 A;  4LR7 A;  1E33 P;  1ZED A;  2GSU A;  4MIV A;  1AJB A;  3M7V A;  2W5T A; 
#chains in the Genus database with same CATH topology
 4WJ4 A;  3M8Z A;  1SHQ A;  3S0X A;  3FKI C;  4KMD A;  4A3C K;  1O2A A;  2R7Z K;  4KN4 A;  1XZQ A;  2ZFZ A;  3CQZ C;  2KWA A;  2R93 K;  2JA7 C;  1J6V A;  2B63 A;  4LOW A;  4BY7 K;  1XXA A;  4LR8 A;  3UN5 A;  5LRN A;  1O24 A;  4FM9 A;  2Y0S D;  2D6F C;  3HOU C;  5D4D A;  1E1Z P;  3H0G C;  3K7A C;  1SFO A;  1DCO A;  5IYB C;  3S15 K;  3DXJ A;  5IOT A;  2IUC B;  2W7V A;  1ZVU A;  5TMC A;  4LRB A;  5HL8 A;  1B4A A;  3FHZ A;  3M3Y K;  4A3L C;  3A8I A;  2FQO A;  4GT9 A;  1KH7 A;  2NVX K;  4LK0 A;  4KMH A;  3HOY C;  4G7O A;  2W8S A;  2P5M A;  2PMZ D;  3T01 A;  4A3K K;  3GTJ C;  4GZY A;  4WJ3 M;  1XXC A;  1URB A;  5INH A;  3A8K A;  4KAY A;  4ZG7 A;  4B56 A;  5M5Y K;  2YU9 C;  3FOF A;  1YCL A;  2E2I A;  3A52 A;  3NKN A;  3LXQ A;  5DLV A;  4UPI A;  3G4C A;  1V5V A;  1WSR A;  1DCH A;  1WOR A;  4CXS A;  2GA3 A;  1O99 A;  4BBS K;  1O27 A;  2JA8 C;  2QZU A;  5HRT A;  4DDQ A;  3TFH A;  1WOO A;  3RZD K;  3GEE A;  4A3B C;  3MML B;  2PA8 D;  4C2M K;  3E2D A;  4X6A K;  4G0W A;  3T00 A;  1PJ5 A;  3NUH A;  4G0V A;  5L0B A;  3S16 K;  4A3E K;  3ADA C;  2XRG A;  4A3M C;  5C4X C;  4BY1 K;  1KQ4 A;  3S2H K;  1IW7 A;  2Y3P A;  3MK1 A;  2E2J C;  1AJC A;  3FKI K;  4MEY A;  5M5W K;  2R93 C;  5KXA A;  1R9T C;  4Y52 C;  3IPJ A;  1I6H K;  3N0B A;  2VQR A;  2PMZ L;  4GTE A;  2RH6 A;  3GTO C;  3LAJ A;  5K4P A;  2NVY C;  3OPF A;  1Y1W A;  2JH3 A;  2GSN A;  5M5X K;  1EJJ A;  1JQW A;  2GSO A;  1L0W A;  4KMA A;  2W5Q A;  2A6E A;  2WB1 L;  3GTK A;  3GTM C;  1KH5 A;  4GTW A;  3AD8 C;  1O25 A;  3AD7 C;  1ALK A;  1KHN A;  3GTQ C;  3GEI A;  1ANI A;  4OIR A;  3GTP C;  1ED9 A;  1I3Q A;  5IP9 C;  2R92 K;  3BDG A;  3TX0 A;  3H3V L;  2Y0S L;  2XR9 A;  4UPK A;  1E3C P;  4NWJ A;  3S1R C;  3PO2 K;  2CW0 A;  1WCM C;  4A3D K;  1ZED A;  2A68 A;  1YNN A;  5CHP A;  5JVO A;  3FKI A;  3L4J A;  1K7H A;  3HKZ L;  3VA7 A;  1TWG K;  3ORE A;  3CQZ A;  3FOE A;  4G7Z A;  2NVX A;  4UOO A;  2JA7 A;  4A3G K;  1KHL A;  3S1Q C;  3HOW K;  4GTF A;  1J6X A;  1ZEF A;  5C4X K;  4BY1 C;  5GOV A;  4BKW A;  1SFO C;  4UPH A;  5IP7 C;  1EFW A;  3HOV K;  1IS1 A;  4KJD A;  1VJE A;  2RGR A;  1R9T K;  2V6U A;  5C44 K;  5L46 A;  3BDF A;  1ALJ A;  4YFN A;  3M4O K;  1ELX A;  4GTA A;  3NKO A;  2JA6 K;  3B5Q A;  1GE9 A;  3NKM A;  1Y6V A;  2CFA A;  4UOP A;  5IYD C;  2YU9 A;  5C66 A;  4C3I K;  1SMY A;  3S17 C;  1I3Q K;  4YFX A;  3HOZ C;  4KC6 A;  1TWA A;  3LPX A;  4LRF A;  4KJG A;  4KB2 A;  4BLA A;  1IBA A;  2W5V A;  4KM9 A;  4C3J C;  1O28 A;  3M8W A;  4Y7N C;  1AUK A;  2VUM K;  1ZQ1 C;  2G9Y A;  3S14 C;  4PAA A;  3GTL K;  1ED8 A;  1TWH A;  4BXX K;  2JA5 K;  1Y1W K;  1TWG A;  2GAG C;  5IYC C;  1FSU A;  3GTG A;  2E2H K;  3IDD A;  3WAY A;  5IOR A;  5DLT A;  4A3L K;  5IOS A;  2R7Z A;  3A8J A;  4KDD A;  3WAX A;  3AQP A;  3AH5 A;  2V6S A;  3HOU K;  3L4K A;  3GDZ A;  4UPL A;  1BDF A;  2R93 A;  1R9T A;  1I6V A;  5AJ9 A;  3WAV A;  3S2D K;  1F93 A;  4QJV A;  4M1X A;  1Y1V K;  2PA8 L;  4LJZ A;  5JFE A;  5FLM C;  1ELY A;  3V4G A;  3T02 A;  5IP7 K;  2NVY A;  5LQQ A;  4OIP A;  4OIO A;  4O2D A;  1BS2 A;  3GTJ K;  3H3V D;  1UV7 A;  3GTK C;  3M8Y A;  2GLQ A;  1G51 A;  1USM A;  3OT9 A;  1EW9 A;  1TWA K;  3TFI A;  4GTZ A;  4LQY A;  3GTQ A;  1IE0 A;  1ALH A;  5L0K A;  2EBB A;  4LR9 A;  4XLP A;  1K83 A;  3QX3 A;  1TWF K;  2E2I K;  4OIQ A;  3GTP A;  3ED4 A;  3RZO K;  5IYD K;  5C3E K;  4C3I C;  4GTL A;  3I4N K;  2CFA B;  4GTB A;  3Q3Q A;  4Y52 K;  4NWX A;  4KN7 A;  2O5I A;  1INN A;  4P9S A;  5IYB K;  3GTG K;  2WAQ L;  1E33 P;  4WIL A;  2GSU A;  2ZUE A;  1AJB A;  3M7V A;  2W5T A;  5C4J C;  5IJQ A;  4BLB A;  4CXK A;  1EQJ A;  2NVY K;  3PO3 K;  3N0C A;  4J3N A;  2E2J K;  2NVX C;  4LK1 A;  3NKP A;  5M3M K;  3UNY A;  2JA5 C;  2ZUF A;  2E2H C;  3GTM K;  4A3I C;  4TN0 A;  1JVI A;  1HQA A;  1WSV A;  1B4B A;  1ZXO A;  4GTY A;  4ILD A;  1KHK A;  4KMU A;  4C3H K;  1WQF A;  1TWF A;  1XXB A;  4KM8 A;  1ZEB A;  2R92 C;  2XCQ A;  4A93 K;  1WOP A;  1Y1V C;  3WAW A;  3LAP A;  3RZD C;  3KD8 A;  1O29 A;  1F7V A;  3GTQ K;  3ERE D;  4Q5S A;  3BDH A;  3S1N K;  4LRA A;  4CYR A;  4KAV A;  2PPB A;  3GTK K;  2W5R A;  2WAQ D;  3HXA A;  3S2H C;  1I50 A;  1TWA C;  2A6H A;  2W5W A;  2BE5 A;  1VH2 A;  1TWC C;  2WB1 D;  4A3F K;  3SZZ A;  4G0U A;  1I6H C;  1SHN A;  1AB4 A;  1XZQ B;  1HJK A;  1BJT A;  1SFO K;  3HOV C;  1E2S P;  4KAT A;  4LRD A;  1TWH C;  4LR2 A;  2NVQ C;  1F9N A;  1TWG C;  3GSI A;  4XSZ A;  2B63 K;  3GTG C;  4A3G C;  3EQL A;  2D1G A;  3MK2 A;  2GAH C;  5L0E A;  2R7Z C;  3BUE A;  4Q4Z A;  2IUC A;  4P5A A;  3PO3 C;  4KB4 A;  1P49 A;  1RU0 A;  1VRQ C;  1BGW A;  3GIR A;  2W5S A;  1USO A;  2JA8 K;  1ANJ A;  1EW8 A;  2XCR B;  1EH1 A;  1WQG A;  5IP9 K;  2VUM A;  3MK0 A;  4G7H A;  4A3B K;  1ISE A;  1N2L A;  1IL2 A;  4A3C C;  2ANH A;  1Y7A A;  3CQZ K;  4Y7N K;  1XZP B;  1WCM K;  3S16 C;  3UN2 A;  4A3D C;  4XSX A;  3IGY B;  2IFY A;  3GTL C;  4BXX C;  1EK8 A;  3G4A A;  2JA6 A;  4A3K C;  5TMF A;  2FQT A;  4FZB A;  4JK1 A;  3WOD A;  1K83 C;  3TFJ A;  3S1N C;  4MHX A;  4GTX A;  4FDJ A;  1O2F B;  3S1M C;  4RMF A;  4QIW D;  1ALI A;  1KHJ A;  4CYS A;  3M3Y C;  1C0A A;  4LR7 A;  3S2D C;  4BBS C;  5C44 C;  4MIV A;  5FLM K;  1JOE A;  1WIH A;  4A3J C;  2NVT K;  3HOX C;  1N2K A;  1VGX A;  1ZBS A;  4ZG6 A;  4ZGA A;  5LRM A;  4MY4 A;  2YU9 K;  4CXU A;  3M4O C;  2XCO A;  3NKQ A;  4C2M C;  1O98 A;  4QAX A;  2NVQ K;  2JA5 A;  3BP8 C;  2B63 C;  2E2H A;  1DD5 A;  1AJD A;  1KH4 A;  5IOQ A;  3H0G A;  1HQM A;  4GTC A;  4LLG A;  1F7U A;  4LRC A;  4BBR C;  1J6W A;  1TWF C;  2PHC B;  1X31 C;  2V6T A;  4X6A C;  3SZY A;  2R92 A;  4FDI A;  1Y1V A;  4A3E C;  4OIN A;  1DCP A;  4NOI A;  3S14 K;  4QJV B;  2X98 A;  2A69 A;  1HDH A;  4AYB L;  1AJA A;  1ZYR A;  3TWZ A;  4YG2 A;  3GTJ A;  3WBH A;  3BDG B;  4KM4 A;  3TG0 A;  3I4M K;  1XZP A;  2E2I C;  4XLN A;  5C3E C;  1I50 C;  4LRE A;  1O2B A;  3GTO K;  3I4N C;  4XCH A;  1TWC A;  4A3I K;  3HKZ D;  3GTP K;  5M3F K;  1K83 K;  3BP3 A;  4MEX A;  3N3Y A;  1EW2 A;  2W5X A;  4UOR A;  3DPC A;  3S1M K;  5CJ9 A;  2ZKT A;  3NKR A;  3DYC A;  2JA7 K;  5EGH A;  5TJ3 A;  4KAS A;  1WOS A;  4AH6 A;  4A93 C;  4BY7 C;  4C45 A;  4A3J K;  2NVT C;  3HOX K;  3S17 K;  1IQ0 A;  4KAR A;  3OEP A;  3H0G K;  3K7A K;  1YX2 A;  1B8J A;  4GTD A;  1HI9 A;  3S15 C;  4ZH4 A;  5E68 A;  3HOW C;  4N7T A;  4C3J K;  5DLW A;  3CAG A;  1J98 A;  4AYB D;  3S1R K;  3PO2 C;  2VUM C;  3RZO C;  1VLO A;  3GTO A;  5GRR A;  3IGZ B;  1TWC K;  4A3F C;  1EQR A;  4PAB A;  3HOY K;  4GFQ A;  1Y1W C;  4MQ9 A;  3GEH A;  1PJ7 A;  5IYC K;  4BBR K;  1URA A;  3UN3 A;  4KAW X;  4P5B A;  3S1Q K;  3GTM A;  2W8D A;  3CMR A;  5C4J K;  3UO0 A;  2O5J A;  1PJ6 A;  3GTL A;  1TWH K;  3AD9 C;  1XPP A;  4YR1 A;  3JST A;  2JA6 C;  2P8T A;  1ELZ A;  3AQO A;  1I3Q C;  3HOZ K;  4QIW L;  3I4M C;  1KH9 A;  1WQH A;  3TTG A;  1I50 K;  5EGE A;  5IJS A;  3NVL A;  5LIA A;  4C3H C;  4ZG9 A;  4YFK A;  1O26 A;  1WCM A;  1EI6 A;  1YNJ A;  5FJ8 K;  4A3M K; 
#chains in the Genus database with same CATH homology
 5IJQ A;  1N2K A;  3M8Z A;  4ZG6 A;  4ZGA A;  1SHQ A;  1EQJ A;  4CXK A;  4MY4 A;  1K7H A;  5LRM A;  4CXU A;  4UOO A;  3NKQ A;  1O98 A;  3NKP A;  4QAX A;  3UNY A;  1KHL A;  3UN5 A;  4TN0 A;  1AJD A;  1KH4 A;  4LR8 A;  1HQA A;  5LRN A;  1ZEF A;  5GOV A;  1E1Z P;  4UPH A;  4GTY A;  1KHK A;  4KJD A;  4LRC A;  2IUC B;  4LRB A;  1ZEB A;  3BDF A;  3SZY A;  1ALJ A;  4FDI A;  3WAW A;  1KH7 A;  1ELX A;  2X98 A;  1HDH A;  2W8S A;  3KD8 A;  3T01 A;  3NKO A;  1AJA A;  3TWZ A;  3B5Q A;  3BDH A;  4CYR A;  1URB A;  4LRA A;  5INH A;  3WBH A;  3NKM A;  1Y6V A;  4KAY A;  4KAV A;  3BDG B;  4UOP A;  4B56 A;  4ZG7 A;  4KM4 A;  2W5R A;  5C66 A;  3TG0 A;  3A52 A;  3NKN A;  3LXQ A;  5DLV A;  4UPI A;  2W5W A;  4LRE A;  4LRF A;  4KJG A;  2W5V A;  3SZZ A;  4CXS A;  2GA3 A;  3M8W A;  1O99 A;  1SHN A;  2QZU A;  1AUK A;  1EW2 A;  1HJK A;  2W5X A;  4UOR A;  5HRT A;  3DPC A;  2G9Y A;  1E2S P;  2ZKT A;  3NKR A;  3DYC A;  1ED8 A;  4LRD A;  4LR2 A;  5EGH A;  5TJ3 A;  3E2D A;  1FSU A;  3T00 A;  5L0B A;  3IDD A;  2D1G A;  3MK2 A;  3WAY A;  1EI6 A;  5DLT A;  2XRG A;  5L0E A;  3MK1 A;  1AJC A;  3WAX A;  2IUC A;  1P49 A;  1B8J A;  4UPL A;  5KXA A;  4N7T A;  5DLW A;  2VQR A;  2W5S A;  5AJ9 A;  3WAV A;  1ANJ A;  1EW8 A;  2RH6 A;  3MK0 A;  5GRR A;  1ELY A;  3T02 A;  3IGZ B;  1N2L A;  5K4P A;  5LQQ A;  2ANH A;  1URA A;  2GSN A;  1Y7A A;  3UN3 A;  1EJJ A;  2GSO A;  3UN2 A;  2W5Q A;  3IGY B;  3M8Y A;  2GLQ A;  2W8D A;  3CMR A;  1KH5 A;  3OT9 A;  1EW9 A;  3UO0 A;  2IFY A;  4GTW A;  1ALK A;  1KHN A;  4YR1 A;  4GTZ A;  1ELZ A;  4LQY A;  1ALH A;  5L0K A;  4LR9 A;  1ANI A;  4MHX A;  4GTX A;  3ED4 A;  4FDJ A;  1ED9 A;  1KH9 A;  1KHJ A;  1ALI A;  4CYS A;  3BDG A;  3TX0 A;  5EGE A;  5IJS A;  3Q3Q A;  3NVL A;  2XR9 A;  4NWX A;  4UPK A;  5LIA A;  1E3C P;  4NWJ A;  4ZG9 A;  4LR7 A;  1E33 P;  1ZED A;  2GSU A;  4MIV A;  1AJB A;  3M7V A;  2W5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...