2HSNA

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MSFLISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFDANAILRYVMDDFEGQTSDKYQFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPLTTTDLILFANVYALNSSLVHSKFPELPSKVHNAVALAKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna binding protein
molecule keywords Methionyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 160
sequence length 160
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09635 MetRS-N MetRS-N binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.140 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2hsnA01
1.20.1050.110 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsnA02
2HSNA
chains in the Genus database with same CATH superfamily
4E8EA 1PKWA 2WW1A 1G6YA 1AOWA 4OMVA 1U88A 2OA7A 3LSZA 5ELAA 2HSNB 3BBYA 16GSA 1GSFA 3UAPA 4EC0A 3IC8A 3VI7A 1N44A 4N0VA 1K0DA 4Q5NA 5A1NB 1V2AA 4HREA 1AIIA 2DSAA 1K0OA 4EE0A 3Q19A 3RGBC 2EFDA 5ECLB 3LYKA 3FR6A 5A5HB 3TU3B 5A4UA 5DAKB 2HRKB 4QQ7A 4ID0A 5ECNB 3PR8A 3VURA 1PBVA 4AGSA 5B7CA 2Q4CA 4QMKA 5F05A 4MDUA 1EV9A 3SWLA 2ON7A 4G01A 1Q4JA 5EVOA 5DJLA 3M8NA 1BO9A 3Q74A 2F3MA 2YCDA 2VXGA 1W45A 3VWXA 5J4VA 1AQVA 2GSRA 2PMTA 1ZGNA 1XJLA 1HNCA 4GLTA 2CAQA 2FHEA 4KX4A 2C8UA 2GSSA 1YKCA 4JXHA 3CRTA 5G5EA 3NIVA 2CZ2A 2X64A 2IL3A 4KN7X 5GSSA 4EVFA 5AIXA 2HYWA 3CSJA 1PL1A 4FQ0C 5FWGA 4OIYA 4ISDA 3LYPA 4KDXA 2VD0A 1I1IP 5D9TA 1K3LA 3LG6A 3VK9A 4G0IA 4EDZA 3VPTA 4BL7A 5EY6A 3DGQA 4NAXA 2EFEA 1PX7A 3F63A 1M9IA 3ANYA 1XT0B 4PGTA 4MDCA 4ZB9A 4ECJA 5BMUA 1BC9A 2PBJA 1USBA 4BVXB 1F2EA 3AO0A 2WW0A 3LTLA 2EFCA 2RANA 2WVYA 3FRCA 4GSNA 3SWVA 2ON5A 5DQSA 1SVMA 1HVFA 5F07A 4GCIA 4C7PA 3U6VA 1GTUA 5KEJA 1A0FA 5JCWA 1HM6A 1M9BA 2PVQA 1K3YA 10GSA 4Q5RA 3IE3A 1GUHA 1RE0B 2HQTA 2PGTA 4Q2SA 1B48A 4G10A 4ZB8A 4MF5A 1S4BP 4ZBAA 4Q5QA 3G7IA 2VCQA 3HKRA 4OFTA 4AKXB 2O5VA 5D73A 5J5NA 6GSUA 5J40A 4FXYP 17GSA 2N5FA 2R5GA 4ECBA 4L5MA 2O36A 1MD3A 1Z9HA 4MPGA 22GSA 2VKZG 2WDUA 4G0LA 4MF6A 3ABOA 1GSQA 3O76A 1EV4A 4IS0A 3LFLA 5A1NA 4HI7A 2CZ3A 1S9DE 1XW5A 5FT3A 2H1LA 1R8ME 1PN9A 1SAVA 3O3TA 2CVDA 1GTBA 5A4WA 2HYUA 4KAEA 1N42A 2WVZA 4PQIA 2WVXB 5DAKA 1PGTA 2HRKA 3GH6A 4F0CA 2IMIA 3AJCA 8GSSA 1YQ1A 1BC3A 1B4PA 1LKVX 1AXNA 2VD1A 1TU7A 5ECKB 1TXUA 2WW3A 14GSA 2VCTA 1K0CA 4PTSA 6GSYA 3RFRC 1GUKA 2V6KA 4NHZA 1PL2A 1YCNA 2H0LA 3VLNA 4MF7A 3ISOA 5ECIB 4MK3A 1XSZA 5JCUA 4JZQA 1A8BA 1OKTA 4KN4X 1SVLA 3PPUA 3M3MA 4D7QA 4MPFA 4ZBDA 3TOUA 3BRXA 2A2SA 3QAVA 4LMWA 5ECMB 3GSTA 4OFNA 1YJ0A 7GSSA 4USSA 1K0AA 4A4PA 4KDYA 1BG5A 3HJLA 3MDKA 1Y1UA 1B8XA 1HVEA 1VF1A 4RI7A 2AB6A 1XW6A 4PQHA 1YVLA 4GDFA 4CHSA 3FYGA 5LCZA 4KH7A 1KU1A 2GSQA 2XO3A 2PERA 4O7HA 4AKIA 2LJRA 1IYHA 1HVDA 4IJIA 3KJYA 2WRTA 4E8HA 1TW9A 3GTUA 2IMKA 2GTUA 1UA5A 2WZSA 1R8QE 5G5FA 4C0AA 1VF2A 2QEZA 1M0UA 1GNEA 1AQWA 4KGIA 3UARA 2VO4A 5J47A 1OYJA 1ANNA 1GWCA 4KMUX 2R4VA 5FHIA 1YJ6A 3QR6A 5ECRB 2OADA 1VF4A 1GUMA 3R2QA 3CWGA 19GSA 3FY7A 1JLVA 2C3TA 3CHXC 2ZOCA 1GTAA 3LXTA 3ABQA 5DALA 1GULA 2HRAA 4YAVA 4JK1X 4RI6A 4AKHA 3EINA 4ECCA 2ZHIA 1AXDA 3ZFBA 1GSYA 3KM6A 5ELGA 4HJ2A 4LMVA 2J9HA 5ECQB 5F8BA 4ZBBA 3TGZA 4Q5FA 5ECSA 4HOJA 3VI5A 5ECOB 5A4VA 4W66A 3GURA 1PMTA 3ZFLA 4PNGA 3HMJG 1EOGA 2WS2A 2HSMA 3UBKA 1HQOA 1R4AE 2IE6A 1BCWA 2O3EA 2F8FA 4K0GA 4KSMA 4JBBA 2H0KA 1F3AA 4F03A 2AHEA 3PGTA 4YAPA 1K0MA 2WVXA 4BVYA 2JL4A 4JEDA 6GSTA 1BAYA 4IVFA 4YH2A 1GSSA 1I4AA 4BL7B 4L5OA 1N2AA 2HSNA 2DC5A 1BC1A 4YQVA 1YY7A 1G6WA 4J2FA 3TW5A 1YGMA 5A34B 1HVGA 4DEJA 12GSA 4O92A 5IQYA 2YV7A 4KE3A 3CBUA 2C3QA 2H0MA 20GSA 5A5HA 3FR3A 3GSSA 1N00A 5AIVA 4IW9A 1FW1A 4EVHA 3P90A 4PI0C 1EEMA 5J4YA 1GSDA 4IELA 3KMNA 4PI2C 3F6FA 3LXZA 4E68A 4L8EA 2R6KA 1PX6A 3HJOA 3CRUA 4IKHA 1MD4A 1W3WA 4NHWA 3ZMKA 4Z21A 3M0FA 4HZ2A 3ABSA 1YDKA 4F0BA 2C80A 4GSTA 4YQMA 1K3OA 2YV9A 3CSHA 1ANWA 2R0DA 1K0BA 2R3XA 5J4UA 11GSA 4KF9A 5GZZB 4PUAA 4ACSA 1GLQA 3L8NA 3C8EA 4AKGA 3WD6A 3USYA 2C3NA 4IGJA 1U87A 1YIIA 1F3BA 3I6AA 1GLPA 2UV8G 1RK4A 1Y6EA 4GTUA 2OACA 2HYVA 1K0NA 3ERGA 1M99A 1N25A 4TOPA 3ABRA 1IYIA 3QAWA 1Q8DA 1FHEA 2UZ8A 4G0KA 5A5KA 1BF5A 1SVOA 1TU8A 2WJUA 3UVHA 4EXJA 1HNBA 1GTIA 2AAWA 1HAKA 1A8AA 4JMOA 3LJRA 3N5OA 1KBNA 1DK5A 1C72A 2II2A 1AVRA 3UBLA 1R5AA 3P8WA 1AVCA 3HJMA 4EDYA 2XO2A 1AEIA 1BC0A 4BVXA 5AISA 4ZXGA 3F6DA 2HNLA 1BG1A 2R09A 1W7BA 2ZHJA 3GUSA 3KXOA 2VCXA 1MTCA 3D0ZA 4G9HA 4MP4A 3CSIA 3IBHA 3L0HA 1ML6A 4FHRB 4PNFA 2GDRA 4AI6A 5LD0A 5AN1A 3I69A 5D9VA 4MZWA 4IQAA 4L5LA 3IK9A 4WR5A 1YEWC 3WYWA 1UPTB 1GNWA 5DJMA 1G7OA 1PD21 1ALAA 1C1KA 13GSA 1TDIA 4ECIA 4MDVA 3USWA 2VCVA 2IE7A 4K0NA 5HFKA 1DM5A 2OY9A 1OE8A 4JWLA 1AQXA 4KDUA 2A2RA 5DDLA 3H1NA 3FR9A 5ECPB 4N3ZA 1ZL9A 3M1GA 5AGYA 9GSSA 2OT3A 4I97A 3IK7A 3GX0A 2EFHA 3ZMLA 3GTUB 5D9WA 4GSSA 1QC7A 2K6XA 1PA3A 3QAGA 1AVHA 2NTOA 5A34A 18GSA 4G19A 4D7RA 2WB9A 4JMIA 1GSUA 2VCZA 3W8SA 3N9JA 1R8SE 4PXOA 3VPQA 5EL8A 1DUGA 3KMOA 2GLRA 1GSEA 5D9XA 4HZ4A 1LBKA 3RBTA 1U3IA 3DD3A 4FQUA 2FNOA 1XWKA 1PKZA 1OE7A 3KTLA 1BCZA 1M9AA 1EOHA 1XWGA 1AW9A 5DALB 1HNAA 1NHYA 3MAKA 4IQ1A 3TOTA 5BMUB 5ECHB 1N41A 4PURA 1JLWA 4OFMA 3G7JA 4WR4A 2CAIA 5J41A 4X9PA 4GF0A 2D2ZA 1V40A 3AY8A 5DCGA 6GSWA 1E6BA 4IBPA 1LJRA 6GSSA 1BX9A 4PHZC 2CA8A 4ZB7A 3IR4A 3SOHB 3EE2A 1VF3A 2VCWA 4ZB6A 2IICA 2HSMB 4YQUA 3R3EA 6GSVA 1G5NA 1JZRA 2GSTA 2WW2A 6GSXA 2C4JA 4PX1A 1BCYA 3ERFA 1ANXA 5GSTA 5F06A 1MCXA 3Q18A 4BVYB 1BYEA 5F0GA 3LQ7A
chains in the Genus database with same CATH topology
4E8EA 1PKWA 1G6YA 4OMVA 1U88A 2OA7A 3LSZA 5ELAA 2HSNB 3BBYA 16GSA 1GSFA 3UAPA 4EC0A 3IC8A 3VI7A 4N0VA 1K0DA 4Q5NA 5A1NB 1V2AA 2DSAA 1K0OA 4EE0A 3Q19A 2EFDA 5ECLB 3LYKA 3FR6A 5A5HB 3TU3B 5A4UA 5DAKB 2HRKB 4QQ7A 4ID0A 5ECNB 3PR8A 3VURA 1PBVA 4AGSA 5B7CA 4QMKA 5F05A 1EV9A 3SWLA 2ON7A 4G01A 1Q4JA 5EVOA 5DJLA 3M8NA 3Q74A 2F3MA 2YCDA 3VWXA 5J4VA 1AQVA 2GSRA 2PMTA 1ZGNA 1HNCA 4GLTA 2CAQA 2FHEA 4KX4A 2C8UA 2GSSA 1YKCA 4JXHA 3CRTA 5G5EA 3NIVA 2CZ2A 2X64A 2IL3A 4KN7X 5GSSA 5AIXA 3CSJA 1PL1A 4FQ0C 5FWGA 4OIYA 4ISDA 3LYPA 4KDXA 2VD0A 5D9TA 1K3LA 3LG6A 3VK9A 4G0IA 4EDZA 3VPTA 4BL7A 5EY6A 3DGQA 4NAXA 2EFEA 1PX7A 3F63A 4PGTA 1XT0B 4MDCA 4ZB9A 4ECJA 5BMUA 1BC9A 2PBJA 1USBA 4BVXB 1F2EA 3LTLA 2EFCA 3FRCA 4GSNA 3SWVA 2ON5A 5DQSA 1SVMA 5F07A 4GCIA 4C7PA 3U6VA 1GTUA 5KEJA 1A0FA 5JCWA 1M9BA 2PVQA 1K3YA 10GSA 4Q5RA 3IE3A 1GUHA 1RE0B 2HQTA 2PGTA 1B48A 4G10A 4ZB8A 4MF5A 4ZBAA 4Q5QA 3G7IA 2VCQA 3HKRA 4OFTA 4AKXB 2O5VA 5D73A 5J5NA 6GSUA 5J40A 17GSA 2N5FA 2R5GA 4ECBA 4L5MA 1MD3A 1Z9HA 4MPGA 22GSA 2VKZG 2WDUA 4G0LA 4MF6A 1GSQA 3O76A 1EV4A 4IS0A 3LFLA 5A1NA 4HI7A 2CZ3A 1S9DE 1XW5A 5FT3A 2H1LA 1R8ME 1PN9A 3O3TA 2CVDA 1GTBA 5A4WA 4KAEA 4PQIA 5DAKA 1PGTA 2HRKA 3GH6A 4F0CA 2IMIA 3AJCA 8GSSA 1YQ1A 1B4PA 1LKVX 2VD1A 1TU7A 5ECKB 1TXUA 14GSA 2VCTA 1K0CA 4PTSA 6GSYA 1GUKA 2V6KA 4NHZA 1PL2A 3VLNA 4MF7A 3ISOA 5ECIB 4MK3A 1XSZA 5JCUA 4JZQA 1OKTA 4KN4X 1SVLA 3PPUA 3M3MA 4D7QA 4MPFA 4ZBDA 3TOUA 2A2SA 3QAVA 4LMWA 5ECMB 3GSTA 4OFNA 7GSSA 4USSA 1K0AA 4A4PA 4KDYA 1BG5A 3HJLA 3MDKA 1Y1UA 1B8XA 1VF1A 4RI7A 2AB6A 1XW6A 4PQHA 1YVLA 4GDFA 4CHSA 3FYGA 5LCZA 4KH7A 1KU1A 2GSQA 2PERA 4O7HA 4AKIA 2LJRA 1IYHA 4IJIA 3KJYA 2WRTA 4E8HA 1TW9A 3GTUA 2IMKA 2GTUA 1UA5A 1R8QE 5G5FA 4C0AA 1VF2A 1M0UA 1GNEA 1AQWA 4KGIA 3UARA 2VO4A 5J47A 1OYJA 1GWCA 4KMUX 2R4VA 5FHIA 1YJ6A 3QR6A 5ECRB 2OADA 1VF4A 1GUMA 3R2QA 3CWGA 19GSA 3FY7A 1JLVA 2C3TA 1GTAA 3LXTA 5DALA 1GULA 2HRAA 4YAVA 4JK1X 4RI6A 4AKHA 3EINA 4ECCA 1AXDA 3ZFBA 1GSYA 3KM6A 5ELGA 4HJ2A 4LMVA 2J9HA 5ECQB 5F8BA 4ZBBA 3TGZA 4Q5FA 5ECSA 4HOJA 3VI5A 5ECOB 5A4VA 4W66A 3GURA 1PMTA 3ZFLA 4PNGA 3HMJG 1EOGA 2WS2A 2HSMA 3UBKA 1HQOA 2F8FA 4K0GA 4KSMA 4JBBA 4F03A 1F3AA 2AHEA 3PGTA 4YAPA 1K0MA 4BVYA 2JL4A 4JEDA 6GSTA 1BAYA 4IVFA 4YH2A 1GSSA 4BL7B 4L5OA 1N2AA 2HSNA 2DC5A 4YQVA 1YY7A 1G6WA 4J2FA 3TW5A 5A34B 4DEJA 12GSA 4O92A 5IQYA 2YV7A 4KE3A 3CBUA 2C3QA 20GSA 5A5HA 3FR3A 3GSSA 5AIVA 4IW9A 1FW1A 3P90A 1EEMA 5J4YA 1GSDA 4IELA 3KMNA 3F6FA 3LXZA 4E68A 4L8EA 2R6KA 1PX6A 3HJOA 3CRUA 4IKHA 1MD4A 4NHWA 3ZMKA 4Z21A 3M0FA 4HZ2A 1YDKA 4F0BA 2C80A 4GSTA 4YQMA 1K3OA 2YV9A 3CSHA 1K0BA 2R0DA 5J4UA 2R3XA 11GSA 4KF9A 5GZZB 4PUAA 4ACSA 1GLQA 3L8NA 3C8EA 4AKGA 3WD6A 3USYA 2C3NA 4IGJA 1U87A 1F3BA 3I6AA 1GLPA 2UV8G 1RK4A 1Y6EA 4GTUA 2OACA 1K0NA 3ERGA 1M99A 1N25A 4TOPA 1IYIA 3QAWA 1Q8DA 1FHEA 2UZ8A 4G0KA 5A5KA 1BF5A 1SVOA 1TU8A 2WJUA 3UVHA 4EXJA 1HNBA 1GTIA 2AAWA 4JMOA 3LJRA 3N5OA 1KBNA 1C72A 3UBLA 1R5AA 3P8WA 3HJMA 4EDYA 4BVXA 5AISA 4ZXGA 3F6DA 2HNLA 1BG1A 2R09A 3GUSA 3KXOA 2VCXA 1MTCA 3D0ZA 4G9HA 4MP4A 3CSIA 3IBHA 3L0HA 1ML6A 4FHRB 4PNFA 2GDRA 4AI6A 5LD0A 5AN1A 3I69A 5D9VA 4MZWA 4IQAA 4L5LA 3IK9A 4WR5A 3WYWA 1GNWA 5DJMA 1G7OA 1PD21 13GSA 1TDIA 4ECIA 3USWA 2VCVA 4K0NA 5HFKA 1OE8A 4JWLA 1AQXA 4KDUA 2A2RA 5DDLA 3H1NA 3FR9A 5ECPB 4N3ZA 1ZL9A 3M1GA 5AGYA 9GSSA 2OT3A 4I97A 3IK7A 3GX0A 2EFHA 3ZMLA 3GTUB 5D9WA 4GSSA 1QC7A 2K6XA 1PA3A 3QAGA 2NTOA 5A34A 18GSA 4G19A 4D7RA 2WB9A 4JMIA 1GSUA 2VCZA 3W8SA 3N9JA 1R8SE 4PXOA 3VPQA 5EL8A 1DUGA 3KMOA 2GLRA 1GSEA 5D9XA 4HZ4A 1LBKA 3RBTA 1U3IA 3DD3A 4FQUA 2FNOA 1XWKA 1PKZA 1OE7A 3KTLA 1M9AA 1EOHA 1XWGA 1AW9A 5DALB 1HNAA 1NHYA 3MAKA 4IQ1A 3TOTA 5BMUB 5ECHB 4PURA 1JLWA 4OFMA 3G7JA 4WR4A 2CAIA 5J41A 4GF0A 2D2ZA 1V40A 3AY8A 5DCGA 6GSWA 1E6BA 4IBPA 1LJRA 6GSSA 1BX9A 2CA8A 4ZB7A 3IR4A 3SOHB 3EE2A 1VF3A 2VCWA 4ZB6A 2HSMB 4YQUA 3R3EA 6GSVA 1JZRA 2GSTA 6GSXA 2C4JA 4PX1A 3ERFA 5GSTA 5F06A 3Q18A 4BVYB 1BYEA 5F0GA 3LQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSN A; 
#chains in the Genus database with same CATH topology
 4E8E A;  1PKW A;  2WW1 A;  1G6Y A;  1AOW A;  4OMV A;  1U88 A;  2OA7 A;  3LSZ A;  5ELA A;  2HSN B;  3BBY A;  16GS A;  1GSF A;  3UAP A;  4EC0 A;  3IC8 A;  3VI7 A;  1N44 A;  4N0V A;  1K0D A;  4Q5N A;  5A1N B;  1V2A A;  4HRE A;  1AII A;  2DSA A;  1K0O A;  4EE0 A;  3Q19 A;  3RGB C;  2EFD A;  5ECL B;  3LYK A;  3FR6 A;  5A5H B;  3TU3 B;  5A4U A;  5DAK B;  2HRK B;  4QQ7 A;  4ID0 A;  5ECN B;  3PR8 A;  3VUR A;  1PBV A;  4AGS A;  5B7C A;  2Q4C A;  4QMK A;  5F05 A;  4MDU A;  1EV9 A;  3SWL A;  2ON7 A;  4G01 A;  1Q4J A;  5EVO A;  5DJL A;  3M8N A;  1BO9 A;  3Q74 A;  2F3M A;  2YCD A;  2VXG A;  1W45 A;  3VWX A;  5J4V A;  1AQV A;  2GSR A;  2PMT A;  1ZGN A;  1XJL A;  1HNC A;  4GLT A;  2CAQ A;  2FHE A;  4KX4 A;  2C8U A;  2GSS A;  1YKC A;  4JXH A;  3CRT A;  5G5E A;  3NIV A;  2CZ2 A;  2X64 A;  2IL3 A;  4KN7 X;  5GSS A;  4EVF A;  5AIX A;  2HYW A;  3CSJ A;  1PL1 A;  4FQ0 C;  5FWG A;  4OIY A;  4ISD A;  3LYP A;  4KDX A;  2VD0 A;  1I1I P;  5D9T A;  1K3L A;  3LG6 A;  3VK9 A;  4G0I A;  4EDZ A;  3VPT A;  4BL7 A;  5EY6 A;  3DGQ A;  4NAX A;  2EFE A;  1PX7 A;  3F63 A;  1M9I A;  3ANY A;  1XT0 B;  4PGT A;  4MDC A;  4ZB9 A;  4ECJ A;  5BMU A;  1BC9 A;  2PBJ A;  1USB A;  4BVX B;  1F2E A;  3AO0 A;  2WW0 A;  3LTL A;  2EFC A;  2RAN A;  2WVY A;  3FRC A;  4GSN A;  3SWV A;  2ON5 A;  5DQS A;  1SVM A;  1HVF A;  5F07 A;  4GCI A;  4C7P A;  3U6V A;  1GTU A;  5KEJ A;  1A0F A;  5JCW A;  1HM6 A;  1M9B A;  2PVQ A;  1K3Y A;  10GS A;  4Q5R A;  3IE3 A;  1GUH A;  1RE0 B;  2HQT A;  2PGT A;  4Q2S A;  1B48 A;  4G10 A;  4ZB8 A;  4MF5 A;  1S4B P;  4ZBA A;  4Q5Q A;  3G7I A;  2VCQ A;  3HKR A;  4OFT A;  4AKX B;  2O5V A;  5D73 A;  5J5N A;  6GSU A;  5J40 A;  4FXY P;  17GS A;  2N5F A;  2R5G A;  4ECB A;  4L5M A;  2O36 A;  1MD3 A;  1Z9H A;  4MPG A;  22GS A;  2VKZ G;  2WDU A;  4G0L A;  4MF6 A;  3ABO A;  1GSQ A;  3O76 A;  1EV4 A;  4IS0 A;  3LFL A;  5A1N A;  4HI7 A;  2CZ3 A;  1S9D E;  1XW5 A;  5FT3 A;  2H1L A;  1R8M E;  1PN9 A;  1SAV A;  3O3T A;  2CVD A;  1GTB A;  5A4W A;  2HYU A;  4KAE A;  1N42 A;  2WVZ A;  4PQI A;  2WVX B;  5DAK A;  1PGT A;  2HRK A;  3GH6 A;  4F0C A;  2IMI A;  3AJC A;  8GSS A;  1YQ1 A;  1BC3 A;  1B4P A;  1LKV X;  1AXN A;  2VD1 A;  1TU7 A;  5ECK B;  1TXU A;  2WW3 A;  14GS A;  2VCT A;  1K0C A;  4PTS A;  6GSY A;  3RFR C;  1GUK A;  2V6K A;  4NHZ A;  1PL2 A;  1YCN A;  2H0L A;  3VLN A;  4MF7 A;  3ISO A;  5ECI B;  4MK3 A;  1XSZ A;  5JCU A;  4JZQ A;  1A8B A;  1OKT A;  4KN4 X;  1SVL A;  3PPU A;  3M3M A;  4D7Q A;  4MPF A;  4ZBD A;  3TOU A;  3BRX A;  2A2S A;  3QAV A;  4LMW A;  5ECM B;  3GST A;  4OFN A;  1YJ0 A;  7GSS A;  4USS A;  1K0A A;  4A4P A;  4KDY A;  1BG5 A;  3HJL A;  3MDK A;  1Y1U A;  1B8X A;  1HVE A;  1VF1 A;  4RI7 A;  2AB6 A;  1XW6 A;  4PQH A;  1YVL A;  4GDF A;  4CHS A;  3FYG A;  5LCZ A;  4KH7 A;  1KU1 A;  2GSQ A;  2XO3 A;  2PER A;  4O7H A;  4AKI A;  2LJR A;  1IYH A;  1HVD A;  4IJI A;  3KJY A;  2WRT A;  4E8H A;  1TW9 A;  3GTU A;  2IMK A;  2GTU A;  1UA5 A;  2WZS A;  1R8Q E;  5G5F A;  4C0A A;  1VF2 A;  2QEZ A;  1M0U A;  1GNE A;  1AQW A;  4KGI A;  3UAR A;  2VO4 A;  5J47 A;  1OYJ A;  1ANN A;  1GWC A;  4KMU X;  2R4V A;  5FHI A;  1YJ6 A;  3QR6 A;  5ECR B;  2OAD A;  1VF4 A;  1GUM A;  3R2Q A;  3CWG A;  19GS A;  3FY7 A;  1JLV A;  2C3T A;  3CHX C;  2ZOC A;  1GTA A;  3LXT A;  3ABQ A;  5DAL A;  1GUL A;  2HRA A;  4YAV A;  4JK1 X;  4RI6 A;  4AKH A;  3EIN A;  4ECC A;  2ZHI A;  1AXD A;  3ZFB A;  1GSY A;  3KM6 A;  5ELG A;  4HJ2 A;  4LMV A;  2J9H A;  5ECQ B;  5F8B A;  4ZBB A;  3TGZ A;  4Q5F A;  5ECS A;  4HOJ A;  3VI5 A;  5ECO B;  5A4V A;  4W66 A;  3GUR A;  1PMT A;  3ZFL A;  4PNG A;  3HMJ G;  1EOG A;  2WS2 A;  2HSM A;  3UBK A;  1HQO A;  1R4A E;  2IE6 A;  1BCW A;  2O3E A;  2F8F A;  4K0G A;  4KSM A;  4JBB A;  2H0K A;  1F3A A;  4F03 A;  2AHE A;  3PGT A;  4YAP A;  1K0M A;  2WVX A;  4BVY A;  2JL4 A;  4JED A;  6GST A;  1BAY A;  4IVF A;  4YH2 A;  1GSS A;  1I4A A;  4BL7 B;  4L5O A;  1N2A A;  2HSN A;  2DC5 A;  1BC1 A;  4YQV A;  1YY7 A;  1G6W A;  4J2F A;  3TW5 A;  1YGM A;  5A34 B;  1HVG A;  4DEJ A;  12GS A;  4O92 A;  5IQY A;  2YV7 A;  4KE3 A;  3CBU A;  2C3Q A;  2H0M A;  20GS A;  5A5H A;  3FR3 A;  3GSS A;  1N00 A;  5AIV A;  4IW9 A;  1FW1 A;  4EVH A;  3P90 A;  4PI0 C;  1EEM A;  5J4Y A;  1GSD A;  4IEL A;  3KMN A;  4PI2 C;  3F6F A;  3LXZ A;  4E68 A;  4L8E A;  2R6K A;  1PX6 A;  3HJO A;  3CRU A;  4IKH A;  1MD4 A;  1W3W A;  4NHW A;  3ZMK A;  4Z21 A;  3M0F A;  4HZ2 A;  3ABS A;  1YDK A;  4F0B A;  2C80 A;  4GST A;  4YQM A;  1K3O A;  2YV9 A;  3CSH A;  1ANW A;  2R0D A;  1K0B A;  2R3X A;  5J4U A;  11GS A;  4KF9 A;  5GZZ B;  4PUA A;  4ACS A;  1GLQ A;  3L8N A;  3C8E A;  4AKG A;  3WD6 A;  3USY A;  2C3N A;  4IGJ A;  1U87 A;  1YII A;  1F3B A;  3I6A A;  1GLP A;  2UV8 G;  1RK4 A;  1Y6E A;  4GTU A;  2OAC A;  2HYV A;  1K0N A;  3ERG A;  1M99 A;  1N25 A;  4TOP A;  3ABR A;  1IYI A;  3QAW A;  1Q8D A;  1FHE A;  2UZ8 A;  4G0K A;  5A5K A;  1BF5 A;  1SVO A;  1TU8 A;  2WJU A;  3UVH A;  4EXJ A;  1HNB A;  1GTI A;  2AAW A;  1HAK A;  1A8A A;  4JMO A;  3LJR A;  3N5O A;  1KBN A;  1DK5 A;  1C72 A;  2II2 A;  1AVR A;  3UBL A;  1R5A A;  3P8W A;  1AVC A;  3HJM A;  4EDY A;  2XO2 A;  1AEI A;  1BC0 A;  4BVX A;  5AIS A;  4ZXG A;  3F6D A;  2HNL A;  1BG1 A;  2R09 A;  1W7B A;  2ZHJ A;  3GUS A;  3KXO A;  2VCX A;  1MTC A;  3D0Z A;  4G9H A;  4MP4 A;  3CSI A;  3IBH A;  3L0H A;  1ML6 A;  4FHR B;  4PNF A;  2GDR A;  4AI6 A;  5LD0 A;  5AN1 A;  3I69 A;  5D9V A;  4MZW A;  4IQA A;  4L5L A;  3IK9 A;  4WR5 A;  1YEW C;  3WYW A;  1UPT B;  1GNW A;  5DJM A;  1G7O A;  1PD2 1;  1ALA A;  1C1K A;  13GS A;  1TDI A;  4ECI A;  4MDV A;  3USW A;  2VCV A;  2IE7 A;  4K0N A;  5HFK A;  1DM5 A;  2OY9 A;  1OE8 A;  4JWL A;  1AQX A;  4KDU A;  2A2R A;  5DDL A;  3H1N A;  3FR9 A;  5ECP B;  4N3Z A;  1ZL9 A;  3M1G A;  5AGY A;  9GSS A;  2OT3 A;  4I97 A;  3IK7 A;  3GX0 A;  2EFH A;  3ZML A;  3GTU B;  5D9W A;  4GSS A;  1QC7 A;  2K6X A;  1PA3 A;  3QAG A;  1AVH A;  2NTO A;  5A34 A;  18GS A;  4G19 A;  4D7R A;  2WB9 A;  4JMI A;  1GSU A;  2VCZ A;  3W8S A;  3N9J A;  1R8S E;  4PXO A;  3VPQ A;  5EL8 A;  1DUG A;  3KMO A;  2GLR A;  1GSE A;  5D9X A;  4HZ4 A;  1LBK A;  3RBT A;  1U3I A;  3DD3 A;  4FQU A;  2FNO A;  1XWK A;  1PKZ A;  1OE7 A;  3KTL A;  1BCZ A;  1M9A A;  1EOH A;  1XWG A;  1AW9 A;  5DAL B;  1HNA A;  1NHY A;  3MAK A;  4IQ1 A;  3TOT A;  5BMU B;  5ECH B;  1N41 A;  4PUR A;  1JLW A;  4OFM A;  3G7J A;  4WR4 A;  2CAI A;  5J41 A;  4X9P A;  4GF0 A;  2D2Z A;  1V40 A;  3AY8 A;  5DCG A;  6GSW A;  1E6B A;  4IBP A;  1LJR A;  6GSS A;  1BX9 A;  4PHZ C;  2CA8 A;  4ZB7 A;  3IR4 A;  3SOH B;  3EE2 A;  1VF3 A;  2VCW A;  4ZB6 A;  2IIC A;  2HSM B;  4YQU A;  3R3E A;  6GSV A;  1G5N A;  1JZR A;  2GST A;  2WW2 A;  6GSX A;  2C4J A;  4PX1 A;  1BCY A;  3ERF A;  1ANX A;  5GST A;  5F06 A;  1MCX A;  3Q18 A;  4BVY B;  1BYE A;  5F0G A;  3LQ7 A; 
#chains in the Genus database with same CATH homology
 4E8E A;  1PKW A;  1G6Y A;  4OMV A;  1U88 A;  2OA7 A;  3LSZ A;  5ELA A;  2HSN B;  3BBY A;  16GS A;  1GSF A;  3UAP A;  4EC0 A;  3IC8 A;  3VI7 A;  4N0V A;  1K0D A;  4Q5N A;  5A1N B;  1V2A A;  2DSA A;  1K0O A;  4EE0 A;  3Q19 A;  2EFD A;  5ECL B;  3LYK A;  3FR6 A;  5A5H B;  3TU3 B;  5A4U A;  5DAK B;  2HRK B;  4QQ7 A;  4ID0 A;  5ECN B;  3PR8 A;  3VUR A;  1PBV A;  4AGS A;  5B7C A;  4QMK A;  5F05 A;  1EV9 A;  3SWL A;  2ON7 A;  4G01 A;  1Q4J A;  5EVO A;  5DJL A;  3M8N A;  3Q74 A;  2F3M A;  2YCD A;  3VWX A;  5J4V A;  1AQV A;  2GSR A;  2PMT A;  1ZGN A;  1HNC A;  4GLT A;  2CAQ A;  2FHE A;  4KX4 A;  2C8U A;  2GSS A;  1YKC A;  4JXH A;  3CRT A;  5G5E A;  3NIV A;  2CZ2 A;  2X64 A;  2IL3 A;  4KN7 X;  5GSS A;  5AIX A;  3CSJ A;  1PL1 A;  4FQ0 C;  5FWG A;  4OIY A;  4ISD A;  3LYP A;  4KDX A;  2VD0 A;  5D9T A;  1K3L A;  3LG6 A;  3VK9 A;  4G0I A;  4EDZ A;  3VPT A;  4BL7 A;  5EY6 A;  3DGQ A;  4NAX A;  2EFE A;  1PX7 A;  3F63 A;  4PGT A;  1XT0 B;  4MDC A;  4ZB9 A;  4ECJ A;  5BMU A;  1BC9 A;  2PBJ A;  1USB A;  4BVX B;  1F2E A;  3LTL A;  2EFC A;  3FRC A;  4GSN A;  3SWV A;  2ON5 A;  5DQS A;  1SVM A;  5F07 A;  4GCI A;  4C7P A;  3U6V A;  1GTU A;  5KEJ A;  1A0F A;  5JCW A;  1M9B A;  2PVQ A;  1K3Y A;  10GS A;  4Q5R A;  3IE3 A;  1GUH A;  1RE0 B;  2HQT A;  2PGT A;  1B48 A;  4G10 A;  4ZB8 A;  4MF5 A;  4ZBA A;  4Q5Q A;  3G7I A;  2VCQ A;  3HKR A;  4OFT A;  4AKX B;  2O5V A;  5D73 A;  5J5N A;  6GSU A;  5J40 A;  17GS A;  2N5F A;  2R5G A;  4ECB A;  4L5M A;  1MD3 A;  1Z9H A;  4MPG A;  22GS A;  2VKZ G;  2WDU A;  4G0L A;  4MF6 A;  1GSQ A;  3O76 A;  1EV4 A;  4IS0 A;  3LFL A;  5A1N A;  4HI7 A;  2CZ3 A;  1S9D E;  1XW5 A;  5FT3 A;  2H1L A;  1R8M E;  1PN9 A;  3O3T A;  2CVD A;  1GTB A;  5A4W A;  4KAE A;  4PQI A;  5DAK A;  1PGT A;  2HRK A;  3GH6 A;  4F0C A;  2IMI A;  3AJC A;  8GSS A;  1YQ1 A;  1B4P A;  1LKV X;  2VD1 A;  1TU7 A;  5ECK B;  1TXU A;  14GS A;  2VCT A;  1K0C A;  4PTS A;  6GSY A;  1GUK A;  2V6K A;  4NHZ A;  1PL2 A;  3VLN A;  4MF7 A;  3ISO A;  5ECI B;  4MK3 A;  1XSZ A;  5JCU A;  4JZQ A;  1OKT A;  4KN4 X;  1SVL A;  3PPU A;  3M3M A;  4D7Q A;  4MPF A;  4ZBD A;  3TOU A;  2A2S A;  3QAV A;  4LMW A;  5ECM B;  3GST A;  4OFN A;  7GSS A;  4USS A;  1K0A A;  4A4P A;  4KDY A;  1BG5 A;  3HJL A;  3MDK A;  1Y1U A;  1B8X A;  1VF1 A;  4RI7 A;  2AB6 A;  1XW6 A;  4PQH A;  1YVL A;  4GDF A;  4CHS A;  3FYG A;  5LCZ A;  4KH7 A;  1KU1 A;  2GSQ A;  2PER A;  4O7H A;  4AKI A;  2LJR A;  1IYH A;  4IJI A;  3KJY A;  2WRT A;  4E8H A;  1TW9 A;  3GTU A;  2IMK A;  2GTU A;  1UA5 A;  1R8Q E;  5G5F A;  4C0A A;  1VF2 A;  1M0U A;  1GNE A;  1AQW A;  4KGI A;  3UAR A;  2VO4 A;  5J47 A;  1OYJ A;  1GWC A;  4KMU X;  2R4V A;  5FHI A;  1YJ6 A;  3QR6 A;  5ECR B;  2OAD A;  1VF4 A;  1GUM A;  3R2Q A;  3CWG A;  19GS A;  3FY7 A;  1JLV A;  2C3T A;  1GTA A;  3LXT A;  5DAL A;  1GUL A;  2HRA A;  4YAV A;  4JK1 X;  4RI6 A;  4AKH A;  3EIN A;  4ECC A;  1AXD A;  3ZFB A;  1GSY A;  3KM6 A;  5ELG A;  4HJ2 A;  4LMV A;  2J9H A;  5ECQ B;  5F8B A;  4ZBB A;  3TGZ A;  4Q5F A;  5ECS A;  4HOJ A;  3VI5 A;  5ECO B;  5A4V A;  4W66 A;  3GUR A;  1PMT A;  3ZFL A;  4PNG A;  3HMJ G;  1EOG A;  2WS2 A;  2HSM A;  3UBK A;  1HQO A;  2F8F A;  4K0G A;  4KSM A;  4JBB A;  4F03 A;  1F3A A;  2AHE A;  3PGT A;  4YAP A;  1K0M A;  4BVY A;  2JL4 A;  4JED A;  6GST A;  1BAY A;  4IVF A;  4YH2 A;  1GSS A;  4BL7 B;  4L5O A;  1N2A A;  2HSN A;  2DC5 A;  4YQV A;  1YY7 A;  1G6W A;  4J2F A;  3TW5 A;  5A34 B;  4DEJ A;  12GS A;  4O92 A;  5IQY A;  2YV7 A;  4KE3 A;  3CBU A;  2C3Q A;  20GS A;  5A5H A;  3FR3 A;  3GSS A;  5AIV A;  4IW9 A;  1FW1 A;  3P90 A;  1EEM A;  5J4Y A;  1GSD A;  4IEL A;  3KMN A;  3F6F A;  3LXZ A;  4E68 A;  4L8E A;  2R6K A;  1PX6 A;  3HJO A;  3CRU A;  4IKH A;  1MD4 A;  4NHW A;  3ZMK A;  4Z21 A;  3M0F A;  4HZ2 A;  1YDK A;  4F0B A;  2C80 A;  4GST A;  4YQM A;  1K3O A;  2YV9 A;  3CSH A;  1K0B A;  2R0D A;  5J4U A;  2R3X A;  11GS A;  4KF9 A;  5GZZ B;  4PUA A;  4ACS A;  1GLQ A;  3L8N A;  3C8E A;  4AKG A;  3WD6 A;  3USY A;  2C3N A;  4IGJ A;  1U87 A;  1F3B A;  3I6A A;  1GLP A;  2UV8 G;  1RK4 A;  1Y6E A;  4GTU A;  2OAC A;  1K0N A;  3ERG A;  1M99 A;  1N25 A;  4TOP A;  1IYI A;  3QAW A;  1Q8D A;  1FHE A;  2UZ8 A;  4G0K A;  5A5K A;  1BF5 A;  1SVO A;  1TU8 A;  2WJU A;  3UVH A;  4EXJ A;  1HNB A;  1GTI A;  2AAW A;  4JMO A;  3LJR A;  3N5O A;  1KBN A;  1C72 A;  3UBL A;  1R5A A;  3P8W A;  3HJM A;  4EDY A;  4BVX A;  5AIS A;  4ZXG A;  3F6D A;  2HNL A;  1BG1 A;  2R09 A;  3GUS A;  3KXO A;  2VCX A;  1MTC A;  3D0Z A;  4G9H A;  4MP4 A;  3CSI A;  3IBH A;  3L0H A;  1ML6 A;  4FHR B;  4PNF A;  2GDR A;  4AI6 A;  5LD0 A;  5AN1 A;  3I69 A;  5D9V A;  4MZW A;  4IQA A;  4L5L A;  3IK9 A;  4WR5 A;  3WYW A;  1GNW A;  5DJM A;  1G7O A;  1PD2 1;  13GS A;  1TDI A;  4ECI A;  3USW A;  2VCV A;  4K0N A;  5HFK A;  1OE8 A;  4JWL A;  1AQX A;  4KDU A;  2A2R A;  5DDL A;  3H1N A;  3FR9 A;  5ECP B;  4N3Z A;  1ZL9 A;  3M1G A;  5AGY A;  9GSS A;  2OT3 A;  4I97 A;  3IK7 A;  3GX0 A;  2EFH A;  3ZML A;  3GTU B;  5D9W A;  4GSS A;  1QC7 A;  2K6X A;  1PA3 A;  3QAG A;  2NTO A;  5A34 A;  18GS A;  4G19 A;  4D7R A;  2WB9 A;  4JMI A;  1GSU A;  2VCZ A;  3W8S A;  3N9J A;  1R8S E;  4PXO A;  3VPQ A;  5EL8 A;  1DUG A;  3KMO A;  2GLR A;  1GSE A;  5D9X A;  4HZ4 A;  1LBK A;  3RBT A;  1U3I A;  3DD3 A;  4FQU A;  2FNO A;  1XWK A;  1PKZ A;  1OE7 A;  3KTL A;  1M9A A;  1EOH A;  1XWG A;  1AW9 A;  5DAL B;  1HNA A;  1NHY A;  3MAK A;  4IQ1 A;  3TOT A;  5BMU B;  5ECH B;  4PUR A;  1JLW A;  4OFM A;  3G7J A;  4WR4 A;  2CAI A;  5J41 A;  4GF0 A;  2D2Z A;  1V40 A;  3AY8 A;  5DCG A;  6GSW A;  1E6B A;  4IBP A;  1LJR A;  6GSS A;  1BX9 A;  2CA8 A;  4ZB7 A;  3IR4 A;  3SOH B;  3EE2 A;  1VF3 A;  2VCW A;  4ZB6 A;  2HSM B;  4YQU A;  3R3E A;  6GSV A;  1JZR A;  2GST A;  6GSX A;  2C4J A;  4PX1 A;  3ERF A;  5GST A;  5F06 A;  3Q18 A;  4BVY B;  1BYE A;  5F0G A;  3LQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...