2HSNA

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MSFLISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFDANAILRYVMDDFEGQTSDKYQFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPLTTTDLILFANVYALNSSLVHSKFPELPSKVHNAVALAKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 42
structure length 160
sequence length 160
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09635 MetRS-N MetRS-N binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.140 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2hsnA01
1.20.1050.110 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsnA02
2HSNA
chains in the Genus database with same CATH superfamily
4W66A 1TW9A 4HZ4A 3IK7A 3FYGA 1RE0B 1G6YA 2HYVA 4USSA 1HVEA 3ABQA 4YAPA 5DAKA 1SVOA 1GSQA 4QQ7A 2IE6A 1HM6A 1BC0A 2WB9A 5EY6A 2C80A 2F3MA 3GSTA 2IL3A 1MD3A 4MF7A 1R5AA 1DK5A 3WD6A 4BVXB 1BAYA 4RI6A 2HSNA 1KBNA 2R09A 2HYUA 2WDUA 1BG5A 1B48A 3GSSA 3G7IA 5D9VA 6GSUA 2IMKA 4PTSA 1R8ME 1YVLA 1N44A 20GSA 1VF3A 5AN1A 3EE2A 4EDYA 4MK3A 1BX9A 1GWCA 3Q74A 2IE7A 2H1LA 4EC0A 2YV9A 4KDXA 3AY8A 1AEIA 3R2QA 3VI7A 5DJLA 1EV4A 4ZBDA 2R5GA 5ECOB 2FHEA 3LQ7A 1UPTB 2O36A 3KXOA 1C1KA 1PBVA 3CWGA 5EVOA 5D9TA 4AKXB 5ECQB 3CSIA 3UVHA 3F6DA 3QAWA 3CBUA 4KDUA 6GSWA 1B8XA 1GLQA 2C3TA 5J47A 3DD3A 1DM5A 1GSYA 1G6WA 18GSA 4OMVA 3W8SA 5GZZB 2VD1A 3QR6A 3HMJG 1M9BA 3TOUA 1Q4JA 1XW6A 1XT0B 5ECKB 4ECJA 2PGTA 2ZHIA 2DC5A 7GSSA 1U87A 3KM6A 2LJRA 3D0ZA 1BC3A 2EFHA 1PL1A 1XW5A 3HKRA 1W3WA 3IBHA 2C8UA 2YCDA 4NHWA 4A4PA 1GTIA 1UA5A 3Q18A 3ABOA 1PMTA 3ABRA 1YCNA 1V40A 1PX7A 1PA3A 3FR6A 17GSA 4FXYP 3M3MA 4Z21A 1K0BA 2O5VA 22GSA 4HJ2A 4IELA 2PMTA 4JK1X 4G01A 4PHZC 16GSA 1AVCA 5ECIB 3EINA 8GSSA 1G7OA 1F3AA 3AJCA 4PI0C 2HRAA 4GSNA 5F07A 5HFKA 5J41A 1FW1A 1BCZA 1S4BP 1K0OA 2VXGA 3F63A 1PKWA 1M9IA 4BVYB 1BC1A 3FY7A 2HYWA 1BF5A 4EXJA 4EVFA 1GUKA 2X64A 5A5KA 1GSSA 1MCXA 4EVHA 5A4UA 1K3YA 3TW5A 2HRKB 1ZL9A 4AKHA 4MF6A 2H0MA 1U88A 4C0AA 1M9AA 2O3EA 1KU1A 1XJLA 2R3XA 4ZBAA 2F8FA 4PGTA 3UAPA 4ACSA 1BCWA 1XWGA 3M1GA 1OE8A 4IKHA 3LSZA 3SOHB 2WJUA 3GTUA 3VPQA 3TGZA 2GLRA 1JZRA 4IQAA 4G0IA 5GSTA 4X9PA 1LBKA 1PN9A 1SVLA 4N0VA 1FHEA 10GSA 2IMIA 3I69A 3CSJA 2CA8A 1GLPA 1YIIA 5DDLA 2OADA 4PI2C 5F0GA 5ECHB 1YJ0A 4Q2SA 1GUMA 1HNBA 3QAVA 9GSSA 2DSAA 5DALB 1ANNA 5IQYA 4L5LA 4HI7A 5BMUB 3BBYA 2GSRA 4ZBBA 3VURA 2AAWA 3M8NA 6GSYA 1BO9A 4RI7A 3AO0A 3U6VA 1K0NA 1Y6EA 3FR3A 3ZMKA 3LJRA 3I6AA 3KTLA 5LCZA 3FR9A 13GSA 1YJ6A 3TOTA 3ZMLA 3HJMA 1IYIA 2CAQA 1AVHA 2VCQA 1BCYA 1JLWA 4JXHA 1K0AA 2ON7A 3HJOA 1GTAA 3VLNA 4G0KA 2HNLA 1PD21 1Y1UA 4ECCA 1AQWA 3RGBC 1BG1A 3QAGA 5ECPB 4DEJA 4F0BA 2C3NA 4C7PA 2EFEA 2HSMB 1I1IP 3VWXA 2CZ3A 5A5HB 1DUGA 1F3BA 1LJRA 5F05A 4IQ1A 4YQMA 4BVXA 2J9HA 4FQUA 5A4VA 2QEZA 1GNWA 2C4JA 1HAKA 2AHEA 5A1NB 4ID0A 3GUSA 1AXNA 2R0DA 3UBKA 3UBLA 3USYA 4MDVA 4KSMA 1YEWC 1MD4A 3IE3A 1OE7A 4KGIA 1XSZA 4OFMA 4I97A 14GSA 2HQTA 4KN4X 1PX6A 4L5MA 1K3LA 1BYEA 5JCWA 2K6XA 1K3OA 5F06A 5F8BA 1G5NA 4GCIA 4QMKA 2FNOA 4PQHA 3IC8A 3P8WA 4PNFA 4KDYA 2C3QA 1K0DA 4ZB6A 2VD0A 1SVMA 3LXTA 4K0GA 2R4VA 4KX4A 4Q5RA 3LTLA 3ABSA 1EOHA 1E6BA 4ZXGA 4AI6A 1R8QE 1A0FA 1PKZA 3L0HA 4YH2A 5A1NA 4ECIA 1IYHA 2UV8G 12GSA 3MDKA 2R6KA 1EEMA 5ECMB 1HVGA 5GSSA 2WVZA 5AGYA 4IGJA 2H0KA 1I4AA 1YY7A 1ML6A 1GSEA 3FRCA 4Q5NA 4AKGA 5JCUA 1OYJA 2VCWA 4KAEA 4MDCA 1GSUA 4PX1A 4D7RA 5J4YA 2PBJA 1PL2A 4OFTA 1TU8A 2WW3A 1TU7A 5AISA 2H0LA 1YGMA 3H1NA 4F03A 2GDRA 4YQVA 2GSSA 4GDFA 2CZ2A 3PR8A 2RANA 2XO2A 1AVRA 4FQ0C 3KMOA 2PVQA 5J5NA 4YAVA 1VF1A 2WW0A 3CRUA 4J2FA 4PUAA 4JWLA 4MZWA 1TXUA 5ECNB 2YV7A 4G9HA 2IICA 4KE3A 2WRTA 4ISDA 4E8HA 1R8SE 4Q5QA 4BVYA 4PQIA 4IBPA 1VF2A 4MF5A 5ELAA 3RFRC 3VK9A 4AGSA 2II2A 5ECSA 4O92A 3LFLA 4TOPA 4HZ2A 5ECRB 3VPTA 5A34B 2HRKA 3TU3B 2OT3A 4PXOA 2N5FA 1QC7A 4BL7B 3M0FA 4GTUA 2ZOCA 1BC9A 1ANXA 3IK9A 1ZGNA 2OA7A 2PERA 1V2AA 4O7HA 2AB6A 4JBBA 1HNAA 2WZSA 2ZHJA 11GSA 4ZB8A 4G0LA 3VI5A 1ALAA 3L8NA 4K0NA 1F2EA 2EFCA 3N5OA 3USWA 2Q4CA 19GSA 1HQOA 5D9XA 4F0CA 1LKVX 4EDZA 1EV9A 3F6FA 4KH7A 3LG6A 4GLTA 4YQUA 5AIVA 3ZFLA 2A2RA 3ZFBA 3UARA 2WVYA 1S9DE 1N00A 3ERGA 3Q19A 1GULA 4NHZA 5DALA 3PPUA 1SAVA 4JZQA 5FWGA 5A34A 5J4UA 2VCVA 5KEJA 1N42A 1HVFA 1YDKA 5BMUA 2OACA 3C8EA 4BL7A 4Q5FA 1AW9A 4PNGA 1AIIA 3LYPA 1AQVA 4JMOA 3SWVA 1Z9HA 5G5FA 4IW9A 4HOJA 1Q8DA 2VCZA 1GTBA 4D7QA 4KF9A 1HVDA 3NIVA 1A8AA 4FHRB 4GF0A 5EL8A 3GX0A 2WW2A 5A4WA 2WVXB 1PGTA 3KMNA 4E8EA 2A2SA 6GSSA 1GNEA 4JMIA 1W45A 1ANWA 3HJLA 4E68A 3R3EA 4LMWA 2VO4A 4NAXA 5DJMA 2WS2A 3LYKA 4WR4A 2UZ8A 3CRTA 2V6KA 2WW1A 1AXDA 5D73A 4G10A 1M0UA 3ISOA 3DGQA 4L5OA 1GTUA 1YQ1A 5D9WA 3ANYA 1YKCA 2HSMA 1HNCA 5A5HA 1GSFA 4ZB7A 4EE0A 1OKTA 4N3ZA 4OIYA 1TDIA 1AOWA 3GH6A 3PGTA 4L8EA 3RBTA 3N9JA 1AQXA 1K0MA 5DQSA 5B7CA 3SWLA 4WR5A 3CHXC 1GUHA 1GSDA 1VF4A 2WVXA 4IJIA 5DCGA 5ELGA 1K0CA 1W7BA 3P90A 1C72A 2XO3A 4HREA 1EOGA 3GTUB 3G7JA 5ECLB 2ON5A 3IR4A 5LD0A 1U3IA 1NHYA 5G5EA 1M99A 2D2ZA 3KJYA 4JEDA 4OFNA 1B4PA 5FT3A 3CSHA 3MAKA 6GSTA 4AKIA 5J4VA 1N41A 2JL4A 5J40A 2EFDA 3ERFA 4IVFA 5DAKB 1USBA 3O3TA 6GSXA 4GSSA 4LMVA 6GSVA 1XWKA 4ECBA 1R4AE 2VCTA 4CHSA 4MPFA 1N2AA 4KN7X 2GTUA 2GSQA 4G19A 4KMUX 2VCXA 3GURA 3O76A 2CAIA 5FHIA 4PURA 3LXZA 4MP4A 4MDUA 3BRXA 2GSTA 2HSNB 5AIXA 4GSTA 1RK4A 1JLVA 4ZB9A 2NTOA 4MPGA 1MTCA 1A8BA 2OY9A 2CVDA 3WYWA 2VKZG 1N25A 4IS0A
chains in the Genus database with same CATH topology
4W66A 1TW9A 4HZ4A 3IK7A 3FYGA 1RE0B 1G6YA 4USSA 5DAKA 4YAPA 1SVOA 1GSQA 4QQ7A 2WB9A 5EY6A 2C80A 2F3MA 3GSTA 2IL3A 1MD3A 4MF7A 1R5AA 4BVXB 3WD6A 1BAYA 4RI6A 2HSNA 1KBNA 2R09A 2WDUA 1BG5A 1B48A 3GSSA 3G7IA 5D9VA 6GSUA 2IMKA 4PTSA 1R8ME 1YVLA 20GSA 1VF3A 5AN1A 3EE2A 4EDYA 4MK3A 1BX9A 1GWCA 3Q74A 2H1LA 4EC0A 2YV9A 4KDXA 3AY8A 3R2QA 3VI7A 5DJLA 1EV4A 4ZBDA 2R5GA 5ECOB 2FHEA 3LQ7A 3KXOA 3CWGA 1PBVA 5EVOA 5D9TA 4AKXB 5ECQB 3CSIA 3UVHA 3F6DA 3QAWA 3CBUA 4KDUA 6GSWA 1B8XA 1GLQA 2C3TA 5J47A 3DD3A 4OMVA 1GSYA 1G6WA 18GSA 3W8SA 3HMJG 5GZZB 2VD1A 3QR6A 1M9BA 3TOUA 1Q4JA 1XW6A 1XT0B 5ECKB 4ECJA 2PGTA 2DC5A 7GSSA 1U87A 3KM6A 2LJRA 3D0ZA 2EFHA 1PL1A 1XW5A 3HKRA 3IBHA 2C8UA 2YCDA 4NHWA 4A4PA 1GTIA 1UA5A 3Q18A 1PMTA 1V40A 1PX7A 1PA3A 3FR6A 17GSA 3M3MA 4Z21A 1K0BA 2O5VA 22GSA 4HJ2A 4IELA 2PMTA 4JK1X 4G01A 16GSA 5ECIB 3EINA 8GSSA 1G7OA 1F3AA 3AJCA 2HRAA 4GSNA 5F07A 5HFKA 5J41A 1FW1A 1K0OA 3F63A 1PKWA 4BVYB 3FY7A 1BF5A 4EXJA 1GUKA 2X64A 5A5KA 1GSSA 5A4UA 1K3YA 3TW5A 2HRKB 1ZL9A 4AKHA 4MF6A 1U88A 4C0AA 1M9AA 1KU1A 2R3XA 4ZBAA 2F8FA 4PGTA 3UAPA 4ACSA 1XWGA 3M1GA 1OE8A 4IKHA 3LSZA 3SOHB 2WJUA 3GTUA 3VPQA 3TGZA 2GLRA 1JZRA 4IQAA 4G0IA 5GSTA 1PN9A 1LBKA 1SVLA 4N0VA 1FHEA 10GSA 2IMIA 3I69A 3CSJA 2CA8A 1GLPA 5DDLA 2OADA 5F0GA 5ECHB 1GUMA 1HNBA 3QAVA 9GSSA 2DSAA 5DALB 5IQYA 4L5LA 4HI7A 5BMUB 3BBYA 2GSRA 4ZBBA 3VURA 2AAWA 3M8NA 6GSYA 4RI7A 3U6VA 1K0NA 1Y6EA 3FR3A 3ZMKA 3LJRA 3I6AA 3KTLA 5LCZA 3FR9A 13GSA 1YJ6A 3TOTA 3ZMLA 3HJMA 1IYIA 2CAQA 2VCQA 1JLWA 4JXHA 1K0AA 2ON7A 3HJOA 1GTAA 3VLNA 4G0KA 2HNLA 1PD21 1Y1UA 4ECCA 1AQWA 1BG1A 3QAGA 5ECPB 4DEJA 4F0BA 4C7PA 2C3NA 2EFEA 2HSMB 3VWXA 2CZ3A 5A5HB 1DUGA 1F3BA 1LJRA 5F05A 4IQ1A 4YQMA 4BVXA 2J9HA 4FQUA 5A4VA 1GNWA 2C4JA 5A1NB 2AHEA 4ID0A 3GUSA 2R0DA 3UBKA 3UBLA 3USYA 4KSMA 1MD4A 3IE3A 1OE7A 4KGIA 1XSZA 4OFMA 4I97A 14GSA 2HQTA 4KN4X 1PX6A 4L5MA 1K3LA 1BYEA 5JCWA 2K6XA 1K3OA 5F06A 5F8BA 4GCIA 4QMKA 2FNOA 4PQHA 3IC8A 3P8WA 4PNFA 4KDYA 2C3QA 1K0DA 4ZB6A 2VD0A 1SVMA 3LXTA 4K0GA 2R4VA 4KX4A 4Q5RA 3LTLA 1EOHA 1E6BA 4ZXGA 4AI6A 1R8QE 1A0FA 1PKZA 3L0HA 4YH2A 5A1NA 4ECIA 1IYHA 2UV8G 12GSA 3MDKA 2R6KA 1EEMA 5ECMB 5GSSA 5AGYA 4IGJA 4AKGA 1YY7A 1ML6A 1GSEA 3FRCA 4Q5NA 5JCUA 1OYJA 2VCWA 4KAEA 4MDCA 1GSUA 4PX1A 4D7RA 5J4YA 2PBJA 1PL2A 4OFTA 1TU8A 1TU7A 5AISA 3H1NA 4F03A 2GDRA 4YQVA 2GSSA 4GDFA 2CZ2A 3PR8A 3KMOA 4FQ0C 5J5NA 2PVQA 4YAVA 1VF1A 3CRUA 4J2FA 4PUAA 4JWLA 4MZWA 1TXUA 5ECNB 2YV7A 4G9HA 4KE3A 2WRTA 4ISDA 4E8HA 1R8SE 4Q5QA 4BVYA 4PQIA 4IBPA 1VF2A 4MF5A 5ELAA 3VK9A 4AGSA 5ECSA 4O92A 3LFLA 4TOPA 4HZ2A 5ECRB 3VPTA 5A34B 2HRKA 3TU3B 2OT3A 4PXOA 2N5FA 1QC7A 4BL7B 3M0FA 4GTUA 1BC9A 3IK9A 1ZGNA 2OA7A 2PERA 1V2AA 4O7HA 2AB6A 4JBBA 1HNAA 11GSA 4ZB8A 4G0LA 3VI5A 3L8NA 4K0NA 1F2EA 2EFCA 3N5OA 3USWA 19GSA 1HQOA 5D9XA 4F0CA 1LKVX 4EDZA 1EV9A 3F6FA 4KH7A 3LG6A 4GLTA 4YQUA 5AIVA 3ZFLA 2A2RA 3ZFBA 3UARA 1S9DE 3ERGA 3Q19A 1GULA 4NHZA 5DALA 3PPUA 4JZQA 5FWGA 5A34A 5J4UA 2VCVA 5KEJA 5BMUA 1YDKA 2OACA 3C8EA 4BL7A 4Q5FA 1AW9A 4PNGA 3LYPA 1AQVA 4JMOA 3SWVA 1Z9HA 5G5FA 4IW9A 4HOJA 1Q8DA 2VCZA 1GTBA 4D7QA 4KF9A 3NIVA 4FHRB 4GF0A 5EL8A 3GX0A 5A4WA 1PGTA 3KMNA 4E8EA 2A2SA 6GSSA 1GNEA 4JMIA 3HJLA 4E68A 3R3EA 4LMWA 2VO4A 4NAXA 5DJMA 2WS2A 3LYKA 4WR4A 2UZ8A 3CRTA 2V6KA 5D73A 1AXDA 4G10A 1M0UA 3ISOA 3DGQA 4L5OA 1GTUA 1YQ1A 5D9WA 1YKCA 2HSMA 1HNCA 5A5HA 1GSFA 4ZB7A 4EE0A 1OKTA 4N3ZA 4OIYA 1TDIA 3GH6A 4L8EA 3PGTA 3RBTA 3N9JA 1AQXA 1K0MA 5DQSA 5B7CA 3SWLA 4WR5A 1GUHA 1GSDA 1VF4A 4IJIA 5DCGA 5ELGA 1K0CA 3P90A 1C72A 1EOGA 3GTUB 3G7JA 5ECLB 2ON5A 3IR4A 5LD0A 1U3IA 1NHYA 5G5EA 1M99A 2D2ZA 3KJYA 4JEDA 4OFNA 1B4PA 5FT3A 3CSHA 3MAKA 6GSTA 4AKIA 5J4VA 2JL4A 5J40A 2EFDA 3ERFA 4IVFA 5DAKB 1USBA 3O3TA 6GSXA 4GSSA 4LMVA 6GSVA 1XWKA 4ECBA 2VCTA 4CHSA 4MPFA 1N2AA 4KN7X 2GTUA 2GSQA 4G19A 4KMUX 2VCXA 3GURA 3O76A 2CAIA 5FHIA 4PURA 3LXZA 4MP4A 2GSTA 2HSNB 5AIXA 4GSTA 1RK4A 1JLVA 4ZB9A 2NTOA 4MPGA 1MTCA 2CVDA 3WYWA 2VKZG 1N25A 4IS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSN A; 
#chains in the Genus database with same CATH topology
 4W66 A;  1TW9 A;  4HZ4 A;  3IK7 A;  3FYG A;  1RE0 B;  1G6Y A;  2HYV A;  4USS A;  1HVE A;  3ABQ A;  4YAP A;  5DAK A;  1SVO A;  1GSQ A;  4QQ7 A;  2IE6 A;  1HM6 A;  1BC0 A;  2WB9 A;  5EY6 A;  2C80 A;  2F3M A;  3GST A;  2IL3 A;  1MD3 A;  4MF7 A;  1R5A A;  1DK5 A;  3WD6 A;  4BVX B;  1BAY A;  4RI6 A;  2HSN A;  1KBN A;  2R09 A;  2HYU A;  2WDU A;  1BG5 A;  1B48 A;  3GSS A;  3G7I A;  5D9V A;  6GSU A;  2IMK A;  4PTS A;  1R8M E;  1YVL A;  1N44 A;  20GS A;  1VF3 A;  5AN1 A;  3EE2 A;  4EDY A;  4MK3 A;  1BX9 A;  1GWC A;  3Q74 A;  2IE7 A;  2H1L A;  4EC0 A;  2YV9 A;  4KDX A;  3AY8 A;  1AEI A;  3R2Q A;  3VI7 A;  5DJL A;  1EV4 A;  4ZBD A;  2R5G A;  5ECO B;  2FHE A;  3LQ7 A;  1UPT B;  2O36 A;  3KXO A;  1C1K A;  1PBV A;  3CWG A;  5EVO A;  5D9T A;  4AKX B;  5ECQ B;  3CSI A;  3UVH A;  3F6D A;  3QAW A;  3CBU A;  4KDU A;  6GSW A;  1B8X A;  1GLQ A;  2C3T A;  5J47 A;  3DD3 A;  1DM5 A;  1GSY A;  1G6W A;  18GS A;  4OMV A;  3W8S A;  5GZZ B;  2VD1 A;  3QR6 A;  3HMJ G;  1M9B A;  3TOU A;  1Q4J A;  1XW6 A;  1XT0 B;  5ECK B;  4ECJ A;  2PGT A;  2ZHI A;  2DC5 A;  7GSS A;  1U87 A;  3KM6 A;  2LJR A;  3D0Z A;  1BC3 A;  2EFH A;  1PL1 A;  1XW5 A;  3HKR A;  1W3W A;  3IBH A;  2C8U A;  2YCD A;  4NHW A;  4A4P A;  1GTI A;  1UA5 A;  3Q18 A;  3ABO A;  1PMT A;  3ABR A;  1YCN A;  1V40 A;  1PX7 A;  1PA3 A;  3FR6 A;  17GS A;  4FXY P;  3M3M A;  4Z21 A;  1K0B A;  2O5V A;  22GS A;  4HJ2 A;  4IEL A;  2PMT A;  4JK1 X;  4G01 A;  4PHZ C;  16GS A;  1AVC A;  5ECI B;  3EIN A;  8GSS A;  1G7O A;  1F3A A;  3AJC A;  4PI0 C;  2HRA A;  4GSN A;  5F07 A;  5HFK A;  5J41 A;  1FW1 A;  1BCZ A;  1S4B P;  1K0O A;  2VXG A;  3F63 A;  1PKW A;  1M9I A;  4BVY B;  1BC1 A;  3FY7 A;  2HYW A;  1BF5 A;  4EXJ A;  4EVF A;  1GUK A;  2X64 A;  5A5K A;  1GSS A;  1MCX A;  4EVH A;  5A4U A;  1K3Y A;  3TW5 A;  2HRK B;  1ZL9 A;  4AKH A;  4MF6 A;  2H0M A;  1U88 A;  4C0A A;  1M9A A;  2O3E A;  1KU1 A;  1XJL A;  2R3X A;  4ZBA A;  2F8F A;  4PGT A;  3UAP A;  4ACS A;  1BCW A;  1XWG A;  3M1G A;  1OE8 A;  4IKH A;  3LSZ A;  3SOH B;  2WJU A;  3GTU A;  3VPQ A;  3TGZ A;  2GLR A;  1JZR A;  4IQA A;  4G0I A;  5GST A;  4X9P A;  1LBK A;  1PN9 A;  1SVL A;  4N0V A;  1FHE A;  10GS A;  2IMI A;  3I69 A;  3CSJ A;  2CA8 A;  1GLP A;  1YII A;  5DDL A;  2OAD A;  4PI2 C;  5F0G A;  5ECH B;  1YJ0 A;  4Q2S A;  1GUM A;  1HNB A;  3QAV A;  9GSS A;  2DSA A;  5DAL B;  1ANN A;  5IQY A;  4L5L A;  4HI7 A;  5BMU B;  3BBY A;  2GSR A;  4ZBB A;  3VUR A;  2AAW A;  3M8N A;  6GSY A;  1BO9 A;  4RI7 A;  3AO0 A;  3U6V A;  1K0N A;  1Y6E A;  3FR3 A;  3ZMK A;  3LJR A;  3I6A A;  3KTL A;  5LCZ A;  3FR9 A;  13GS A;  1YJ6 A;  3TOT A;  3ZML A;  3HJM A;  1IYI A;  2CAQ A;  1AVH A;  2VCQ A;  1BCY A;  1JLW A;  4JXH A;  1K0A A;  2ON7 A;  3HJO A;  1GTA A;  3VLN A;  4G0K A;  2HNL A;  1PD2 1;  1Y1U A;  4ECC A;  1AQW A;  3RGB C;  1BG1 A;  3QAG A;  5ECP B;  4DEJ A;  4F0B A;  2C3N A;  4C7P A;  2EFE A;  2HSM B;  1I1I P;  3VWX A;  2CZ3 A;  5A5H B;  1DUG A;  1F3B A;  1LJR A;  5F05 A;  4IQ1 A;  4YQM A;  4BVX A;  2J9H A;  4FQU A;  5A4V A;  2QEZ A;  1GNW A;  2C4J A;  1HAK A;  2AHE A;  5A1N B;  4ID0 A;  3GUS A;  1AXN A;  2R0D A;  3UBK A;  3UBL A;  3USY A;  4MDV A;  4KSM A;  1YEW C;  1MD4 A;  3IE3 A;  1OE7 A;  4KGI A;  1XSZ A;  4OFM A;  4I97 A;  14GS A;  2HQT A;  4KN4 X;  1PX6 A;  4L5M A;  1K3L A;  1BYE A;  5JCW A;  2K6X A;  1K3O A;  5F06 A;  5F8B A;  1G5N A;  4GCI A;  4QMK A;  2FNO A;  4PQH A;  3IC8 A;  3P8W A;  4PNF A;  4KDY A;  2C3Q A;  1K0D A;  4ZB6 A;  2VD0 A;  1SVM A;  3LXT A;  4K0G A;  2R4V A;  4KX4 A;  4Q5R A;  3LTL A;  3ABS A;  1EOH A;  1E6B A;  4ZXG A;  4AI6 A;  1R8Q E;  1A0F A;  1PKZ A;  3L0H A;  4YH2 A;  5A1N A;  4ECI A;  1IYH A;  2UV8 G;  12GS A;  3MDK A;  2R6K A;  1EEM A;  5ECM B;  1HVG A;  5GSS A;  2WVZ A;  5AGY A;  4IGJ A;  2H0K A;  1I4A A;  1YY7 A;  1ML6 A;  1GSE A;  3FRC A;  4Q5N A;  4AKG A;  5JCU A;  1OYJ A;  2VCW A;  4KAE A;  4MDC A;  1GSU A;  4PX1 A;  4D7R A;  5J4Y A;  2PBJ A;  1PL2 A;  4OFT A;  1TU8 A;  2WW3 A;  1TU7 A;  5AIS A;  2H0L A;  1YGM A;  3H1N A;  4F03 A;  2GDR A;  4YQV A;  2GSS A;  4GDF A;  2CZ2 A;  3PR8 A;  2RAN A;  2XO2 A;  1AVR A;  4FQ0 C;  3KMO A;  2PVQ A;  5J5N A;  4YAV A;  1VF1 A;  2WW0 A;  3CRU A;  4J2F A;  4PUA A;  4JWL A;  4MZW A;  1TXU A;  5ECN B;  2YV7 A;  4G9H A;  2IIC A;  4KE3 A;  2WRT A;  4ISD A;  4E8H A;  1R8S E;  4Q5Q A;  4BVY A;  4PQI A;  4IBP A;  1VF2 A;  4MF5 A;  5ELA A;  3RFR C;  3VK9 A;  4AGS A;  2II2 A;  5ECS A;  4O92 A;  3LFL A;  4TOP A;  4HZ2 A;  5ECR B;  3VPT A;  5A34 B;  2HRK A;  3TU3 B;  2OT3 A;  4PXO A;  2N5F A;  1QC7 A;  4BL7 B;  3M0F A;  4GTU A;  2ZOC A;  1BC9 A;  1ANX A;  3IK9 A;  1ZGN A;  2OA7 A;  2PER A;  1V2A A;  4O7H A;  2AB6 A;  4JBB A;  1HNA A;  2WZS A;  2ZHJ A;  11GS A;  4ZB8 A;  4G0L A;  3VI5 A;  1ALA A;  3L8N A;  4K0N A;  1F2E A;  2EFC A;  3N5O A;  3USW A;  2Q4C A;  19GS A;  1HQO A;  5D9X A;  4F0C A;  1LKV X;  4EDZ A;  1EV9 A;  3F6F A;  4KH7 A;  3LG6 A;  4GLT A;  4YQU A;  5AIV A;  3ZFL A;  2A2R A;  3ZFB A;  3UAR A;  2WVY A;  1S9D E;  1N00 A;  3ERG A;  3Q19 A;  1GUL A;  4NHZ A;  5DAL A;  3PPU A;  1SAV A;  4JZQ A;  5FWG A;  5A34 A;  5J4U A;  2VCV A;  5KEJ A;  1N42 A;  1HVF A;  1YDK A;  5BMU A;  2OAC A;  3C8E A;  4BL7 A;  4Q5F A;  1AW9 A;  4PNG A;  1AII A;  3LYP A;  1AQV A;  4JMO A;  3SWV A;  1Z9H A;  5G5F A;  4IW9 A;  4HOJ A;  1Q8D A;  2VCZ A;  1GTB A;  4D7Q A;  4KF9 A;  1HVD A;  3NIV A;  1A8A A;  4FHR B;  4GF0 A;  5EL8 A;  3GX0 A;  2WW2 A;  5A4W A;  2WVX B;  1PGT A;  3KMN A;  4E8E A;  2A2S A;  6GSS A;  1GNE A;  4JMI A;  1W45 A;  1ANW A;  3HJL A;  4E68 A;  3R3E A;  4LMW A;  2VO4 A;  4NAX A;  5DJM A;  2WS2 A;  3LYK A;  4WR4 A;  2UZ8 A;  3CRT A;  2V6K A;  2WW1 A;  1AXD A;  5D73 A;  4G10 A;  1M0U A;  3ISO A;  3DGQ A;  4L5O A;  1GTU A;  1YQ1 A;  5D9W A;  3ANY A;  1YKC A;  2HSM A;  1HNC A;  5A5H A;  1GSF A;  4ZB7 A;  4EE0 A;  1OKT A;  4N3Z A;  4OIY A;  1TDI A;  1AOW A;  3GH6 A;  3PGT A;  4L8E A;  3RBT A;  3N9J A;  1AQX A;  1K0M A;  5DQS A;  5B7C A;  3SWL A;  4WR5 A;  3CHX C;  1GUH A;  1GSD A;  1VF4 A;  2WVX A;  4IJI A;  5DCG A;  5ELG A;  1K0C A;  1W7B A;  3P90 A;  1C72 A;  2XO3 A;  4HRE A;  1EOG A;  3GTU B;  3G7J A;  5ECL B;  2ON5 A;  3IR4 A;  5LD0 A;  1U3I A;  1NHY A;  5G5E A;  1M99 A;  2D2Z A;  3KJY A;  4JED A;  4OFN A;  1B4P A;  5FT3 A;  3CSH A;  3MAK A;  6GST A;  4AKI A;  5J4V A;  1N41 A;  2JL4 A;  5J40 A;  2EFD A;  3ERF A;  4IVF A;  5DAK B;  1USB A;  3O3T A;  6GSX A;  4GSS A;  4LMV A;  6GSV A;  1XWK A;  4ECB A;  1R4A E;  2VCT A;  4CHS A;  4MPF A;  1N2A A;  4KN7 X;  2GTU A;  2GSQ A;  4G19 A;  4KMU X;  2VCX A;  3GUR A;  3O76 A;  2CAI A;  5FHI A;  4PUR A;  3LXZ A;  4MP4 A;  4MDU A;  3BRX A;  2GST A;  2HSN B;  5AIX A;  4GST A;  1RK4 A;  1JLV A;  4ZB9 A;  2NTO A;  4MPG A;  1MTC A;  1A8B A;  2OY9 A;  2CVD A;  3WYW A;  2VKZ G;  1N25 A;  4IS0 A; 
#chains in the Genus database with same CATH homology
 4W66 A;  1TW9 A;  4HZ4 A;  3IK7 A;  3FYG A;  1RE0 B;  1G6Y A;  4USS A;  5DAK A;  4YAP A;  1SVO A;  1GSQ A;  4QQ7 A;  2WB9 A;  5EY6 A;  2C80 A;  2F3M A;  3GST A;  2IL3 A;  1MD3 A;  4MF7 A;  1R5A A;  4BVX B;  3WD6 A;  1BAY A;  4RI6 A;  2HSN A;  1KBN A;  2R09 A;  2WDU A;  1BG5 A;  1B48 A;  3GSS A;  3G7I A;  5D9V A;  6GSU A;  2IMK A;  4PTS A;  1R8M E;  1YVL A;  20GS A;  1VF3 A;  5AN1 A;  3EE2 A;  4EDY A;  4MK3 A;  1BX9 A;  1GWC A;  3Q74 A;  2H1L A;  4EC0 A;  2YV9 A;  4KDX A;  3AY8 A;  3R2Q A;  3VI7 A;  5DJL A;  1EV4 A;  4ZBD A;  2R5G A;  5ECO B;  2FHE A;  3LQ7 A;  3KXO A;  3CWG A;  1PBV A;  5EVO A;  5D9T A;  4AKX B;  5ECQ B;  3CSI A;  3UVH A;  3F6D A;  3QAW A;  3CBU A;  4KDU A;  6GSW A;  1B8X A;  1GLQ A;  2C3T A;  5J47 A;  3DD3 A;  4OMV A;  1GSY A;  1G6W A;  18GS A;  3W8S A;  3HMJ G;  5GZZ B;  2VD1 A;  3QR6 A;  1M9B A;  3TOU A;  1Q4J A;  1XW6 A;  1XT0 B;  5ECK B;  4ECJ A;  2PGT A;  2DC5 A;  7GSS A;  1U87 A;  3KM6 A;  2LJR A;  3D0Z A;  2EFH A;  1PL1 A;  1XW5 A;  3HKR A;  3IBH A;  2C8U A;  2YCD A;  4NHW A;  4A4P A;  1GTI A;  1UA5 A;  3Q18 A;  1PMT A;  1V40 A;  1PX7 A;  1PA3 A;  3FR6 A;  17GS A;  3M3M A;  4Z21 A;  1K0B A;  2O5V A;  22GS A;  4HJ2 A;  4IEL A;  2PMT A;  4JK1 X;  4G01 A;  16GS A;  5ECI B;  3EIN A;  8GSS A;  1G7O A;  1F3A A;  3AJC A;  2HRA A;  4GSN A;  5F07 A;  5HFK A;  5J41 A;  1FW1 A;  1K0O A;  3F63 A;  1PKW A;  4BVY B;  3FY7 A;  1BF5 A;  4EXJ A;  1GUK A;  2X64 A;  5A5K A;  1GSS A;  5A4U A;  1K3Y A;  3TW5 A;  2HRK B;  1ZL9 A;  4AKH A;  4MF6 A;  1U88 A;  4C0A A;  1M9A A;  1KU1 A;  2R3X A;  4ZBA A;  2F8F A;  4PGT A;  3UAP A;  4ACS A;  1XWG A;  3M1G A;  1OE8 A;  4IKH A;  3LSZ A;  3SOH B;  2WJU A;  3GTU A;  3VPQ A;  3TGZ A;  2GLR A;  1JZR A;  4IQA A;  4G0I A;  5GST A;  1PN9 A;  1LBK A;  1SVL A;  4N0V A;  1FHE A;  10GS A;  2IMI A;  3I69 A;  3CSJ A;  2CA8 A;  1GLP A;  5DDL A;  2OAD A;  5F0G A;  5ECH B;  1GUM A;  1HNB A;  3QAV A;  9GSS A;  2DSA A;  5DAL B;  5IQY A;  4L5L A;  4HI7 A;  5BMU B;  3BBY A;  2GSR A;  4ZBB A;  3VUR A;  2AAW A;  3M8N A;  6GSY A;  4RI7 A;  3U6V A;  1K0N A;  1Y6E A;  3FR3 A;  3ZMK A;  3LJR A;  3I6A A;  3KTL A;  5LCZ A;  3FR9 A;  13GS A;  1YJ6 A;  3TOT A;  3ZML A;  3HJM A;  1IYI A;  2CAQ A;  2VCQ A;  1JLW A;  4JXH A;  1K0A A;  2ON7 A;  3HJO A;  1GTA A;  3VLN A;  4G0K A;  2HNL A;  1PD2 1;  1Y1U A;  4ECC A;  1AQW A;  1BG1 A;  3QAG A;  5ECP B;  4DEJ A;  4F0B A;  4C7P A;  2C3N A;  2EFE A;  2HSM B;  3VWX A;  2CZ3 A;  5A5H B;  1DUG A;  1F3B A;  1LJR A;  5F05 A;  4IQ1 A;  4YQM A;  4BVX A;  2J9H A;  4FQU A;  5A4V A;  1GNW A;  2C4J A;  5A1N B;  2AHE A;  4ID0 A;  3GUS A;  2R0D A;  3UBK A;  3UBL A;  3USY A;  4KSM A;  1MD4 A;  3IE3 A;  1OE7 A;  4KGI A;  1XSZ A;  4OFM A;  4I97 A;  14GS A;  2HQT A;  4KN4 X;  1PX6 A;  4L5M A;  1K3L A;  1BYE A;  5JCW A;  2K6X A;  1K3O A;  5F06 A;  5F8B A;  4GCI A;  4QMK A;  2FNO A;  4PQH A;  3IC8 A;  3P8W A;  4PNF A;  4KDY A;  2C3Q A;  1K0D A;  4ZB6 A;  2VD0 A;  1SVM A;  3LXT A;  4K0G A;  2R4V A;  4KX4 A;  4Q5R A;  3LTL A;  1EOH A;  1E6B A;  4ZXG A;  4AI6 A;  1R8Q E;  1A0F A;  1PKZ A;  3L0H A;  4YH2 A;  5A1N A;  4ECI A;  1IYH A;  2UV8 G;  12GS A;  3MDK A;  2R6K A;  1EEM A;  5ECM B;  5GSS A;  5AGY A;  4IGJ A;  4AKG A;  1YY7 A;  1ML6 A;  1GSE A;  3FRC A;  4Q5N A;  5JCU A;  1OYJ A;  2VCW A;  4KAE A;  4MDC A;  1GSU A;  4PX1 A;  4D7R A;  5J4Y A;  2PBJ A;  1PL2 A;  4OFT A;  1TU8 A;  1TU7 A;  5AIS A;  3H1N A;  4F03 A;  2GDR A;  4YQV A;  2GSS A;  4GDF A;  2CZ2 A;  3PR8 A;  3KMO A;  4FQ0 C;  5J5N A;  2PVQ A;  4YAV A;  1VF1 A;  3CRU A;  4J2F A;  4PUA A;  4JWL A;  4MZW A;  1TXU A;  5ECN B;  2YV7 A;  4G9H A;  4KE3 A;  2WRT A;  4ISD A;  4E8H A;  1R8S E;  4Q5Q A;  4BVY A;  4PQI A;  4IBP A;  1VF2 A;  4MF5 A;  5ELA A;  3VK9 A;  4AGS A;  5ECS A;  4O92 A;  3LFL A;  4TOP A;  4HZ2 A;  5ECR B;  3VPT A;  5A34 B;  2HRK A;  3TU3 B;  2OT3 A;  4PXO A;  2N5F A;  1QC7 A;  4BL7 B;  3M0F A;  4GTU A;  1BC9 A;  3IK9 A;  1ZGN A;  2OA7 A;  2PER A;  1V2A A;  4O7H A;  2AB6 A;  4JBB A;  1HNA A;  11GS A;  4ZB8 A;  4G0L A;  3VI5 A;  3L8N A;  4K0N A;  1F2E A;  2EFC A;  3N5O A;  3USW A;  19GS A;  1HQO A;  5D9X A;  4F0C A;  1LKV X;  4EDZ A;  1EV9 A;  3F6F A;  4KH7 A;  3LG6 A;  4GLT A;  4YQU A;  5AIV A;  3ZFL A;  2A2R A;  3ZFB A;  3UAR A;  1S9D E;  3ERG A;  3Q19 A;  1GUL A;  4NHZ A;  5DAL A;  3PPU A;  4JZQ A;  5FWG A;  5A34 A;  5J4U A;  2VCV A;  5KEJ A;  5BMU A;  1YDK A;  2OAC A;  3C8E A;  4BL7 A;  4Q5F A;  1AW9 A;  4PNG A;  3LYP A;  1AQV A;  4JMO A;  3SWV A;  1Z9H A;  5G5F A;  4IW9 A;  4HOJ A;  1Q8D A;  2VCZ A;  1GTB A;  4D7Q A;  4KF9 A;  3NIV A;  4FHR B;  4GF0 A;  5EL8 A;  3GX0 A;  5A4W A;  1PGT A;  3KMN A;  4E8E A;  2A2S A;  6GSS A;  1GNE A;  4JMI A;  3HJL A;  4E68 A;  3R3E A;  4LMW A;  2VO4 A;  4NAX A;  5DJM A;  2WS2 A;  3LYK A;  4WR4 A;  2UZ8 A;  3CRT A;  2V6K A;  5D73 A;  1AXD A;  4G10 A;  1M0U A;  3ISO A;  3DGQ A;  4L5O A;  1GTU A;  1YQ1 A;  5D9W A;  1YKC A;  2HSM A;  1HNC A;  5A5H A;  1GSF A;  4ZB7 A;  4EE0 A;  1OKT A;  4N3Z A;  4OIY A;  1TDI A;  3GH6 A;  4L8E A;  3PGT A;  3RBT A;  3N9J A;  1AQX A;  1K0M A;  5DQS A;  5B7C A;  3SWL A;  4WR5 A;  1GUH A;  1GSD A;  1VF4 A;  4IJI A;  5DCG A;  5ELG A;  1K0C A;  3P90 A;  1C72 A;  1EOG A;  3GTU B;  3G7J A;  5ECL B;  2ON5 A;  3IR4 A;  5LD0 A;  1U3I A;  1NHY A;  5G5E A;  1M99 A;  2D2Z A;  3KJY A;  4JED A;  4OFN A;  1B4P A;  5FT3 A;  3CSH A;  3MAK A;  6GST A;  4AKI A;  5J4V A;  2JL4 A;  5J40 A;  2EFD A;  3ERF A;  4IVF A;  5DAK B;  1USB A;  3O3T A;  6GSX A;  4GSS A;  4LMV A;  6GSV A;  1XWK A;  4ECB A;  2VCT A;  4CHS A;  4MPF A;  1N2A A;  4KN7 X;  2GTU A;  2GSQ A;  4G19 A;  4KMU X;  2VCX A;  3GUR A;  3O76 A;  2CAI A;  5FHI A;  4PUR A;  3LXZ A;  4MP4 A;  2GST A;  2HSN B;  5AIX A;  4GST A;  1RK4 A;  1JLV A;  4ZB9 A;  2NTO A;  4MPG A;  1MTC A;  2CVD A;  3WYW A;  2VKZ G;  1N25 A;  4IS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...