1HVEA

Structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
312
structure length
312
Chain Sequence
LRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFQKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title Structural and electrophysiological analysis of annexin V mutants. Mutagenesis of human annexin V, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding
total genus 125
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hveA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hveA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hveA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hveA03
2RANA 1AIIA 1BC3A 2XO3A 1ANWA 1AVCA 1N00A 2XO2A 1BC1A 4MDUA 1BO9A 1BCYA 1HVDA 4EVFA 1BCZA 1M9IA 1N42A 1SAVA 2ZHJA 1YIIA 2IICA 1W7BA 1MCXA 2HYVA 1HVFA 2Q4CA 4HREA 1DM5A 1DK5A 1ANNA 1W3WA 2IE6A 2H0LA 1AEIA 1YJ0A 1HM6A 2H0MA 1HAKA 2H0KA 2HYUA 1BCWA 1N41A 2ZOCA 1W45A 1HVEA 4EVHA 1N44A 4MDVA 1BC0A 1I4AA 2II2A 1A8AA 1A8BA 1XJLA 1AXNA 1G5NA 2IE7A 3BRXA 4X9PA 1AVRA 2HYWA 1ALAA 1ANXA 1HVGA 1AVHA 2ZHIA 1YCNA 1AOWA
chains in the Genus database with same CATH superfamily
1AIIA 1BC3A 2XO2A 3AJCA 4MDUA 4OIYA 1XSZA 1M9IA 4JXHA 2ZHJA 4JMIA 4KN7X 2Q4CA 4FQ0C 1ANNA 1KU1A 3SWVA 4D7QA 1YJ0A 2HYUA 1BCWA 1I4AA 2IE7A 4JK1X 1ANXA 2R09A 1PBVA 3ANYA 1AOWA 4JWLA 1R8ME 2RANA 4EVFA 3SOHB 3TW5A 1N00A 1C1KA 1BCYA 1BCZA 1YIIA 2OY9A 1DM5A 1W3WA 1R8QE 2H0LA 1HAKA 2H0KA 3LTLA 1R4AE 4EVHA 1BC0A 3BRXA 1S9DE 1G5NA 4KMUX 3ABSA 1ALAA 3AO0A 1YCNA 1YGMA 1AEIA 3ABQA 2XO3A 1BC1A 1HVDA 1N42A 1Q8DA 1SAVA 1MCXA 1HVFA 2HSNA 3HJLA 1DK5A 3USYA 1HM6A 1QC7A 1LKVX 4FHRB 4C0AA 4L5MA 1BC9A 2QEZA 2ZOCA 1HVEA 2K6XA 4MDVA 4Z21A 2II2A 4X9PA 1A8AA 1A8BA 1AXNA 2HYWA 3L8NA 1HVGA 2VXGA 4KN4X 1UPTB 3USWA 1RE0B 1ANWA 1AVCA 1BO9A 4C7PA 4Q2SA 4A4PA 2IICA 1W7BA 2HYVA 4HREA 1XT0B 2R0DA 4D7RA 2IE6A 2H0MA 3ABOA 1N41A 1W45A 1N44A 3ABRA 1XJLA 4JMOA 1AVRA 1AVHA 2ZHIA 1R8SE
chains in the Genus database with same CATH topology
2RANA 1AIIA 1BC3A 2XO3A 1ANWA 1AVCA 1N00A 2XO2A 1BC1A 4MDUA 1BO9A 1BCYA 1HVDA 4EVFA 1BCZA 1M9IA 1N42A 1SAVA 2ZHJA 1YIIA 2IICA 1W7BA 1MCXA 2HYVA 1HVFA 2Q4CA 4HREA 1DM5A 1DK5A 1ANNA 1W3WA 2IE6A 2H0LA 1AEIA 1YJ0A 1HM6A 2H0MA 1HAKA 2H0KA 2HYUA 1BCWA 1N41A 2ZOCA 1W45A 1HVEA 4EVHA 1N44A 4MDVA 1BC0A 1I4AA 2II2A 1A8AA 1A8BA 1XJLA 1AXNA 1G5NA 2IE7A 3BRXA 4X9PA 1AVRA 2HYWA 1ALAA 1ANXA 1HVGA 1AVHA 2ZHIA 1YCNA 1AOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAN A;  1AII A;  1BC3 A;  2XO3 A;  1ANW A;  1AVC A;  1N00 A;  2XO2 A;  1BC1 A;  4MDU A;  1BO9 A;  1BCY A;  1HVD A;  4EVF A;  1BCZ A;  1M9I A;  1N42 A;  1SAV A;  2ZHJ A;  1YII A;  2IIC A;  1W7B A;  1MCX A;  2HYV A;  1HVF A;  2Q4C A;  4HRE A;  1DM5 A;  1DK5 A;  1ANN A;  1W3W A;  2IE6 A;  2H0L A;  1AEI A;  1YJ0 A;  1HM6 A;  2H0M A;  1HAK A;  2H0K A;  2HYU A;  1BCW A;  1N41 A;  2ZOC A;  1W45 A;  1HVE A;  4EVH A;  1N44 A;  4MDV A;  1BC0 A;  1I4A A;  2II2 A;  1A8A A;  1A8B A;  1XJL A;  1AXN A;  1G5N A;  2IE7 A;  3BRX A;  4X9P A;  1AVR A;  2HYW A;  1ALA A;  1ANX A;  1HVG A;  1AVH A;  2ZHI A;  1YCN A;  1AOW A; 
#chains in the Genus database with same CATH topology
 1AII A;  1BC3 A;  2XO2 A;  3AJC A;  4MDU A;  4OIY A;  1XSZ A;  1M9I A;  4JXH A;  2ZHJ A;  4JMI A;  4KN7 X;  2Q4C A;  4FQ0 C;  1ANN A;  1KU1 A;  3SWV A;  4D7Q A;  1YJ0 A;  2HYU A;  1BCW A;  1I4A A;  2IE7 A;  4JK1 X;  1ANX A;  2R09 A;  1PBV A;  3ANY A;  1AOW A;  4JWL A;  1R8M E;  2RAN A;  4EVF A;  3SOH B;  3TW5 A;  1N00 A;  1C1K A;  1BCY A;  1BCZ A;  1YII A;  2OY9 A;  1DM5 A;  1W3W A;  1R8Q E;  2H0L A;  1HAK A;  2H0K A;  3LTL A;  1R4A E;  4EVH A;  1BC0 A;  3BRX A;  1S9D E;  1G5N A;  4KMU X;  3ABS A;  1ALA A;  3AO0 A;  1YCN A;  1YGM A;  1AEI A;  3ABQ A;  2XO3 A;  1BC1 A;  1HVD A;  1N42 A;  1Q8D A;  1SAV A;  1MCX A;  1HVF A;  2HSN A;  3HJL A;  1DK5 A;  3USY A;  1HM6 A;  1QC7 A;  1LKV X;  4FHR B;  4C0A A;  4L5M A;  1BC9 A;  2QEZ A;  2ZOC A;  1HVE A;  2K6X A;  4MDV A;  4Z21 A;  2II2 A;  4X9P A;  1A8A A;  1A8B A;  1AXN A;  2HYW A;  3L8N A;  1HVG A;  2VXG A;  4KN4 X;  1UPT B;  3USW A;  1RE0 B;  1ANW A;  1AVC A;  1BO9 A;  4C7P A;  4Q2S A;  4A4P A;  2IIC A;  1W7B A;  2HYV A;  4HRE A;  1XT0 B;  2R0D A;  4D7R A;  2IE6 A;  2H0M A;  3ABO A;  1N41 A;  1W45 A;  1N44 A;  3ABR A;  1XJL A;  4JMO A;  1AVR A;  1AVH A;  2ZHI A;  1R8S E; 
#chains in the Genus database with same CATH homology
 2RAN A;  1AII A;  1BC3 A;  2XO3 A;  1ANW A;  1AVC A;  1N00 A;  2XO2 A;  1BC1 A;  4MDU A;  1BO9 A;  1BCY A;  1HVD A;  4EVF A;  1BCZ A;  1M9I A;  1N42 A;  1SAV A;  2ZHJ A;  1YII A;  2IIC A;  1W7B A;  1MCX A;  2HYV A;  1HVF A;  2Q4C A;  4HRE A;  1DM5 A;  1DK5 A;  1ANN A;  1W3W A;  2IE6 A;  2H0L A;  1AEI A;  1YJ0 A;  1HM6 A;  2H0M A;  1HAK A;  2H0K A;  2HYU A;  1BCW A;  1N41 A;  2ZOC A;  1W45 A;  1HVE A;  4EVH A;  1N44 A;  4MDV A;  1BC0 A;  1I4A A;  2II2 A;  1A8A A;  1A8B A;  1XJL A;  1AXN A;  1G5N A;  2IE7 A;  3BRX A;  4X9P A;  1AVR A;  2HYW A;  1ALA A;  1ANX A;  1HVG A;  1AVH A;  2ZHI A;  1YCN A;  1AOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...