1A8BA

Rat annexin v complexed with glycerophosphoethanolamine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
318
structure length
318
Chain Sequence
ALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords ANNEXIN V
publication title Ca(2+)-bridging mechanism and phospholipid head group recognition in the membrane-binding protein annexin V.
pubmed doi rcsb
total genus 122
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8bA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8bA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8bA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1a8bA03
2HYVA 2IICA 1HVDA 2HYUA 1HAKA 1BCZA 1HM6A 1HVGA 1N41A 3BRXA 1W3WA 1A8AA 1AVCA 1I4AA 1BCWA 1M9IA 2ZOCA 1YJ0A 1AVHA 1BC1A 1BO9A 4EVHA 1N00A 1DK5A 4MDVA 1G5NA 1SAVA 1MCXA 2HYWA 2H0LA 2Q4CA 1YCNA 1YIIA 2ZHIA 4MDUA 1N44A 2IE6A 1BC0A 1AVRA 1XJLA 4EVFA 1AIIA 1ANNA 1BC3A 1BCYA 2H0KA 2RANA 4X9PA 1N42A 1AXNA 1ANWA 1AEIA 1A8BA 2H0MA 2ZHJA 1HVFA 2XO2A 2IE7A 4HREA 1AOWA 1W7BA 2XO3A 1DM5A 1HVEA 1W45A 2II2A 1ANXA 1ALAA
chains in the Genus database with same CATH superfamily
2IICA 1R8SE 1N41A 1AVCA 1I4AA 1BCWA 1XT0B 2ZOCA 1YJ0A 3USWA 4JK1X 1PBVA 4OIYA 4EVHA 4MDVA 4JMIA 1G5NA 4Q2SA 2ZHIA 4MDUA 4EVFA 1BC0A 2K6XA 4Z21A 1AIIA 3TW5A 2H0KA 1BC9A 1ANWA 1A8BA 1AEIA 1UPTB 2ZHJA 3AO0A 2IE7A 1AOWA 4D7RA 1DM5A 1XSZA 1HVDA 4D7QA 2HYUA 1HAKA 1BCZA 1R8QE 2R09A 1M9IA 1YGMA 1AVHA 4L5MA 1N00A 1DK5A 3ABOA 1SAVA 1MCXA 2HYWA 1YIIA 1N44A 2OY9A 4JXHA 4X9PA 3ANYA 3L8NA 1AXNA 1RE0B 1HVFA 2R0DA 4A4PA 2XO3A 1W45A 4KN7X 1S9DE 3BRXA 1W3WA 1A8AA 4FHRB 4JWLA 3SOHB 2IE6A 1XJLA 4C7PA 1QC7A 1BC3A 1Q8DA 1BCYA 2RANA 1N42A 3HJLA 3ABSA 2HSNA 3LTLA 2H0MA 1W7BA 1KU1A 1R4AE 2VXGA 3ABRA 3USYA 2HYVA 1R8ME 2QEZA 1HM6A 1HVGA 1BC1A 1BO9A 4KMUX 2H0LA 2Q4CA 1YCNA 1AVRA 1C1KA 1ANNA 4KN4X 3SWVA 3AJCA 4JMOA 4C0AA 2XO2A 3ABQA 4HREA 4FQ0C 1HVEA 2II2A 1ANXA 1ALAA 1LKVX
chains in the Genus database with same CATH topology
2HYVA 2IICA 1HVDA 2HYUA 1HAKA 1BCZA 1HM6A 1HVGA 1N41A 3BRXA 1W3WA 1A8AA 1AVCA 1I4AA 1BCWA 1M9IA 2ZOCA 1YJ0A 1AVHA 1BC1A 1BO9A 4EVHA 1N00A 1DK5A 4MDVA 1G5NA 1SAVA 1MCXA 2HYWA 2H0LA 2Q4CA 1YCNA 1YIIA 2ZHIA 4MDUA 1N44A 2IE6A 1BC0A 1AVRA 1XJLA 4EVFA 1AIIA 1ANNA 1BC3A 1BCYA 2H0KA 2RANA 4X9PA 1N42A 1AXNA 1ANWA 1AEIA 1A8BA 2H0MA 2ZHJA 1HVFA 2XO2A 2IE7A 4HREA 1AOWA 1W7BA 2XO3A 1DM5A 1HVEA 1W45A 2II2A 1ANXA 1ALAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYV A;  2IIC A;  1HVD A;  2HYU A;  1HAK A;  1BCZ A;  1HM6 A;  1HVG A;  1N41 A;  3BRX A;  1W3W A;  1A8A A;  1AVC A;  1I4A A;  1BCW A;  1M9I A;  2ZOC A;  1YJ0 A;  1AVH A;  1BC1 A;  1BO9 A;  4EVH A;  1N00 A;  1DK5 A;  4MDV A;  1G5N A;  1SAV A;  1MCX A;  2HYW A;  2H0L A;  2Q4C A;  1YCN A;  1YII A;  2ZHI A;  4MDU A;  1N44 A;  2IE6 A;  1BC0 A;  1AVR A;  1XJL A;  4EVF A;  1AII A;  1ANN A;  1BC3 A;  1BCY A;  2H0K A;  2RAN A;  4X9P A;  1N42 A;  1AXN A;  1ANW A;  1AEI A;  1A8B A;  2H0M A;  2ZHJ A;  1HVF A;  2XO2 A;  2IE7 A;  4HRE A;  1AOW A;  1W7B A;  2XO3 A;  1DM5 A;  1HVE A;  1W45 A;  2II2 A;  1ANX A;  1ALA A; 
#chains in the Genus database with same CATH topology
 2IIC A;  1R8S E;  1N41 A;  1AVC A;  1I4A A;  1BCW A;  1XT0 B;  2ZOC A;  1YJ0 A;  3USW A;  4JK1 X;  1PBV A;  4OIY A;  4EVH A;  4MDV A;  4JMI A;  1G5N A;  4Q2S A;  2ZHI A;  4MDU A;  4EVF A;  1BC0 A;  2K6X A;  4Z21 A;  1AII A;  3TW5 A;  2H0K A;  1BC9 A;  1ANW A;  1A8B A;  1AEI A;  1UPT B;  2ZHJ A;  3AO0 A;  2IE7 A;  1AOW A;  4D7R A;  1DM5 A;  1XSZ A;  1HVD A;  4D7Q A;  2HYU A;  1HAK A;  1BCZ A;  1R8Q E;  2R09 A;  1M9I A;  1YGM A;  1AVH A;  4L5M A;  1N00 A;  1DK5 A;  3ABO A;  1SAV A;  1MCX A;  2HYW A;  1YII A;  1N44 A;  2OY9 A;  4JXH A;  4X9P A;  3ANY A;  3L8N A;  1AXN A;  1RE0 B;  1HVF A;  2R0D A;  4A4P A;  2XO3 A;  1W45 A;  4KN7 X;  1S9D E;  3BRX A;  1W3W A;  1A8A A;  4FHR B;  4JWL A;  3SOH B;  2IE6 A;  1XJL A;  4C7P A;  1QC7 A;  1BC3 A;  1Q8D A;  1BCY A;  2RAN A;  1N42 A;  3HJL A;  3ABS A;  2HSN A;  3LTL A;  2H0M A;  1W7B A;  1KU1 A;  1R4A E;  2VXG A;  3ABR A;  3USY A;  2HYV A;  1R8M E;  2QEZ A;  1HM6 A;  1HVG A;  1BC1 A;  1BO9 A;  4KMU X;  2H0L A;  2Q4C A;  1YCN A;  1AVR A;  1C1K A;  1ANN A;  4KN4 X;  3SWV A;  3AJC A;  4JMO A;  4C0A A;  2XO2 A;  3ABQ A;  4HRE A;  4FQ0 C;  1HVE A;  2II2 A;  1ANX A;  1ALA A;  1LKV X; 
#chains in the Genus database with same CATH homology
 2HYV A;  2IIC A;  1HVD A;  2HYU A;  1HAK A;  1BCZ A;  1HM6 A;  1HVG A;  1N41 A;  3BRX A;  1W3W A;  1A8A A;  1AVC A;  1I4A A;  1BCW A;  1M9I A;  2ZOC A;  1YJ0 A;  1AVH A;  1BC1 A;  1BO9 A;  4EVH A;  1N00 A;  1DK5 A;  4MDV A;  1G5N A;  1SAV A;  1MCX A;  2HYW A;  2H0L A;  2Q4C A;  1YCN A;  1YII A;  2ZHI A;  4MDU A;  1N44 A;  2IE6 A;  1BC0 A;  1AVR A;  1XJL A;  4EVF A;  1AII A;  1ANN A;  1BC3 A;  1BCY A;  2H0K A;  2RAN A;  4X9P A;  1N42 A;  1AXN A;  1ANW A;  1AEI A;  1A8B A;  2H0M A;  2ZHJ A;  1HVF A;  2XO2 A;  2IE7 A;  4HRE A;  1AOW A;  1W7B A;  2XO3 A;  1DM5 A;  1HVE A;  1W45 A;  2II2 A;  1ANX A;  1ALA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...