2HSNA

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MSFLISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFDANAILRYVMDDFEGQTSDKYQFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPLTTTDLILFANVYALNSSLVHSKFPELPSKVHNAVALAKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 42
structure length 160
sequence length 160
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09635 MetRS-N MetRS-N binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.140 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2hsnA01
1.20.1050.110 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsnA02
2HSNA
chains in the Genus database with same CATH superfamily
1YCNA 1PGTA 1U88A 3HMJG 1K0NA 2WVYA 1ANNA 3KJYA 2PBJA 1GTAA 1SVOA 4AGSA 5DJMA 4KAEA 1XJLA 2HYWA 4WR5A 5J4UA 1VF3A 2YCDA 3C8EA 3P8WA 2HSMA 2WW3A 2HRKB 1HM6A 1PKWA 3QR6A 4KMUX 4Q5RA 7GSSA 2CZ2A 1FW1A 19GSA 5DJLA 2NTOA 4ZB9A 3Q74A 5A4VA 3EE2A 2OT3A 2HSNB 4GTUA 4KSMA 4ZXGA 1PN9A 1PX6A 4PI2C 3GTUA 4OMVA 2C3TA 4JBBA 5LD0A 4RI7A 4JMIA 2PVQA 2R5GA 2OY9A 1K3YA 3LFLA 4J2FA 2WB9A 1B8XA 4L5OA 4ECBA 4IBPA 3LTLA 6GSXA 3RBTA 2C3QA 2O5VA 3UVHA 5D9XA 1SAVA 4N3ZA 1SVLA 4PUAA 13GSA 4PQHA 5D9WA 16GSA 4I97A 4ACSA 1UPTB 2OADA 5AIXA 5F07A 4ZBBA 1PX7A 6GSSA 4PQIA 3KMOA 3HJMA 1K3LA 5AISA 2D2ZA 4NHZA 5AIVA 5AN1A 4EDYA 1I4AA 3IBHA 2PGTA 2ZHIA 2EFEA 2IE6A 1B4PA 4ZB8A 3HKRA 2VCWA 2OA7A 1PA3A 4FQUA 4F0BA 1TU7A 4JK1X 3FR6A 4QMKA 1Z9HA 1N41A 4EE0A 2C80A 3GH6A 3TU3B 4MF5A 1HVFA 1YIIA 1AQVA 5EVOA 4EVHA 2IICA 2UV8G 4E68A 5FT3A 1C72A 2WVXB 3VI5A 4IQ1A 3KM6A 4NHWA 1V40A 3UBLA 1ML6A 2ON5A 4PX1A 4HZ4A 3BRXA 3IC8A 3R3EA 2R4VA 1A8AA 2WJUA 2N5FA 2VCQA 4IW9A 1USBA 2H0MA 8GSSA 4D7QA 5DAKB 4AI6A 1LJRA 2AAWA 2J9HA 1GTUA 5AGYA 3VLNA 4BVYA 4ECIA 1UA5A 3U6VA 4FHRB 1TU8A 4ZB6A 2O3EA 5A34A 3VK9A 9GSSA 5ECQB 3QAVA 3ABSA 1I1IP 4JWLA 3PGTA 1XSZA 5IQYA 4OIYA 5EY6A 2WDUA 1GSUA 2PERA 2PMTA 12GSA 1PKZA 1U87A 4IKHA 5A5HB 6GSWA 1K3OA 2A2RA 5D73A 1F3AA 4L8EA 4L5MA 5J5NA 1G6WA 3KTLA 2O36A 3RGBC 1F3BA 4KH7A 1HVEA 4G0IA 1TXUA 1EV9A 4GCIA 4F0CA 4AKIA 1EEMA 2EFHA 3BBYA 3FY7A 2R6KA 3VPQA 2VO4A 1G5NA 1MTCA 1S4BP 1HNCA 3G7IA 2C3NA 1K0OA 4RI6A 4KDUA 4GLTA 3LXZA 3F63A 4KDXA 4JEDA 2H0LA 5ECKB 3L0HA 3IE3A 3VI7A 1ZGNA 5J4YA 5J41A 2F8FA 4IVFA 5DALA 3CBUA 1R4AE 2GDRA 3HJOA 3MDKA 1TDIA 3GSSA 4MF6A 5DQSA 2IMKA 3SWLA 2WRTA 4MDUA 1LKVX 3GX0A 4AKGA 3ZFLA 1EOHA 1YKCA 1GUKA 3G7JA 1GSYA 3EINA 6GSYA 4YQUA 4C7PA 5A4UA 1BC3A 1HVDA 4F03A 1N25A 5GZZB 1VF1A 4MPFA 1BYEA 1BCWA 2HRKA 4ZBAA 1AXDA 1R8QE 1JLWA 1BCZA 5A1NB 2VCXA 4ZBDA 3RFRC 1K0BA 4MK3A 1F2EA 2XO3A 1BF5A 3IK9A 3L8NA 3VURA 1BCYA 3I69A 4FXYP 2WW0A 5D9VA 2HSNA 4KGIA 3QAGA 2QEZA 2F3MA 1GUHA 1M9BA 4Z21A 5F8BA 1JLVA 22GSA 2YV9A 4D7RA 2ON7A 5ELGA 4O92A 1IYIA 5ELAA 4PNGA 4ID0A 4IS0A 1GNWA 5FWGA 1GSEA 4KN4X 2WW2A 3NIVA 4GF0A 4N0VA 5BMUB 1YVLA 1IYHA 3P90A 3M0FA 2II2A 3F6DA 4USSA 1YGMA 3TW5A 1FHEA 4QQ7A 4JZQA 4KN7X 1OE8A 3WYWA 2Q4CA 5G5FA 4Q2SA 1HNAA 1U3IA 4BVXB 1Q8DA 5A4WA 2V6KA 2HNLA 3UARA 10GSA 1DM5A 2X64A 4HI7A 5EL8A 3ZMLA 4YAPA 4MF7A 5ECNB 5A5KA 4GSTA 2VD1A 1XW5A 4IELA 4X9PA 5ECOB 1GULA 1YJ0A 2CVDA 1HAKA 1GTIA 3O3TA 5G5EA 5GSSA 1GNEA 4TOPA 4DEJA 3ERFA 1AQXA 5LCZA 2HQTA 5GSTA 4BL7B 3IK7A 1Y1UA 4K0GA 4Q5FA 3M8NA 11GSA 5FHIA 3N5OA 1R8ME 2FHEA 1XW6A 3USYA 1NHYA 5ECHB 4PGTA 4OFNA 2WVXA 1GWCA 3PR8A 3CSHA 1AIIA 3F6FA 3ISOA 3AJCA 2EFDA 3ABRA 1OE7A 3CWGA 4ISDA 1EV4A 1K0DA 3SOHB 2WS2A 3LSZA 4K0NA 1AEIA 2GLRA 5DAKA 1MD3A 5ECMB 4O7HA 1AVRA 4Q5QA 6GSTA 1EOGA 1M99A 1GLPA 1XT0B 3ZFBA 1K0CA 1W7BA 4PHZC 4AKXB 20GSA 2GSSA 5ECPB 4CHSA 2CAIA 4HZ2A 3FYGA 1YDKA 4OFTA 5D9TA 1XWKA 4JMOA 3W8SA 3ZMKA 1TW9A 1XWGA 4G01A 4MZWA 1PBVA 2ZOCA 2HSMB 2VKZG 1G7OA 1W3WA 2H1LA 5A5HA 1DUGA 3LJRA 4EC0A 1VF4A 5DALB 5J40A 1PMTA 2AB6A 3TOTA 4L5LA 2R09A 4GSNA 3I6AA 2UZ8A 4ECCA 3R2QA 2IL3A 4G0KA 4MPGA 5JCWA 1MCXA 3FR3A 3IR4A 1AXNA 2C4JA 4KX4A 2WZSA 1SVMA 1HNBA 2WW1A 18GSA 5F06A 2ZHJA 3SWVA 2R3XA 4A4PA 4KF9A 2DSAA 4G19A 3GTUB 1ZL9A 3LYPA 1B48A 1KU1A 3GSTA 1YEWC 2WVZA 4IJIA 1AOWA 1N44A 2VXGA 1K0AA 1A8BA 3M3MA 3VWXA 3ANYA 2GSQA 5ECRB 4MP4A 4PXOA 1Q4JA 1AVCA 4HJ2A 1GSQA 2YV7A 1M0UA 1GSSA 1AW9A 3DD3A 1GTBA 4C0AA 1RK4A 3M1GA 3CRTA 2H0KA 3CSIA 2K6XA 1Y6EA 1AQWA 4LMWA 4FQ0C 1A0FA 2JL4A 2GSRA 4IQAA 4G9HA 3HJLA 1E6BA 3CSJA 1C1KA 1OYJA 1ALAA 4YAVA 4G10A 1N00A 1ANXA 1OKTA 4ECJA 2RANA 4PURA 3LQ7A 4EXJA 5A1NA 6GSVA 1K0MA 1GSFA 2XO2A 5ECSA 1V2AA 3WD6A 1YQ1A 17GSA 2HYVA 2OACA 4JXHA 3QAWA 1MD4A 1RE0B 3Q19A 4YQMA 1M9AA 1GSDA 2AHEA 4ZB7A 5JCUA 1BC0A 2FNOA 3PPUA 3MAKA 3D0ZA 3FRCA 2HRAA 3LG6A 1PL1A 1ANWA 3H1NA 4GSSA 1GLQA 3AO0A 4Q5NA 1N2AA 3CHXC 5KEJA 3FR9A 3VPTA 5BMUA 1N42A 1PD21 2IE7A 2GTUA 3GUSA 1W45A 3ERGA 6GSUA 1HVGA 1BX9A 14GSA 4HREA 4BVYB 1DK5A 4PNFA 3O76A 1BC9A 5A34B 4G0LA 4BVXA 1BO9A 5ECLB 4KE3A 1BG5A 4E8EA 4E8HA 2VCTA 1BC1A 1BAYA 3N9JA 1R8SE 1LBKA 4IGJA 2EFCA 3ABOA 3TOUA 2HYUA 1G6YA 4LMVA 5J4VA 4NAXA 4AKHA 4OFMA 4BL7A 3LYKA 2A2SA 1KBNA 5HFKA 5J47A 1M9IA 4PI0C 3ABQA 1S9DE 3UAPA 3USWA 4KDYA 3Q18A 3DGQA 1AVHA 2IMIA 3GURA 2CAQA 4PTSA 4MDCA 4HOJA 4GDFA 3UBKA 1YJ6A 4EDZA 1PL2A 5ECIB 2LJRA 3KMNA 5F05A 1VF2A 4EVFA 5DDLA 1R5AA 2R0DA 2DC5A 4MDVA 2VCZA 5B7CA 2GSTA 5DCGA 1BG1A 3CRUA 1JZRA 2C8UA 3TGZA 4YQVA 1QC7A 2CZ3A 3LXTA 2CA8A 1GUMA 2VCVA 1HQOA 3AY8A 4YH2A 5F0GA 4W66A 1YY7A 3KXOA 2VD0A 4WR4A
chains in the Genus database with same CATH topology
1PGTA 1U88A 3HMJG 1K0NA 3KJYA 2PBJA 1GTAA 1SVOA 4AGSA 5DJMA 4KAEA 4WR5A 5J4UA 1VF3A 2YCDA 3C8EA 3P8WA 2HSMA 2HRKB 1PKWA 3QR6A 4KMUX 4Q5RA 7GSSA 2CZ2A 1FW1A 19GSA 5DJLA 2NTOA 4ZB9A 3Q74A 5A4VA 3EE2A 2OT3A 2HSNB 4GTUA 4KSMA 4ZXGA 1PN9A 1PX6A 3GTUA 4OMVA 2C3TA 4JBBA 5LD0A 4RI7A 4JMIA 2PVQA 2R5GA 1K3YA 3LFLA 4J2FA 2WB9A 1B8XA 4L5OA 4ECBA 4IBPA 3LTLA 6GSXA 3RBTA 2C3QA 2O5VA 3UVHA 5D9XA 4N3ZA 1SVLA 4PUAA 13GSA 4PQHA 5D9WA 16GSA 4I97A 4ACSA 2OADA 5AIXA 5F07A 4ZBBA 1PX7A 6GSSA 4PQIA 3KMOA 3HJMA 1K3LA 5AISA 2D2ZA 4NHZA 5AIVA 5AN1A 4EDYA 3IBHA 2PGTA 2EFEA 1B4PA 4ZB8A 3HKRA 2VCWA 2OA7A 1PA3A 4FQUA 4F0BA 1TU7A 4JK1X 3FR6A 4QMKA 1Z9HA 4EE0A 2C80A 3GH6A 3TU3B 4MF5A 1AQVA 5EVOA 2UV8G 4E68A 5FT3A 1C72A 3VI5A 4IQ1A 3KM6A 4NHWA 1V40A 3UBLA 1ML6A 2ON5A 4PX1A 4HZ4A 3IC8A 3R3EA 2R4VA 2WJUA 2N5FA 2VCQA 4IW9A 1USBA 8GSSA 4D7QA 5DAKB 4AI6A 1LJRA 2AAWA 2J9HA 1GTUA 5AGYA 3VLNA 4BVYA 4ECIA 1UA5A 3U6VA 4FHRB 1TU8A 4ZB6A 5A34A 3VK9A 9GSSA 5ECQB 3QAVA 4JWLA 3PGTA 1XSZA 5IQYA 4OIYA 5EY6A 2WDUA 1GSUA 2PERA 2PMTA 12GSA 1PKZA 1U87A 4IKHA 5A5HB 6GSWA 1K3OA 2A2RA 5D73A 1F3AA 4L8EA 4L5MA 5J5NA 1G6WA 3KTLA 1F3BA 4KH7A 4G0IA 1TXUA 1EV9A 4GCIA 4F0CA 4AKIA 1EEMA 2EFHA 3BBYA 3FY7A 2R6KA 3VPQA 2VO4A 1MTCA 3G7IA 1HNCA 2C3NA 1K0OA 4RI6A 4KDUA 4GLTA 3LXZA 3F63A 4KDXA 4JEDA 5ECKB 3L0HA 3IE3A 3VI7A 1ZGNA 5J4YA 5J41A 2F8FA 4IVFA 5DALA 3CBUA 2GDRA 3HJOA 3MDKA 1TDIA 3GSSA 4MF6A 5DQSA 2IMKA 3SWLA 2WRTA 1LKVX 3GX0A 4AKGA 3ZFLA 1EOHA 1YKCA 1GUKA 3G7JA 1GSYA 3EINA 6GSYA 4YQUA 4C7PA 5A4UA 4F03A 1N25A 5GZZB 1VF1A 4MPFA 1BYEA 2HRKA 4ZBAA 1AXDA 1R8QE 1JLWA 5A1NB 2VCXA 4ZBDA 1K0BA 4MK3A 1F2EA 1BF5A 3IK9A 3L8NA 3VURA 3I69A 5D9VA 2HSNA 4KGIA 3QAGA 2F3MA 1GUHA 1M9BA 4Z21A 5F8BA 1JLVA 22GSA 2YV9A 4D7RA 2ON7A 5ELGA 4O92A 1IYIA 5ELAA 4PNGA 4ID0A 4IS0A 1GNWA 5FWGA 1GSEA 4KN4X 3NIVA 4GF0A 4N0VA 5BMUB 1YVLA 1IYHA 3P90A 3M0FA 3F6DA 4USSA 3TW5A 1FHEA 4QQ7A 4JZQA 4KN7X 1OE8A 3WYWA 5G5FA 1HNAA 1U3IA 4BVXB 1Q8DA 5A4WA 2V6KA 2HNLA 3UARA 10GSA 2X64A 4HI7A 5EL8A 3ZMLA 4YAPA 4MF7A 5ECNB 5A5KA 4GSTA 2VD1A 1XW5A 4IELA 5ECOB 1GULA 5GSSA 2CVDA 1GTIA 3O3TA 5G5EA 1GNEA 4TOPA 4DEJA 3ERFA 1AQXA 5LCZA 2HQTA 5GSTA 4BL7B 3IK7A 1Y1UA 4K0GA 4Q5FA 3M8NA 11GSA 5FHIA 3N5OA 1R8ME 2FHEA 1XW6A 3USYA 1NHYA 5ECHB 4PGTA 4OFNA 1GWCA 3PR8A 3CSHA 3F6FA 3ISOA 3AJCA 2EFDA 1OE7A 3CWGA 4ISDA 1EV4A 1K0DA 3SOHB 2WS2A 3LSZA 4K0NA 2GLRA 5DAKA 5ECMB 1MD3A 4O7HA 4Q5QA 6GSTA 1EOGA 1M99A 1GLPA 1XT0B 3ZFBA 1K0CA 4AKXB 20GSA 2GSSA 5ECPB 4CHSA 2CAIA 4HZ2A 3FYGA 1YDKA 4OFTA 5D9TA 1XWKA 4JMOA 3W8SA 3ZMKA 1TW9A 1XWGA 4G01A 4MZWA 1PBVA 2VKZG 2HSMB 1G7OA 2H1LA 5A5HA 1DUGA 3LJRA 4EC0A 1VF4A 5DALB 5J40A 1PMTA 2AB6A 3TOTA 4L5LA 2R09A 4GSNA 3I6AA 2UZ8A 4ECCA 3R2QA 2IL3A 4G0KA 4MPGA 5JCWA 3FR3A 3IR4A 2C4JA 4KX4A 1SVMA 1HNBA 18GSA 5F06A 3SWVA 2R3XA 4A4PA 4KF9A 2DSAA 4G19A 3GTUB 1ZL9A 3LYPA 1B48A 1KU1A 3GSTA 4IJIA 1K0AA 3M3MA 3VWXA 2GSQA 5ECRB 4MP4A 4PXOA 1Q4JA 4HJ2A 1GSQA 2YV7A 1M0UA 1GSSA 1AW9A 3DD3A 1GTBA 4C0AA 1RK4A 3M1GA 3CRTA 3CSIA 2K6XA 1Y6EA 1AQWA 4LMWA 4FQ0C 1A0FA 2JL4A 2GSRA 4IQAA 4G9HA 3HJLA 1E6BA 3CSJA 1OYJA 4YAVA 4G10A 1OKTA 4ECJA 4PURA 3LQ7A 4EXJA 5A1NA 6GSVA 1K0MA 1GSFA 5ECSA 1V2AA 3WD6A 1YQ1A 17GSA 2OACA 4JXHA 3QAWA 1MD4A 1RE0B 3Q19A 4YQMA 1M9AA 1GSDA 2AHEA 4ZB7A 5JCUA 2FNOA 3PPUA 3MAKA 3D0ZA 3FRCA 2HRAA 3LG6A 1PL1A 3H1NA 4GSSA 1GLQA 4Q5NA 1N2AA 5KEJA 3FR9A 3VPTA 5BMUA 1PD21 2GTUA 3GUSA 3ERGA 6GSUA 1BX9A 14GSA 4BVYB 4PNFA 3O76A 1BC9A 5A34B 4G0LA 4BVXA 5ECLB 4KE3A 1BG5A 4E8EA 4E8HA 2VCTA 1BAYA 3N9JA 1R8SE 1LBKA 4IGJA 2EFCA 3TOUA 1G6YA 4LMVA 5J4VA 4NAXA 4AKHA 4OFMA 4BL7A 3LYKA 2A2SA 1KBNA 5HFKA 5J47A 1S9DE 3UAPA 3USWA 4KDYA 3Q18A 3DGQA 2IMIA 3GURA 2CAQA 4PTSA 4MDCA 4HOJA 4GDFA 3UBKA 1YJ6A 4EDZA 1PL2A 5ECIB 2LJRA 3KMNA 5F05A 1VF2A 5DDLA 1R5AA 2R0DA 2DC5A 2VCZA 5B7CA 2GSTA 5DCGA 1BG1A 3CRUA 1JZRA 2C8UA 3TGZA 4YQVA 1QC7A 2CZ3A 3LXTA 2CA8A 1GUMA 3AY8A 1HQOA 2VCVA 4YH2A 5F0GA 4W66A 1YY7A 3KXOA 2VD0A 4WR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSN A; 
#chains in the Genus database with same CATH topology
 1YCN A;  1PGT A;  1U88 A;  3HMJ G;  1K0N A;  2WVY A;  1ANN A;  3KJY A;  2PBJ A;  1GTA A;  1SVO A;  4AGS A;  5DJM A;  4KAE A;  1XJL A;  2HYW A;  4WR5 A;  5J4U A;  1VF3 A;  2YCD A;  3C8E A;  3P8W A;  2HSM A;  2WW3 A;  2HRK B;  1HM6 A;  1PKW A;  3QR6 A;  4KMU X;  4Q5R A;  7GSS A;  2CZ2 A;  1FW1 A;  19GS A;  5DJL A;  2NTO A;  4ZB9 A;  3Q74 A;  5A4V A;  3EE2 A;  2OT3 A;  2HSN B;  4GTU A;  4KSM A;  4ZXG A;  1PN9 A;  1PX6 A;  4PI2 C;  3GTU A;  4OMV A;  2C3T A;  4JBB A;  5LD0 A;  4RI7 A;  4JMI A;  2PVQ A;  2R5G A;  2OY9 A;  1K3Y A;  3LFL A;  4J2F A;  2WB9 A;  1B8X A;  4L5O A;  4ECB A;  4IBP A;  3LTL A;  6GSX A;  3RBT A;  2C3Q A;  2O5V A;  3UVH A;  5D9X A;  1SAV A;  4N3Z A;  1SVL A;  4PUA A;  13GS A;  4PQH A;  5D9W A;  16GS A;  4I97 A;  4ACS A;  1UPT B;  2OAD A;  5AIX A;  5F07 A;  4ZBB A;  1PX7 A;  6GSS A;  4PQI A;  3KMO A;  3HJM A;  1K3L A;  5AIS A;  2D2Z A;  4NHZ A;  5AIV A;  5AN1 A;  4EDY A;  1I4A A;  3IBH A;  2PGT A;  2ZHI A;  2EFE A;  2IE6 A;  1B4P A;  4ZB8 A;  3HKR A;  2VCW A;  2OA7 A;  1PA3 A;  4FQU A;  4F0B A;  1TU7 A;  4JK1 X;  3FR6 A;  4QMK A;  1Z9H A;  1N41 A;  4EE0 A;  2C80 A;  3GH6 A;  3TU3 B;  4MF5 A;  1HVF A;  1YII A;  1AQV A;  5EVO A;  4EVH A;  2IIC A;  2UV8 G;  4E68 A;  5FT3 A;  1C72 A;  2WVX B;  3VI5 A;  4IQ1 A;  3KM6 A;  4NHW A;  1V40 A;  3UBL A;  1ML6 A;  2ON5 A;  4PX1 A;  4HZ4 A;  3BRX A;  3IC8 A;  3R3E A;  2R4V A;  1A8A A;  2WJU A;  2N5F A;  2VCQ A;  4IW9 A;  1USB A;  2H0M A;  8GSS A;  4D7Q A;  5DAK B;  4AI6 A;  1LJR A;  2AAW A;  2J9H A;  1GTU A;  5AGY A;  3VLN A;  4BVY A;  4ECI A;  1UA5 A;  3U6V A;  4FHR B;  1TU8 A;  4ZB6 A;  2O3E A;  5A34 A;  3VK9 A;  9GSS A;  5ECQ B;  3QAV A;  3ABS A;  1I1I P;  4JWL A;  3PGT A;  1XSZ A;  5IQY A;  4OIY A;  5EY6 A;  2WDU A;  1GSU A;  2PER A;  2PMT A;  12GS A;  1PKZ A;  1U87 A;  4IKH A;  5A5H B;  6GSW A;  1K3O A;  2A2R A;  5D73 A;  1F3A A;  4L8E A;  4L5M A;  5J5N A;  1G6W A;  3KTL A;  2O36 A;  3RGB C;  1F3B A;  4KH7 A;  1HVE A;  4G0I A;  1TXU A;  1EV9 A;  4GCI A;  4F0C A;  4AKI A;  1EEM A;  2EFH A;  3BBY A;  3FY7 A;  2R6K A;  3VPQ A;  2VO4 A;  1G5N A;  1MTC A;  1S4B P;  1HNC A;  3G7I A;  2C3N A;  1K0O A;  4RI6 A;  4KDU A;  4GLT A;  3LXZ A;  3F63 A;  4KDX A;  4JED A;  2H0L A;  5ECK B;  3L0H A;  3IE3 A;  3VI7 A;  1ZGN A;  5J4Y A;  5J41 A;  2F8F A;  4IVF A;  5DAL A;  3CBU A;  1R4A E;  2GDR A;  3HJO A;  3MDK A;  1TDI A;  3GSS A;  4MF6 A;  5DQS A;  2IMK A;  3SWL A;  2WRT A;  4MDU A;  1LKV X;  3GX0 A;  4AKG A;  3ZFL A;  1EOH A;  1YKC A;  1GUK A;  3G7J A;  1GSY A;  3EIN A;  6GSY A;  4YQU A;  4C7P A;  5A4U A;  1BC3 A;  1HVD A;  4F03 A;  1N25 A;  5GZZ B;  1VF1 A;  4MPF A;  1BYE A;  1BCW A;  2HRK A;  4ZBA A;  1AXD A;  1R8Q E;  1JLW A;  1BCZ A;  5A1N B;  2VCX A;  4ZBD A;  3RFR C;  1K0B A;  4MK3 A;  1F2E A;  2XO3 A;  1BF5 A;  3IK9 A;  3L8N A;  3VUR A;  1BCY A;  3I69 A;  4FXY P;  2WW0 A;  5D9V A;  2HSN A;  4KGI A;  3QAG A;  2QEZ A;  2F3M A;  1GUH A;  1M9B A;  4Z21 A;  5F8B A;  1JLV A;  22GS A;  2YV9 A;  4D7R A;  2ON7 A;  5ELG A;  4O92 A;  1IYI A;  5ELA A;  4PNG A;  4ID0 A;  4IS0 A;  1GNW A;  5FWG A;  1GSE A;  4KN4 X;  2WW2 A;  3NIV A;  4GF0 A;  4N0V A;  5BMU B;  1YVL A;  1IYH A;  3P90 A;  3M0F A;  2II2 A;  3F6D A;  4USS A;  1YGM A;  3TW5 A;  1FHE A;  4QQ7 A;  4JZQ A;  4KN7 X;  1OE8 A;  3WYW A;  2Q4C A;  5G5F A;  4Q2S A;  1HNA A;  1U3I A;  4BVX B;  1Q8D A;  5A4W A;  2V6K A;  2HNL A;  3UAR A;  10GS A;  1DM5 A;  2X64 A;  4HI7 A;  5EL8 A;  3ZML A;  4YAP A;  4MF7 A;  5ECN B;  5A5K A;  4GST A;  2VD1 A;  1XW5 A;  4IEL A;  4X9P A;  5ECO B;  1GUL A;  1YJ0 A;  2CVD A;  1HAK A;  1GTI A;  3O3T A;  5G5E A;  5GSS A;  1GNE A;  4TOP A;  4DEJ A;  3ERF A;  1AQX A;  5LCZ A;  2HQT A;  5GST A;  4BL7 B;  3IK7 A;  1Y1U A;  4K0G A;  4Q5F A;  3M8N A;  11GS A;  5FHI A;  3N5O A;  1R8M E;  2FHE A;  1XW6 A;  3USY A;  1NHY A;  5ECH B;  4PGT A;  4OFN A;  2WVX A;  1GWC A;  3PR8 A;  3CSH A;  1AII A;  3F6F A;  3ISO A;  3AJC A;  2EFD A;  3ABR A;  1OE7 A;  3CWG A;  4ISD A;  1EV4 A;  1K0D A;  3SOH B;  2WS2 A;  3LSZ A;  4K0N A;  1AEI A;  2GLR A;  5DAK A;  1MD3 A;  5ECM B;  4O7H A;  1AVR A;  4Q5Q A;  6GST A;  1EOG A;  1M99 A;  1GLP A;  1XT0 B;  3ZFB A;  1K0C A;  1W7B A;  4PHZ C;  4AKX B;  20GS A;  2GSS A;  5ECP B;  4CHS A;  2CAI A;  4HZ2 A;  3FYG A;  1YDK A;  4OFT A;  5D9T A;  1XWK A;  4JMO A;  3W8S A;  3ZMK A;  1TW9 A;  1XWG A;  4G01 A;  4MZW A;  1PBV A;  2ZOC A;  2HSM B;  2VKZ G;  1G7O A;  1W3W A;  2H1L A;  5A5H A;  1DUG A;  3LJR A;  4EC0 A;  1VF4 A;  5DAL B;  5J40 A;  1PMT A;  2AB6 A;  3TOT A;  4L5L A;  2R09 A;  4GSN A;  3I6A A;  2UZ8 A;  4ECC A;  3R2Q A;  2IL3 A;  4G0K A;  4MPG A;  5JCW A;  1MCX A;  3FR3 A;  3IR4 A;  1AXN A;  2C4J A;  4KX4 A;  2WZS A;  1SVM A;  1HNB A;  2WW1 A;  18GS A;  5F06 A;  2ZHJ A;  3SWV A;  2R3X A;  4A4P A;  4KF9 A;  2DSA A;  4G19 A;  3GTU B;  1ZL9 A;  3LYP A;  1B48 A;  1KU1 A;  3GST A;  1YEW C;  2WVZ A;  4IJI A;  1AOW A;  1N44 A;  2VXG A;  1K0A A;  1A8B A;  3M3M A;  3VWX A;  3ANY A;  2GSQ A;  5ECR B;  4MP4 A;  4PXO A;  1Q4J A;  1AVC A;  4HJ2 A;  1GSQ A;  2YV7 A;  1M0U A;  1GSS A;  1AW9 A;  3DD3 A;  1GTB A;  4C0A A;  1RK4 A;  3M1G A;  3CRT A;  2H0K A;  3CSI A;  2K6X A;  1Y6E A;  1AQW A;  4LMW A;  4FQ0 C;  1A0F A;  2JL4 A;  2GSR A;  4IQA A;  4G9H A;  3HJL A;  1E6B A;  3CSJ A;  1C1K A;  1OYJ A;  1ALA A;  4YAV A;  4G10 A;  1N00 A;  1ANX A;  1OKT A;  4ECJ A;  2RAN A;  4PUR A;  3LQ7 A;  4EXJ A;  5A1N A;  6GSV A;  1K0M A;  1GSF A;  2XO2 A;  5ECS A;  1V2A A;  3WD6 A;  1YQ1 A;  17GS A;  2HYV A;  2OAC A;  4JXH A;  3QAW A;  1MD4 A;  1RE0 B;  3Q19 A;  4YQM A;  1M9A A;  1GSD A;  2AHE A;  4ZB7 A;  5JCU A;  1BC0 A;  2FNO A;  3PPU A;  3MAK A;  3D0Z A;  3FRC A;  2HRA A;  3LG6 A;  1PL1 A;  1ANW A;  3H1N A;  4GSS A;  1GLQ A;  3AO0 A;  4Q5N A;  1N2A A;  3CHX C;  5KEJ A;  3FR9 A;  3VPT A;  5BMU A;  1N42 A;  1PD2 1;  2IE7 A;  2GTU A;  3GUS A;  1W45 A;  3ERG A;  6GSU A;  1HVG A;  1BX9 A;  14GS A;  4HRE A;  4BVY B;  1DK5 A;  4PNF A;  3O76 A;  1BC9 A;  5A34 B;  4G0L A;  4BVX A;  1BO9 A;  5ECL B;  4KE3 A;  1BG5 A;  4E8E A;  4E8H A;  2VCT A;  1BC1 A;  1BAY A;  3N9J A;  1R8S E;  1LBK A;  4IGJ A;  2EFC A;  3ABO A;  3TOU A;  2HYU A;  1G6Y A;  4LMV A;  5J4V A;  4NAX A;  4AKH A;  4OFM A;  4BL7 A;  3LYK A;  2A2S A;  1KBN A;  5HFK A;  5J47 A;  1M9I A;  4PI0 C;  3ABQ A;  1S9D E;  3UAP A;  3USW A;  4KDY A;  3Q18 A;  3DGQ A;  1AVH A;  2IMI A;  3GUR A;  2CAQ A;  4PTS A;  4MDC A;  4HOJ A;  4GDF A;  3UBK A;  1YJ6 A;  4EDZ A;  1PL2 A;  5ECI B;  2LJR A;  3KMN A;  5F05 A;  1VF2 A;  4EVF A;  5DDL A;  1R5A A;  2R0D A;  2DC5 A;  4MDV A;  2VCZ A;  5B7C A;  2GST A;  5DCG A;  1BG1 A;  3CRU A;  1JZR A;  2C8U A;  3TGZ A;  4YQV A;  1QC7 A;  2CZ3 A;  3LXT A;  2CA8 A;  1GUM A;  2VCV A;  1HQO A;  3AY8 A;  4YH2 A;  5F0G A;  4W66 A;  1YY7 A;  3KXO A;  2VD0 A;  4WR4 A; 
#chains in the Genus database with same CATH homology
 1PGT A;  1U88 A;  3HMJ G;  1K0N A;  3KJY A;  2PBJ A;  1GTA A;  1SVO A;  4AGS A;  5DJM A;  4KAE A;  4WR5 A;  5J4U A;  1VF3 A;  2YCD A;  3C8E A;  3P8W A;  2HSM A;  2HRK B;  1PKW A;  3QR6 A;  4KMU X;  4Q5R A;  7GSS A;  2CZ2 A;  1FW1 A;  19GS A;  5DJL A;  2NTO A;  4ZB9 A;  3Q74 A;  5A4V A;  3EE2 A;  2OT3 A;  2HSN B;  4GTU A;  4KSM A;  4ZXG A;  1PN9 A;  1PX6 A;  3GTU A;  4OMV A;  2C3T A;  4JBB A;  5LD0 A;  4RI7 A;  4JMI A;  2PVQ A;  2R5G A;  1K3Y A;  3LFL A;  4J2F A;  2WB9 A;  1B8X A;  4L5O A;  4ECB A;  4IBP A;  3LTL A;  6GSX A;  3RBT A;  2C3Q A;  2O5V A;  3UVH A;  5D9X A;  4N3Z A;  1SVL A;  4PUA A;  13GS A;  4PQH A;  5D9W A;  16GS A;  4I97 A;  4ACS A;  2OAD A;  5AIX A;  5F07 A;  4ZBB A;  1PX7 A;  6GSS A;  4PQI A;  3KMO A;  3HJM A;  1K3L A;  5AIS A;  2D2Z A;  4NHZ A;  5AIV A;  5AN1 A;  4EDY A;  3IBH A;  2PGT A;  2EFE A;  1B4P A;  4ZB8 A;  3HKR A;  2VCW A;  2OA7 A;  1PA3 A;  4FQU A;  4F0B A;  1TU7 A;  4JK1 X;  3FR6 A;  4QMK A;  1Z9H A;  4EE0 A;  2C80 A;  3GH6 A;  3TU3 B;  4MF5 A;  1AQV A;  5EVO A;  2UV8 G;  4E68 A;  5FT3 A;  1C72 A;  3VI5 A;  4IQ1 A;  3KM6 A;  4NHW A;  1V40 A;  3UBL A;  1ML6 A;  2ON5 A;  4PX1 A;  4HZ4 A;  3IC8 A;  3R3E A;  2R4V A;  2WJU A;  2N5F A;  2VCQ A;  4IW9 A;  1USB A;  8GSS A;  4D7Q A;  5DAK B;  4AI6 A;  1LJR A;  2AAW A;  2J9H A;  1GTU A;  5AGY A;  3VLN A;  4BVY A;  4ECI A;  1UA5 A;  3U6V A;  4FHR B;  1TU8 A;  4ZB6 A;  5A34 A;  3VK9 A;  9GSS A;  5ECQ B;  3QAV A;  4JWL A;  3PGT A;  1XSZ A;  5IQY A;  4OIY A;  5EY6 A;  2WDU A;  1GSU A;  2PER A;  2PMT A;  12GS A;  1PKZ A;  1U87 A;  4IKH A;  5A5H B;  6GSW A;  1K3O A;  2A2R A;  5D73 A;  1F3A A;  4L8E A;  4L5M A;  5J5N A;  1G6W A;  3KTL A;  1F3B A;  4KH7 A;  4G0I A;  1TXU A;  1EV9 A;  4GCI A;  4F0C A;  4AKI A;  1EEM A;  2EFH A;  3BBY A;  3FY7 A;  2R6K A;  3VPQ A;  2VO4 A;  1MTC A;  3G7I A;  1HNC A;  2C3N A;  1K0O A;  4RI6 A;  4KDU A;  4GLT A;  3LXZ A;  3F63 A;  4KDX A;  4JED A;  5ECK B;  3L0H A;  3IE3 A;  3VI7 A;  1ZGN A;  5J4Y A;  5J41 A;  2F8F A;  4IVF A;  5DAL A;  3CBU A;  2GDR A;  3HJO A;  3MDK A;  1TDI A;  3GSS A;  4MF6 A;  5DQS A;  2IMK A;  3SWL A;  2WRT A;  1LKV X;  3GX0 A;  4AKG A;  3ZFL A;  1EOH A;  1YKC A;  1GUK A;  3G7J A;  1GSY A;  3EIN A;  6GSY A;  4YQU A;  4C7P A;  5A4U A;  4F03 A;  1N25 A;  5GZZ B;  1VF1 A;  4MPF A;  1BYE A;  2HRK A;  4ZBA A;  1AXD A;  1R8Q E;  1JLW A;  5A1N B;  2VCX A;  4ZBD A;  1K0B A;  4MK3 A;  1F2E A;  1BF5 A;  3IK9 A;  3L8N A;  3VUR A;  3I69 A;  5D9V A;  2HSN A;  4KGI A;  3QAG A;  2F3M A;  1GUH A;  1M9B A;  4Z21 A;  5F8B A;  1JLV A;  22GS A;  2YV9 A;  4D7R A;  2ON7 A;  5ELG A;  4O92 A;  1IYI A;  5ELA A;  4PNG A;  4ID0 A;  4IS0 A;  1GNW A;  5FWG A;  1GSE A;  4KN4 X;  3NIV A;  4GF0 A;  4N0V A;  5BMU B;  1YVL A;  1IYH A;  3P90 A;  3M0F A;  3F6D A;  4USS A;  3TW5 A;  1FHE A;  4QQ7 A;  4JZQ A;  4KN7 X;  1OE8 A;  3WYW A;  5G5F A;  1HNA A;  1U3I A;  4BVX B;  1Q8D A;  5A4W A;  2V6K A;  2HNL A;  3UAR A;  10GS A;  2X64 A;  4HI7 A;  5EL8 A;  3ZML A;  4YAP A;  4MF7 A;  5ECN B;  5A5K A;  4GST A;  2VD1 A;  1XW5 A;  4IEL A;  5ECO B;  1GUL A;  5GSS A;  2CVD A;  1GTI A;  3O3T A;  5G5E A;  1GNE A;  4TOP A;  4DEJ A;  3ERF A;  1AQX A;  5LCZ A;  2HQT A;  5GST A;  4BL7 B;  3IK7 A;  1Y1U A;  4K0G A;  4Q5F A;  3M8N A;  11GS A;  5FHI A;  3N5O A;  1R8M E;  2FHE A;  1XW6 A;  3USY A;  1NHY A;  5ECH B;  4PGT A;  4OFN A;  1GWC A;  3PR8 A;  3CSH A;  3F6F A;  3ISO A;  3AJC A;  2EFD A;  1OE7 A;  3CWG A;  4ISD A;  1EV4 A;  1K0D A;  3SOH B;  2WS2 A;  3LSZ A;  4K0N A;  2GLR A;  5DAK A;  5ECM B;  1MD3 A;  4O7H A;  4Q5Q A;  6GST A;  1EOG A;  1M99 A;  1GLP A;  1XT0 B;  3ZFB A;  1K0C A;  4AKX B;  20GS A;  2GSS A;  5ECP B;  4CHS A;  2CAI A;  4HZ2 A;  3FYG A;  1YDK A;  4OFT A;  5D9T A;  1XWK A;  4JMO A;  3W8S A;  3ZMK A;  1TW9 A;  1XWG A;  4G01 A;  4MZW A;  1PBV A;  2VKZ G;  2HSM B;  1G7O A;  2H1L A;  5A5H A;  1DUG A;  3LJR A;  4EC0 A;  1VF4 A;  5DAL B;  5J40 A;  1PMT A;  2AB6 A;  3TOT A;  4L5L A;  2R09 A;  4GSN A;  3I6A A;  2UZ8 A;  4ECC A;  3R2Q A;  2IL3 A;  4G0K A;  4MPG A;  5JCW A;  3FR3 A;  3IR4 A;  2C4J A;  4KX4 A;  1SVM A;  1HNB A;  18GS A;  5F06 A;  3SWV A;  2R3X A;  4A4P A;  4KF9 A;  2DSA A;  4G19 A;  3GTU B;  1ZL9 A;  3LYP A;  1B48 A;  1KU1 A;  3GST A;  4IJI A;  1K0A A;  3M3M A;  3VWX A;  2GSQ A;  5ECR B;  4MP4 A;  4PXO A;  1Q4J A;  4HJ2 A;  1GSQ A;  2YV7 A;  1M0U A;  1GSS A;  1AW9 A;  3DD3 A;  1GTB A;  4C0A A;  1RK4 A;  3M1G A;  3CRT A;  3CSI A;  2K6X A;  1Y6E A;  1AQW A;  4LMW A;  4FQ0 C;  1A0F A;  2JL4 A;  2GSR A;  4IQA A;  4G9H A;  3HJL A;  1E6B A;  3CSJ A;  1OYJ A;  4YAV A;  4G10 A;  1OKT A;  4ECJ A;  4PUR A;  3LQ7 A;  4EXJ A;  5A1N A;  6GSV A;  1K0M A;  1GSF A;  5ECS A;  1V2A A;  3WD6 A;  1YQ1 A;  17GS A;  2OAC A;  4JXH A;  3QAW A;  1MD4 A;  1RE0 B;  3Q19 A;  4YQM A;  1M9A A;  1GSD A;  2AHE A;  4ZB7 A;  5JCU A;  2FNO A;  3PPU A;  3MAK A;  3D0Z A;  3FRC A;  2HRA A;  3LG6 A;  1PL1 A;  3H1N A;  4GSS A;  1GLQ A;  4Q5N A;  1N2A A;  5KEJ A;  3FR9 A;  3VPT A;  5BMU A;  1PD2 1;  2GTU A;  3GUS A;  3ERG A;  6GSU A;  1BX9 A;  14GS A;  4BVY B;  4PNF A;  3O76 A;  1BC9 A;  5A34 B;  4G0L A;  4BVX A;  5ECL B;  4KE3 A;  1BG5 A;  4E8E A;  4E8H A;  2VCT A;  1BAY A;  3N9J A;  1R8S E;  1LBK A;  4IGJ A;  2EFC A;  3TOU A;  1G6Y A;  4LMV A;  5J4V A;  4NAX A;  4AKH A;  4OFM A;  4BL7 A;  3LYK A;  2A2S A;  1KBN A;  5HFK A;  5J47 A;  1S9D E;  3UAP A;  3USW A;  4KDY A;  3Q18 A;  3DGQ A;  2IMI A;  3GUR A;  2CAQ A;  4PTS A;  4MDC A;  4HOJ A;  4GDF A;  3UBK A;  1YJ6 A;  4EDZ A;  1PL2 A;  5ECI B;  2LJR A;  3KMN A;  5F05 A;  1VF2 A;  5DDL A;  1R5A A;  2R0D A;  2DC5 A;  2VCZ A;  5B7C A;  2GST A;  5DCG A;  1BG1 A;  3CRU A;  1JZR A;  2C8U A;  3TGZ A;  4YQV A;  1QC7 A;  2CZ3 A;  3LXT A;  2CA8 A;  1GUM A;  3AY8 A;  1HQO A;  2VCV A;  4YH2 A;  5F0G A;  4W66 A;  1YY7 A;  3KXO A;  2VD0 A;  4WR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...