2R0DA

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Cytohesin-3
total genus 114
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r0dA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r0dA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r0dA03
3WA0A 2J0MA 5J3YA 1B55A 2QKMA 4MK0A 3HQCA 2IFSA 5D3VA 2R0DA 2GCJA 3IVFA 3AU5A 3PG7A 4ZRJA 1UPRA 4CHJA 4A4PA 2EJ8A 2RNRB 4Z2NA 4ZRKA 5JHHA 3DXEA 4B6HA 1MIZB 4HB0B 4OIYA 3PSCA 4EJNA 1DDVA 1V88A 5C16A 1FGZA 5CLQB 2VKIA 2DHKA 1WGQA 1X05A 1U5FA 3N7CA 3PEGA 4TKNA 1V5PA 2ADZA 5KQ4A 2DKQA 2DN6A 4A6FB 2P0HA 1NI2A 5LONB 2FJLA 2NMBA 2RUKB 2HE7A 2MDXA 5DHAB 5JHGA 4HAYB 3F0WA 4JWLA 2HTHB 2DLWA 3PVWA 1K5DB 1DROA 4KHAA 3D8DA 2M14A 1U27A 2OQBA 5FI1A 1R8QE 2IYBA 5L81A 4XWXA 2RGNB 2MKRA 2COFA 4WSFA 3OANA 1WJ1A 2M38A 2YS1A 5GOWB 2Z0QA 1FOEA 1KZ7A 4JXHA 2I1JA 2G35A 3TO1A 3D8FA 3HK0A 2ROVA 2ROZB 3GYPA 5CLLB 5DH9B 2D9YA 2XQNM 2W2XC 3T06A 4C7PA 4ZRIA 3L8NA 2YT0A 1V61A 1P3RA 2DA0A 1XX0A 2D10A 4JMOA 5JP4A 3AJ4A 5D27A 3ODXA 1BWNA 3X23A 4HB4B 2ELBA 1U5DA 1AWEA 1XD4A 1DDWA 1OQNA 1WI1A 1FHXA 2L2IA 2Y8GA 3ULCA 5FI0A 5KCVA 3G9WA 2LOZA 1ISNA 1FB8A 2X18A 2Y8FA 1X86A 3TVVA 3DXCA 2K2JA 2ZPYA 3ML4A 1NTVA 3KRXA 2CY5A 4KAXB 1NU2A 3SNHA 2L1CA 4Z2MB 2YS5A 1DBHA 2AEHA 4A6HA 3VIAA 4F7HA 1IRSA 3DXDA 1KZGA 2D11A 1U2BA 4Y94A 1FHWA 2KGXB 3A8QA 1RE0B 2P8VA 1WJMA 2GS0A 2LOXA 3ODWA 2DKPA 3V5WA 2E2XA 1GG3A 3TCAA 4PNKA 2YS3A 4KHBB 1M7EA 4C0AA 3QIJA 5C79A 2LULA 1Q67A 3HW2B 2W2WA 3KSYA 1WG7A 4A5KA 4IAPA 3CIKA 3BJIA 1R8SE 1N3HA 1MIXA 5HE3A 1BTNA 2COAA 2YSZA 1MKEA 1V89A 1XODA 1Y19B 4HAZB 1XT0B 1RJ2A 4L5MA 2H7DA 5J3QA 3U8ZA 3F5RA 4H8SA 1ZVRA 4HATB 3LJUX 5KQ1A 2P0FA 2N0YA 1U5EA 2CRFA 1X11A 1X1GA 1BAKA 1DDMA 4HB3B 1ZC4B 5DI9B 1UPQA 4DXAB 1XSZA 4KHOA 1H10A 5JLJB 5C6RA 4GZUA 2ELAA 5HE0A 3P7ZA 2YT1A 4GN1A 3KY9A 3ZDTA 4HAWB 2YF0A 2D4QA 2DTCA 4JMIA 1WVHA 3ODOA 3KZ1A 5J3TA 5D3WA 2H7EA 4GXBA 4GMVA 2DHJA 1RRPB 3O96A 4D7QA 1BC9A 1W1HA 3M1IB 4P7IA 1PBVA 3QWMA 4HB2B 2EMTA 3VOQA 1XKEA 5HE2A 2Z0OA 2QKLA 2R09A 2EMSA 2Y7BA 2CY4A 1Y5OA 1Z87A 4K2OA 1XR0B 3SUZA 2PZ1A 3MPXA 4WVFB 1PFJA 1FAOA 2D9WA 1TJ6A 1J19A 1U29A 2COCA 2I5FA 1GC7A 3NSUA 3SYXA 4HAXB 1ZC3B 1E5WA 1S9DE 5DHFB 2D2QA 1V5MA 2LKOA 1M7RA 3PVLA 2D9VA 5LOPB 1P6SA 3UZTA 1X1FA 2KCJA 1LW3A 1SHCA 1QC6A 2MFQA 2J0KA 1UNQA 1UNRA 2RVBB 2YVCA 3A8PA 3FM8C 2DFKA 2KUPA 3AU4A 3SWVA 2DX1A 1MPHA 2GCLA 1PMSA 1P5TA 1FHOA 1EGXA 1I7AA 3GYOA 2EC1A 5C5BB 4D7RA 4BBKA 1OY2A 1U5GA 2J59M 4KVGB 3TFMA 1J0WA 3BINA 1FGYA 2UZRA 1SGHA 4L6EA 4HAVB 2NZ8B 1PLSA 1NTYA 4IFSA 4MY6A 3LTLA 2LG1A 2UZSA 2V76A 3TW1A 4PQ0A 2JP2A 2CODA 1ZM0A 4GMXB 3MDBC 4TYZA 3RCPA 2RSGA 1BTKA 3FSSA 2RLOA 1EF1A 4NSWA 2I5CA 2AL6A 1EVHA 3ULBA 1XCGA 3PP2A 1TQZA 4CHMA 1QQGA 4DBBA 1UEFA 2VRWB 3KRWA 4YL8A 4D0NB 2BCJA 1H4RA 4HAUB 1V5UA 2GJYA 4K17A 3SV1A 4IOYX 1UNPA 2J0JA 2N23A 4K2PA 1I2HA 1KI1B 5DIFB 2D9XA 2UVMA 3FEHA 2DHIA 2YRYA 3SO6A 4CYEA 4F7UP 3ZVRA 2D9ZA 3QBVB 2LYDA 4F7GA 2DYNA 4EKUA 4GPTB 3WYFB 2W2XD 3U7DA 5EFXA 4NY0A 3PZDA 4YONA 5D3XA 1K5GB 1AQCA 3A98B 1TXDA 3PVUA 4MT7A 5D3YA 2DX5A 4A6KA 1MAIA 2OTXA 1LB1A 4HHVA 1R8ME 1W1DA 4EMOA 2Z0PA 1W1GA 2Q13A 5C5BA 4DX90 2VSZA 4DX8A 4K81A 1DYNA 4HDQA 1MK7B 1ZSQA 1WGUA 4Z21A 2K00A 4HDOA 1MK9B 1EAZA 4WJ7A 1GC6A 2I1KA 1OMWA 3P6AA 5HE1A 3D8EA 2K2UA 2MWNB 1KU1A 2CAYA 3CXBB 4A6FA 2P0DA 2DYQA
chains in the Genus database with same CATH superfamily
3ANYA 1W7BA 2XO3A 3WA0A 2J0MA 1T77A 5J3YA 1B55A 1W45A 1YIIA 2QKMA 4MK0A 3HQCA 2IFSA 5D3VA 1AVRA 2R0DA 2GCJA 3IVFA 1YCNA 1ANWA 1BC1A 1A8AA 3AU5A 3PG7A 4ZRJA 1UPRA 4CHJA 4A4PA 2EJ8A 2RNRB 4Z2NA 4ZRKA 5JHHA 3DXEA 4B6HA 1MIZB 4HB0B 2Q4CA 4OIYA 4OT1A 3NW8A 1AIIA 1G5NA 3PSCA 4EJNA 1DDVA 1V88A 5C16A 1FGZA 5CLQB 2VKIA 1LKVX 2DHKA 3FVCA 1WGQA 1X05A 1U5FA 3N7CA 3PEGA 4TKNA 2IICA 1V5PA 2ADZA 1BO9A 5KQ4A 2DKQA 2H0MA 2DN6A 4A6FB 2P0HA 1NI2A 4GNKB 5LONB 1BC3A 2FJLA 2NMBA 2RUKB 2HE7A 3ABRA 2MDXA 5DHAB 5JHGA 4HAYB 3F0WA 4JWLA 2HTHB 2DLWA 3PVWA 4FQ0C 1K5DB 1DROA 4KHAA 3D8DA 2M14A 1U27A 2OQBA 5FI1A 1R8QE 2IYBA 5L81A 2HYVA 3B77A 2OY9A 4XWXA 2RGNB 2MKRA 2COFA 4WSFA 3OANA 2KUQA 2VXGA 1WJ1A 2M38A 2YS1A 5GOWB 2Z0QA 3SOHB 1FOEA 1KZ7A 4JXHA 2I1JA 1A8BA 2G35A 1ANNA 3TO1A 3D8FA 3HK0A 2ROVA 2ROZB 2HSNA 3GYPA 5CLLB 5DH9B 1W3WA 2D9YA 1ALAA 2XQNM 4KHBA 1R4AE 3NWFA 2W2XC 3T06A 1BCYA 4C7PA 4ZRIA 3L8NA 1YJ0A 2FJUB 2YT0A 1V61A 1P3RA 2DA0A 1XX0A 2D10A 4JMOA 5JP4A 5IRSA 3AJ4A 5D27A 3ODXA 1UPTB 1BWNA 3X23A 4HB4B 2ELBA 5I2MA 1U5DA 1AWEA 1XD4A 1DDWA 1HVGA 1OQNA 1WI1A 1FHXA 2L2IA 2Y8GA 3ULCA 5FI0A 3NWDA 5KCVA 1AEIA 1AVCA 3G9WA 1N41A 2LOZA 4QJ3B 1ISNA 3AO0A 1FB8A 2XO2A 2X18A 2Y8FA 1MI1A 1X86A 3TVVA 3DXCA 2K2JA 2ZPYA 3ML4A 1NTVA 3KRXA 2CY5A 4KAXB 1NU2A 3SNHA 2L1CA 2QEZA 4Z2MB 2IE7A 3TW5A 2YS5A 1DBHA 1DK5A 2AEHA 4A6HA 3HJLA 4GOUA 3VIAA 4F7HA 1IRSA 2D11A 1KZGA 3DXDA 1U2BA 4Y94A 1FHWA 2KGXB 1HAKA 3A8QA 1RE0B 2P8VA 5M4YB 1WJMA 4HSIA 2GS0A 2LOXA 2R2YA 4HREA 1HM6A 3ODWA 4QJ4B 2DKPA 3V5WA 2E2XA 1GG3A 3TCAA 4PNKA 3ABSA 2YS3A 4KHBB 2KR0A 1M7EA 3NWAA 4C0AA 3AJCA 3QIJA 2LULA 5C79A 4EVFA 1BCWA 1Q67A 3HW2B 2W2WA 3KSYA 1ANXA 1WG7A 4A5KA 2Z59A 3BRXA 4IAPA 3CIKA 3BJIA 2RANA 1R8SE 1N3HA 1MIXA 5HE3A 2NBVA 1BTNA 2COAA 2YSZA 4DIXA 1MKEA 1V89A 1XODA 1Y19B 4HAZB 1XT0B 1RJ2A 4L5MA 2H7DA 5J3QA 3U8ZA 1Q8DA 3F5RA 4H8SA 1ZVRA 4HATB 3LJUX 5KQ1A 2P0FA 2N0YA 1U5EA 2CRFA 1X11A 2KIEA 1X1GA 1BAKA 1DDMA 4HB3B 1ZC4B 5DI9B 1UPQA 4DXAB 1XSZA 4KHOA 1H10A 5JLJB 5C6RA 4GZUA 1AOWA 2ELAA 3ABQA 5HE0A 3P7ZA 2HYUA 2YT1A 3ABOA 4MDUA 3KY9A 4GN1A 3ZDTA 4HAWB 2YF0A 4OSNA 2D4QA 1MCXA 2DTCA 4JMIA 1WVHA 3ODOA 3KZ1A 5J3TA 3USYA 5D3WA 1I4AA 2H7EA 4GXBA 4FHRB 4GMVA 2DHJA 2K8EA 3HIEA 1RRPB 3O96A 4D7QA 1BC9A 1W1HA 3M1IB 4P7IA 1PBVA 1ZYIA 3QWMA 4HB2B 2EMTA 3VOQA 5I2SA 1XKEA 2YT2A 5HE2A 2Z0OA 2QKLA 2R09A 2EMSA 2K6XA 2Y7BA 2CY4A 4KMUX 1Y5OA 1Z87A 4CSQA 4K2OA 1XR0B 3SUZA 1HVFA 2IE6A 2PZ1A 3MPXA 4WVFB 1PFJA 1FAOA 1BCZA 2D9WA 1TJ6A 1J19A 1M9IA 1U29A 2COCA 2I5FA 1HVEA 1HVDA 1GC7A 2K49A 3NSUA 3SYXA 4HAXB 1ZC3B 4EVHA 1E5WA 1S9DE 5DHFB 2D2QA 1V5MA 2LKOA 1XJLA 1M7RA 3PVLA 2D9VA 5LOPB 1P6SA 2Z4DA 3UZTA 1X1FA 2KCJA 1LW3A 1SHCA 1SAVA 1QC6A 4KN4X 2MFQA 2J0KA 1UNQA 1UNRA 2RVBB 2YVCA 3A8PA 3FM8C 2ZHIA 2DFKA 2KUPA 3AU4A 3SWVA 2DX1A 1MPHA 2H0LA 2GCLA 1PMSA 1P5TA 1FHOA 1EGXA 1I7AA 3GYOA 2EC1A 1BC0A 4D7RA 5C5BB 4BBKA 1OY2A 1U5GA 2J59M 4KVGB 3TFMA 1J0WA 3BINA 1FGYA 2UZRA 2Z14A 1SGHA 2ZOCA 4L6EA 4QJ5B 4Q2SA 4HAVB 2NZ8B 1PLSA 1NTYA 4IFSA 4MY6A 3LTLA 2LG1A 2II2A 2UZSA 2V76A 3TW1A 4PQ0A 2JP2A 2CODA 1ZM0A 4GMXB 3MDBC 4TYZA 1N00A 4L1RA 3RCPA 2RSGA 1BTKA 3FSSA 2RLOA 1EF1A 4NSWA 2I5CA 2AL6A 2Z13A 1EVHA 3ULBA 1XCGA 4MDVA 3PP2A 4KN7X 2H0KA 1TQZA 4CHMA 1QQGA 2GUMA 1C1KA 2ZHJA 4DBBA 1UEFA 2VRWB 3DCXA 3KRWA 4YL8A 4D0NB 2BCJA 1H4RA 4HAUB 1V5UA 2GJYA 4K17A 3SV1A 4IOYX 1UNPA 2J0JA 2N23A 4K2PA 1DM5A 1I2HA 2RRFA 1KI1B 3OHMB 5DIFB 3U12A 2D9XA 2ZKMX 2UVMA 3FEHA 2DHIA 2YRYA 3SO6A 4CYEA 4F7UP 1QC7A 3ZVRA 2D9ZA 3QBVB 2LYDA 4F7GA 2DYNA 4EKUA 4GPTB 3WYFB 2W2XD 3U7DA 2HYWA 5EFXA 4NY0A 3PZDA 4QXAB 4YONA 5D3XA 4X9PA 4D6WA 5LG4B 1K5GB 1AQCA 3A98B 1TXDA 3PVUA 4MT7A 5D3YA 2DX5A 4A6KA 3USWA 1MAIA 2OTXA 1LB1A 1YGMA 1N42A 1AVHA 3HSAA 4HHVA 1R8ME 1W1DA 2KIGA 4EMOA 2Z0PA 1W1GA 2Q13A 5C5BA 4DX90 2VSZA 4DX8A 4K81A 1DYNA 4HDQA 1MK7B 1ZSQA 1WGUA 3A58A 4Z21A 1N44A 2K00A 4HDOA 1MK9B 1EAZA 4JK1X 4WJ7A 1GC6A 2I1KA 1OMWA 3P6AA 5HE1A 3D8EA 2K2UA 2MWNB 1KU1A 2CAYA 1AXNA 3CXBB 4A6FA 2P0DA 2DYQA
chains in the Genus database with same CATH topology
3WA0A 2J0MA 5J3YA 1B55A 2QKMA 4MK0A 3HQCA 2IFSA 5D3VA 2R0DA 2GCJA 3IVFA 3AU5A 3PG7A 4ZRJA 1UPRA 4CHJA 4A4PA 2EJ8A 2RNRB 4Z2NA 4ZRKA 5JHHA 3DXEA 4B6HA 1MIZB 4HB0B 4OIYA 3PSCA 4EJNA 1DDVA 1V88A 5C16A 1FGZA 5CLQB 2VKIA 1LKVX 2DHKA 1WGQA 1X05A 1U5FA 3N7CA 3PEGA 4TKNA 1V5PA 2ADZA 5KQ4A 2DKQA 2DN6A 4A6FB 2P0HA 1NI2A 5LONB 2FJLA 2NMBA 2RUKB 2HE7A 2MDXA 5DHAB 5JHGA 4HAYB 3F0WA 4JWLA 2HTHB 2DLWA 3PVWA 4FQ0C 1K5DB 1DROA 4KHAA 3D8DA 2M14A 1U27A 2OQBA 5FI1A 1R8QE 2IYBA 5L81A 4XWXA 2RGNB 2MKRA 2COFA 4WSFA 3OANA 1WJ1A 2M38A 2YS1A 5GOWB 2Z0QA 3SOHB 1FOEA 1KZ7A 4JXHA 2I1JA 2G35A 3TO1A 3D8FA 3HK0A 2ROVA 2ROZB 2HSNA 3GYPA 5CLLB 5DH9B 2D9YA 2XQNM 2W2XC 3T06A 4C7PA 4ZRIA 3L8NA 2YT0A 1V61A 1P3RA 2DA0A 1XX0A 2D10A 4JMOA 5JP4A 3AJ4A 5D27A 3ODXA 1BWNA 3X23A 4HB4B 2ELBA 1U5DA 1AWEA 1XD4A 1DDWA 1OQNA 1WI1A 1FHXA 2L2IA 2Y8GA 3ULCA 5FI0A 5KCVA 3G9WA 2LOZA 1ISNA 1FB8A 2X18A 2Y8FA 1X86A 3TVVA 3DXCA 2K2JA 2ZPYA 3ML4A 1NTVA 3KRXA 2CY5A 4KAXB 1NU2A 3SNHA 2L1CA 4Z2MB 3TW5A 2YS5A 1DBHA 2AEHA 4A6HA 3HJLA 3VIAA 4F7HA 1IRSA 3DXDA 1KZGA 2D11A 1U2BA 4Y94A 1FHWA 2KGXB 3A8QA 1RE0B 2P8VA 1WJMA 2GS0A 2LOXA 3ODWA 2DKPA 3V5WA 2E2XA 1GG3A 3TCAA 4PNKA 2YS3A 4KHBB 1M7EA 4C0AA 3AJCA 3QIJA 2LULA 5C79A 1Q67A 3HW2B 2W2WA 3KSYA 1WG7A 4A5KA 4IAPA 3CIKA 3BJIA 1R8SE 1N3HA 1MIXA 5HE3A 1BTNA 2COAA 2YSZA 1MKEA 1V89A 1XODA 1Y19B 4HAZB 1XT0B 1RJ2A 4L5MA 2H7DA 5J3QA 3U8ZA 1Q8DA 3F5RA 4H8SA 1ZVRA 4HATB 3LJUX 5KQ1A 2P0FA 2N0YA 1U5EA 2CRFA 1X11A 1X1GA 1BAKA 1DDMA 4HB3B 1ZC4B 5DI9B 1UPQA 4DXAB 1XSZA 4KHOA 1H10A 5JLJB 5C6RA 4GZUA 2ELAA 5HE0A 3P7ZA 2YT1A 4GN1A 3KY9A 3ZDTA 4HAWB 2YF0A 2D4QA 2DTCA 4JMIA 1WVHA 3ODOA 3KZ1A 5J3TA 3USYA 5D3WA 2H7EA 4GXBA 4FHRB 4GMVA 2DHJA 1RRPB 3O96A 4D7QA 1BC9A 1W1HA 3M1IB 4P7IA 1PBVA 3QWMA 4HB2B 2EMTA 3VOQA 1XKEA 5HE2A 2Z0OA 2QKLA 2R09A 2EMSA 2K6XA 2Y7BA 2CY4A 4KMUX 1Y5OA 1Z87A 4K2OA 1XR0B 3SUZA 2PZ1A 3MPXA 4WVFB 1PFJA 1FAOA 2D9WA 1TJ6A 1J19A 1U29A 2COCA 2I5FA 1GC7A 3NSUA 3SYXA 4HAXB 1ZC3B 1E5WA 1S9DE 5DHFB 2D2QA 1V5MA 2LKOA 1M7RA 3PVLA 2D9VA 5LOPB 1P6SA 3UZTA 1X1FA 2KCJA 1LW3A 1SHCA 1QC6A 4KN4X 2MFQA 2J0KA 1UNQA 1UNRA 2RVBB 2YVCA 3A8PA 3FM8C 2DFKA 2KUPA 3AU4A 3SWVA 2DX1A 1MPHA 2GCLA 1PMSA 1P5TA 1FHOA 1EGXA 1I7AA 3GYOA 2EC1A 5C5BB 4D7RA 4BBKA 1OY2A 1U5GA 2J59M 4KVGB 3TFMA 1J0WA 3BINA 1FGYA 2UZRA 1SGHA 4L6EA 4HAVB 2NZ8B 1PLSA 1NTYA 4IFSA 4MY6A 3LTLA 2LG1A 2UZSA 2V76A 3TW1A 4PQ0A 2JP2A 2CODA 1ZM0A 4GMXB 3MDBC 4TYZA 3RCPA 2RSGA 1BTKA 3FSSA 2RLOA 1EF1A 4NSWA 2I5CA 2AL6A 1EVHA 3ULBA 1XCGA 3PP2A 4KN7X 1TQZA 4CHMA 1QQGA 4DBBA 1UEFA 2VRWB 3KRWA 4YL8A 4D0NB 2BCJA 1H4RA 4HAUB 1V5UA 2GJYA 4K17A 3SV1A 4IOYX 1UNPA 2J0JA 2N23A 4K2PA 1I2HA 1KI1B 5DIFB 2D9XA 2UVMA 3FEHA 2DHIA 2YRYA 3SO6A 4CYEA 4F7UP 1QC7A 3ZVRA 2D9ZA 3QBVB 2LYDA 4F7GA 2DYNA 4EKUA 4GPTB 3WYFB 2W2XD 3U7DA 5EFXA 4NY0A 3PZDA 4YONA 5D3XA 1K5GB 1AQCA 3A98B 1TXDA 3PVUA 4MT7A 5D3YA 2DX5A 4A6KA 3USWA 1MAIA 2OTXA 1LB1A 4HHVA 1R8ME 1W1DA 4EMOA 2Z0PA 1W1GA 2Q13A 5C5BA 4DX90 2VSZA 4DX8A 4K81A 1DYNA 4HDQA 1MK7B 1ZSQA 1WGUA 4Z21A 2K00A 4HDOA 1MK9B 1EAZA 4JK1X 4WJ7A 1GC6A 2I1KA 1OMWA 3P6AA 5HE1A 3D8EA 2K2UA 2MWNB 1KU1A 2CAYA 3CXBB 4A6FA 2P0DA 2DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA0 A;  2J0M A;  5J3Y A;  1B55 A;  2QKM A;  4MK0 A;  3HQC A;  2IFS A;  5D3V A;  2R0D A;  2GCJ A;  3IVF A;  3AU5 A;  3PG7 A;  4ZRJ A;  1UPR A;  4CHJ A;  4A4P A;  2EJ8 A;  2RNR B;  4Z2N A;  4ZRK A;  5JHH A;  3DXE A;  4B6H A;  1MIZ B;  4HB0 B;  4OIY A;  3PSC A;  4EJN A;  1DDV A;  1V88 A;  5C16 A;  1FGZ A;  5CLQ B;  2VKI A;  2DHK A;  1WGQ A;  1X05 A;  1U5F A;  3N7C A;  3PEG A;  4TKN A;  1V5P A;  2ADZ A;  5KQ4 A;  2DKQ A;  2DN6 A;  4A6F B;  2P0H A;  1NI2 A;  5LON B;  2FJL A;  2NMB A;  2RUK B;  2HE7 A;  2MDX A;  5DHA B;  5JHG A;  4HAY B;  3F0W A;  4JWL A;  2HTH B;  2DLW A;  3PVW A;  1K5D B;  1DRO A;  4KHA A;  3D8D A;  2M14 A;  1U27 A;  2OQB A;  5FI1 A;  1R8Q E;  2IYB A;  5L81 A;  4XWX A;  2RGN B;  2MKR A;  2COF A;  4WSF A;  3OAN A;  1WJ1 A;  2M38 A;  2YS1 A;  5GOW B;  2Z0Q A;  1FOE A;  1KZ7 A;  4JXH A;  2I1J A;  2G35 A;  3TO1 A;  3D8F A;  3HK0 A;  2ROV A;  2ROZ B;  3GYP A;  5CLL B;  5DH9 B;  2D9Y A;  2XQN M;  2W2X C;  3T06 A;  4C7P A;  4ZRI A;  3L8N A;  2YT0 A;  1V61 A;  1P3R A;  2DA0 A;  1XX0 A;  2D10 A;  4JMO A;  5JP4 A;  3AJ4 A;  5D27 A;  3ODX A;  1BWN A;  3X23 A;  4HB4 B;  2ELB A;  1U5D A;  1AWE A;  1XD4 A;  1DDW A;  1OQN A;  1WI1 A;  1FHX A;  2L2I A;  2Y8G A;  3ULC A;  5FI0 A;  5KCV A;  3G9W A;  2LOZ A;  1ISN A;  1FB8 A;  2X18 A;  2Y8F A;  1X86 A;  3TVV A;  3DXC A;  2K2J A;  2ZPY A;  3ML4 A;  1NTV A;  3KRX A;  2CY5 A;  4KAX B;  1NU2 A;  3SNH A;  2L1C A;  4Z2M B;  2YS5 A;  1DBH A;  2AEH A;  4A6H A;  3VIA A;  4F7H A;  1IRS A;  3DXD A;  1KZG A;  2D11 A;  1U2B A;  4Y94 A;  1FHW A;  2KGX B;  3A8Q A;  1RE0 B;  2P8V A;  1WJM A;  2GS0 A;  2LOX A;  3ODW A;  2DKP A;  3V5W A;  2E2X A;  1GG3 A;  3TCA A;  4PNK A;  2YS3 A;  4KHB B;  1M7E A;  4C0A A;  3QIJ A;  5C79 A;  2LUL A;  1Q67 A;  3HW2 B;  2W2W A;  3KSY A;  1WG7 A;  4A5K A;  4IAP A;  3CIK A;  3BJI A;  1R8S E;  1N3H A;  1MIX A;  5HE3 A;  1BTN A;  2COA A;  2YSZ A;  1MKE A;  1V89 A;  1XOD A;  1Y19 B;  4HAZ B;  1XT0 B;  1RJ2 A;  4L5M A;  2H7D A;  5J3Q A;  3U8Z A;  3F5R A;  4H8S A;  1ZVR A;  4HAT B;  3LJU X;  5KQ1 A;  2P0F A;  2N0Y A;  1U5E A;  2CRF A;  1X11 A;  1X1G A;  1BAK A;  1DDM A;  4HB3 B;  1ZC4 B;  5DI9 B;  1UPQ A;  4DXA B;  1XSZ A;  4KHO A;  1H10 A;  5JLJ B;  5C6R A;  4GZU A;  2ELA A;  5HE0 A;  3P7Z A;  2YT1 A;  4GN1 A;  3KY9 A;  3ZDT A;  4HAW B;  2YF0 A;  2D4Q A;  2DTC A;  4JMI A;  1WVH A;  3ODO A;  3KZ1 A;  5J3T A;  5D3W A;  2H7E A;  4GXB A;  4GMV A;  2DHJ A;  1RRP B;  3O96 A;  4D7Q A;  1BC9 A;  1W1H A;  3M1I B;  4P7I A;  1PBV A;  3QWM A;  4HB2 B;  2EMT A;  3VOQ A;  1XKE A;  5HE2 A;  2Z0O A;  2QKL A;  2R09 A;  2EMS A;  2Y7B A;  2CY4 A;  1Y5O A;  1Z87 A;  4K2O A;  1XR0 B;  3SUZ A;  2PZ1 A;  3MPX A;  4WVF B;  1PFJ A;  1FAO A;  2D9W A;  1TJ6 A;  1J19 A;  1U29 A;  2COC A;  2I5F A;  1GC7 A;  3NSU A;  3SYX A;  4HAX B;  1ZC3 B;  1E5W A;  1S9D E;  5DHF B;  2D2Q A;  1V5M A;  2LKO A;  1M7R A;  3PVL A;  2D9V A;  5LOP B;  1P6S A;  3UZT A;  1X1F A;  2KCJ A;  1LW3 A;  1SHC A;  1QC6 A;  2MFQ A;  2J0K A;  1UNQ A;  1UNR A;  2RVB B;  2YVC A;  3A8P A;  3FM8 C;  2DFK A;  2KUP A;  3AU4 A;  3SWV A;  2DX1 A;  1MPH A;  2GCL A;  1PMS A;  1P5T A;  1FHO A;  1EGX A;  1I7A A;  3GYO A;  2EC1 A;  5C5B B;  4D7R A;  4BBK A;  1OY2 A;  1U5G A;  2J59 M;  4KVG B;  3TFM A;  1J0W A;  3BIN A;  1FGY A;  2UZR A;  1SGH A;  4L6E A;  4HAV B;  2NZ8 B;  1PLS A;  1NTY A;  4IFS A;  4MY6 A;  3LTL A;  2LG1 A;  2UZS A;  2V76 A;  3TW1 A;  4PQ0 A;  2JP2 A;  2COD A;  1ZM0 A;  4GMX B;  3MDB C;  4TYZ A;  3RCP A;  2RSG A;  1BTK A;  3FSS A;  2RLO A;  1EF1 A;  4NSW A;  2I5C A;  2AL6 A;  1EVH A;  3ULB A;  1XCG A;  3PP2 A;  1TQZ A;  4CHM A;  1QQG A;  4DBB A;  1UEF A;  2VRW B;  3KRW A;  4YL8 A;  4D0N B;  2BCJ A;  1H4R A;  4HAU B;  1V5U A;  2GJY A;  4K17 A;  3SV1 A;  4IOY X;  1UNP A;  2J0J A;  2N23 A;  4K2P A;  1I2H A;  1KI1 B;  5DIF B;  2D9X A;  2UVM A;  3FEH A;  2DHI A;  2YRY A;  3SO6 A;  4CYE A;  4F7U P;  3ZVR A;  2D9Z A;  3QBV B;  2LYD A;  4F7G A;  2DYN A;  4EKU A;  4GPT B;  3WYF B;  2W2X D;  3U7D A;  5EFX A;  4NY0 A;  3PZD A;  4YON A;  5D3X A;  1K5G B;  1AQC A;  3A98 B;  1TXD A;  3PVU A;  4MT7 A;  5D3Y A;  2DX5 A;  4A6K A;  1MAI A;  2OTX A;  1LB1 A;  4HHV A;  1R8M E;  1W1D A;  4EMO A;  2Z0P A;  1W1G A;  2Q13 A;  5C5B A;  4DX9 0;  2VSZ A;  4DX8 A;  4K81 A;  1DYN A;  4HDQ A;  1MK7 B;  1ZSQ A;  1WGU A;  4Z21 A;  2K00 A;  4HDO A;  1MK9 B;  1EAZ A;  4WJ7 A;  1GC6 A;  2I1K A;  1OMW A;  3P6A A;  5HE1 A;  3D8E A;  2K2U A;  2MWN B;  1KU1 A;  2CAY A;  3CXB B;  4A6F A;  2P0D A;  2DYQ A; 
#chains in the Genus database with same CATH topology
 3ANY A;  1W7B A;  2XO3 A;  3WA0 A;  2J0M A;  1T77 A;  5J3Y A;  1B55 A;  1W45 A;  1YII A;  2QKM A;  4MK0 A;  3HQC A;  2IFS A;  5D3V A;  1AVR A;  2R0D A;  2GCJ A;  3IVF A;  1YCN A;  1ANW A;  1BC1 A;  1A8A A;  3AU5 A;  3PG7 A;  4ZRJ A;  1UPR A;  4CHJ A;  4A4P A;  2EJ8 A;  2RNR B;  4Z2N A;  4ZRK A;  5JHH A;  3DXE A;  4B6H A;  1MIZ B;  4HB0 B;  2Q4C A;  4OIY A;  4OT1 A;  3NW8 A;  1AII A;  1G5N A;  3PSC A;  4EJN A;  1DDV A;  1V88 A;  5C16 A;  1FGZ A;  5CLQ B;  2VKI A;  1LKV X;  2DHK A;  3FVC A;  1WGQ A;  1X05 A;  1U5F A;  3N7C A;  3PEG A;  4TKN A;  2IIC A;  1V5P A;  2ADZ A;  1BO9 A;  5KQ4 A;  2DKQ A;  2H0M A;  2DN6 A;  4A6F B;  2P0H A;  1NI2 A;  4GNK B;  5LON B;  1BC3 A;  2FJL A;  2NMB A;  2RUK B;  2HE7 A;  3ABR A;  2MDX A;  5DHA B;  5JHG A;  4HAY B;  3F0W A;  4JWL A;  2HTH B;  2DLW A;  3PVW A;  4FQ0 C;  1K5D B;  1DRO A;  4KHA A;  3D8D A;  2M14 A;  1U27 A;  2OQB A;  5FI1 A;  1R8Q E;  2IYB A;  5L81 A;  2HYV A;  3B77 A;  2OY9 A;  4XWX A;  2RGN B;  2MKR A;  2COF A;  4WSF A;  3OAN A;  2KUQ A;  2VXG A;  1WJ1 A;  2M38 A;  2YS1 A;  5GOW B;  2Z0Q A;  3SOH B;  1FOE A;  1KZ7 A;  4JXH A;  2I1J A;  1A8B A;  2G35 A;  1ANN A;  3TO1 A;  3D8F A;  3HK0 A;  2ROV A;  2ROZ B;  2HSN A;  3GYP A;  5CLL B;  5DH9 B;  1W3W A;  2D9Y A;  1ALA A;  2XQN M;  4KHB A;  1R4A E;  3NWF A;  2W2X C;  3T06 A;  1BCY A;  4C7P A;  4ZRI A;  3L8N A;  1YJ0 A;  2FJU B;  2YT0 A;  1V61 A;  1P3R A;  2DA0 A;  1XX0 A;  2D10 A;  4JMO A;  5JP4 A;  5IRS A;  3AJ4 A;  5D27 A;  3ODX A;  1UPT B;  1BWN A;  3X23 A;  4HB4 B;  2ELB A;  5I2M A;  1U5D A;  1AWE A;  1XD4 A;  1DDW A;  1HVG A;  1OQN A;  1WI1 A;  1FHX A;  2L2I A;  2Y8G A;  3ULC A;  5FI0 A;  3NWD A;  5KCV A;  1AEI A;  1AVC A;  3G9W A;  1N41 A;  2LOZ A;  4QJ3 B;  1ISN A;  3AO0 A;  1FB8 A;  2XO2 A;  2X18 A;  2Y8F A;  1MI1 A;  1X86 A;  3TVV A;  3DXC A;  2K2J A;  2ZPY A;  3ML4 A;  1NTV A;  3KRX A;  2CY5 A;  4KAX B;  1NU2 A;  3SNH A;  2L1C A;  2QEZ A;  4Z2M B;  2IE7 A;  3TW5 A;  2YS5 A;  1DBH A;  1DK5 A;  2AEH A;  4A6H A;  3HJL A;  4GOU A;  3VIA A;  4F7H A;  1IRS A;  2D11 A;  1KZG A;  3DXD A;  1U2B A;  4Y94 A;  1FHW A;  2KGX B;  1HAK A;  3A8Q A;  1RE0 B;  2P8V A;  5M4Y B;  1WJM A;  4HSI A;  2GS0 A;  2LOX A;  2R2Y A;  4HRE A;  1HM6 A;  3ODW A;  4QJ4 B;  2DKP A;  3V5W A;  2E2X A;  1GG3 A;  3TCA A;  4PNK A;  3ABS A;  2YS3 A;  4KHB B;  2KR0 A;  1M7E A;  3NWA A;  4C0A A;  3AJC A;  3QIJ A;  2LUL A;  5C79 A;  4EVF A;  1BCW A;  1Q67 A;  3HW2 B;  2W2W A;  3KSY A;  1ANX A;  1WG7 A;  4A5K A;  2Z59 A;  3BRX A;  4IAP A;  3CIK A;  3BJI A;  2RAN A;  1R8S E;  1N3H A;  1MIX A;  5HE3 A;  2NBV A;  1BTN A;  2COA A;  2YSZ A;  4DIX A;  1MKE A;  1V89 A;  1XOD A;  1Y19 B;  4HAZ B;  1XT0 B;  1RJ2 A;  4L5M A;  2H7D A;  5J3Q A;  3U8Z A;  1Q8D A;  3F5R A;  4H8S A;  1ZVR A;  4HAT B;  3LJU X;  5KQ1 A;  2P0F A;  2N0Y A;  1U5E A;  2CRF A;  1X11 A;  2KIE A;  1X1G A;  1BAK A;  1DDM A;  4HB3 B;  1ZC4 B;  5DI9 B;  1UPQ A;  4DXA B;  1XSZ A;  4KHO A;  1H10 A;  5JLJ B;  5C6R A;  4GZU A;  1AOW A;  2ELA A;  3ABQ A;  5HE0 A;  3P7Z A;  2HYU A;  2YT1 A;  3ABO A;  4MDU A;  3KY9 A;  4GN1 A;  3ZDT A;  4HAW B;  2YF0 A;  4OSN A;  2D4Q A;  1MCX A;  2DTC A;  4JMI A;  1WVH A;  3ODO A;  3KZ1 A;  5J3T A;  3USY A;  5D3W A;  1I4A A;  2H7E A;  4GXB A;  4FHR B;  4GMV A;  2DHJ A;  2K8E A;  3HIE A;  1RRP B;  3O96 A;  4D7Q A;  1BC9 A;  1W1H A;  3M1I B;  4P7I A;  1PBV A;  1ZYI A;  3QWM A;  4HB2 B;  2EMT A;  3VOQ A;  5I2S A;  1XKE A;  2YT2 A;  5HE2 A;  2Z0O A;  2QKL A;  2R09 A;  2EMS A;  2K6X A;  2Y7B A;  2CY4 A;  4KMU X;  1Y5O A;  1Z87 A;  4CSQ A;  4K2O A;  1XR0 B;  3SUZ A;  1HVF A;  2IE6 A;  2PZ1 A;  3MPX A;  4WVF B;  1PFJ A;  1FAO A;  1BCZ A;  2D9W A;  1TJ6 A;  1J19 A;  1M9I A;  1U29 A;  2COC A;  2I5F A;  1HVE A;  1HVD A;  1GC7 A;  2K49 A;  3NSU A;  3SYX A;  4HAX B;  1ZC3 B;  4EVH A;  1E5W A;  1S9D E;  5DHF B;  2D2Q A;  1V5M A;  2LKO A;  1XJL A;  1M7R A;  3PVL A;  2D9V A;  5LOP B;  1P6S A;  2Z4D A;  3UZT A;  1X1F A;  2KCJ A;  1LW3 A;  1SHC A;  1SAV A;  1QC6 A;  4KN4 X;  2MFQ A;  2J0K A;  1UNQ A;  1UNR A;  2RVB B;  2YVC A;  3A8P A;  3FM8 C;  2ZHI A;  2DFK A;  2KUP A;  3AU4 A;  3SWV A;  2DX1 A;  1MPH A;  2H0L A;  2GCL A;  1PMS A;  1P5T A;  1FHO A;  1EGX A;  1I7A A;  3GYO A;  2EC1 A;  1BC0 A;  4D7R A;  5C5B B;  4BBK A;  1OY2 A;  1U5G A;  2J59 M;  4KVG B;  3TFM A;  1J0W A;  3BIN A;  1FGY A;  2UZR A;  2Z14 A;  1SGH A;  2ZOC A;  4L6E A;  4QJ5 B;  4Q2S A;  4HAV B;  2NZ8 B;  1PLS A;  1NTY A;  4IFS A;  4MY6 A;  3LTL A;  2LG1 A;  2II2 A;  2UZS A;  2V76 A;  3TW1 A;  4PQ0 A;  2JP2 A;  2COD A;  1ZM0 A;  4GMX B;  3MDB C;  4TYZ A;  1N00 A;  4L1R A;  3RCP A;  2RSG A;  1BTK A;  3FSS A;  2RLO A;  1EF1 A;  4NSW A;  2I5C A;  2AL6 A;  2Z13 A;  1EVH A;  3ULB A;  1XCG A;  4MDV A;  3PP2 A;  4KN7 X;  2H0K A;  1TQZ A;  4CHM A;  1QQG A;  2GUM A;  1C1K A;  2ZHJ A;  4DBB A;  1UEF A;  2VRW B;  3DCX A;  3KRW A;  4YL8 A;  4D0N B;  2BCJ A;  1H4R A;  4HAU B;  1V5U A;  2GJY A;  4K17 A;  3SV1 A;  4IOY X;  1UNP A;  2J0J A;  2N23 A;  4K2P A;  1DM5 A;  1I2H A;  2RRF A;  1KI1 B;  3OHM B;  5DIF B;  3U12 A;  2D9X A;  2ZKM X;  2UVM A;  3FEH A;  2DHI A;  2YRY A;  3SO6 A;  4CYE A;  4F7U P;  1QC7 A;  3ZVR A;  2D9Z A;  3QBV B;  2LYD A;  4F7G A;  2DYN A;  4EKU A;  4GPT B;  3WYF B;  2W2X D;  3U7D A;  2HYW A;  5EFX A;  4NY0 A;  3PZD A;  4QXA B;  4YON A;  5D3X A;  4X9P A;  4D6W A;  5LG4 B;  1K5G B;  1AQC A;  3A98 B;  1TXD A;  3PVU A;  4MT7 A;  5D3Y A;  2DX5 A;  4A6K A;  3USW A;  1MAI A;  2OTX A;  1LB1 A;  1YGM A;  1N42 A;  1AVH A;  3HSA A;  4HHV A;  1R8M E;  1W1D A;  2KIG A;  4EMO A;  2Z0P A;  1W1G A;  2Q13 A;  5C5B A;  4DX9 0;  2VSZ A;  4DX8 A;  4K81 A;  1DYN A;  4HDQ A;  1MK7 B;  1ZSQ A;  1WGU A;  3A58 A;  4Z21 A;  1N44 A;  2K00 A;  4HDO A;  1MK9 B;  1EAZ A;  4JK1 X;  4WJ7 A;  1GC6 A;  2I1K A;  1OMW A;  3P6A A;  5HE1 A;  3D8E A;  2K2U A;  2MWN B;  1KU1 A;  2CAY A;  1AXN A;  3CXB B;  4A6F A;  2P0D A;  2DYQ A; 
#chains in the Genus database with same CATH homology
 3WA0 A;  2J0M A;  5J3Y A;  1B55 A;  2QKM A;  4MK0 A;  3HQC A;  2IFS A;  5D3V A;  2R0D A;  2GCJ A;  3IVF A;  3AU5 A;  3PG7 A;  4ZRJ A;  1UPR A;  4CHJ A;  4A4P A;  2EJ8 A;  2RNR B;  4Z2N A;  4ZRK A;  5JHH A;  3DXE A;  4B6H A;  1MIZ B;  4HB0 B;  4OIY A;  3PSC A;  4EJN A;  1DDV A;  1V88 A;  5C16 A;  1FGZ A;  5CLQ B;  2VKI A;  1LKV X;  2DHK A;  1WGQ A;  1X05 A;  1U5F A;  3N7C A;  3PEG A;  4TKN A;  1V5P A;  2ADZ A;  5KQ4 A;  2DKQ A;  2DN6 A;  4A6F B;  2P0H A;  1NI2 A;  5LON B;  2FJL A;  2NMB A;  2RUK B;  2HE7 A;  2MDX A;  5DHA B;  5JHG A;  4HAY B;  3F0W A;  4JWL A;  2HTH B;  2DLW A;  3PVW A;  4FQ0 C;  1K5D B;  1DRO A;  4KHA A;  3D8D A;  2M14 A;  1U27 A;  2OQB A;  5FI1 A;  1R8Q E;  2IYB A;  5L81 A;  4XWX A;  2RGN B;  2MKR A;  2COF A;  4WSF A;  3OAN A;  1WJ1 A;  2M38 A;  2YS1 A;  5GOW B;  2Z0Q A;  3SOH B;  1FOE A;  1KZ7 A;  4JXH A;  2I1J A;  2G35 A;  3TO1 A;  3D8F A;  3HK0 A;  2ROV A;  2ROZ B;  2HSN A;  3GYP A;  5CLL B;  5DH9 B;  2D9Y A;  2XQN M;  2W2X C;  3T06 A;  4C7P A;  4ZRI A;  3L8N A;  2YT0 A;  1V61 A;  1P3R A;  2DA0 A;  1XX0 A;  2D10 A;  4JMO A;  5JP4 A;  3AJ4 A;  5D27 A;  3ODX A;  1BWN A;  3X23 A;  4HB4 B;  2ELB A;  1U5D A;  1AWE A;  1XD4 A;  1DDW A;  1OQN A;  1WI1 A;  1FHX A;  2L2I A;  2Y8G A;  3ULC A;  5FI0 A;  5KCV A;  3G9W A;  2LOZ A;  1ISN A;  1FB8 A;  2X18 A;  2Y8F A;  1X86 A;  3TVV A;  3DXC A;  2K2J A;  2ZPY A;  3ML4 A;  1NTV A;  3KRX A;  2CY5 A;  4KAX B;  1NU2 A;  3SNH A;  2L1C A;  4Z2M B;  3TW5 A;  2YS5 A;  1DBH A;  2AEH A;  4A6H A;  3HJL A;  3VIA A;  4F7H A;  1IRS A;  3DXD A;  1KZG A;  2D11 A;  1U2B A;  4Y94 A;  1FHW A;  2KGX B;  3A8Q A;  1RE0 B;  2P8V A;  1WJM A;  2GS0 A;  2LOX A;  3ODW A;  2DKP A;  3V5W A;  2E2X A;  1GG3 A;  3TCA A;  4PNK A;  2YS3 A;  4KHB B;  1M7E A;  4C0A A;  3AJC A;  3QIJ A;  2LUL A;  5C79 A;  1Q67 A;  3HW2 B;  2W2W A;  3KSY A;  1WG7 A;  4A5K A;  4IAP A;  3CIK A;  3BJI A;  1R8S E;  1N3H A;  1MIX A;  5HE3 A;  1BTN A;  2COA A;  2YSZ A;  1MKE A;  1V89 A;  1XOD A;  1Y19 B;  4HAZ B;  1XT0 B;  1RJ2 A;  4L5M A;  2H7D A;  5J3Q A;  3U8Z A;  1Q8D A;  3F5R A;  4H8S A;  1ZVR A;  4HAT B;  3LJU X;  5KQ1 A;  2P0F A;  2N0Y A;  1U5E A;  2CRF A;  1X11 A;  1X1G A;  1BAK A;  1DDM A;  4HB3 B;  1ZC4 B;  5DI9 B;  1UPQ A;  4DXA B;  1XSZ A;  4KHO A;  1H10 A;  5JLJ B;  5C6R A;  4GZU A;  2ELA A;  5HE0 A;  3P7Z A;  2YT1 A;  4GN1 A;  3KY9 A;  3ZDT A;  4HAW B;  2YF0 A;  2D4Q A;  2DTC A;  4JMI A;  1WVH A;  3ODO A;  3KZ1 A;  5J3T A;  3USY A;  5D3W A;  2H7E A;  4GXB A;  4FHR B;  4GMV A;  2DHJ A;  1RRP B;  3O96 A;  4D7Q A;  1BC9 A;  1W1H A;  3M1I B;  4P7I A;  1PBV A;  3QWM A;  4HB2 B;  2EMT A;  3VOQ A;  1XKE A;  5HE2 A;  2Z0O A;  2QKL A;  2R09 A;  2EMS A;  2K6X A;  2Y7B A;  2CY4 A;  4KMU X;  1Y5O A;  1Z87 A;  4K2O A;  1XR0 B;  3SUZ A;  2PZ1 A;  3MPX A;  4WVF B;  1PFJ A;  1FAO A;  2D9W A;  1TJ6 A;  1J19 A;  1U29 A;  2COC A;  2I5F A;  1GC7 A;  3NSU A;  3SYX A;  4HAX B;  1ZC3 B;  1E5W A;  1S9D E;  5DHF B;  2D2Q A;  1V5M A;  2LKO A;  1M7R A;  3PVL A;  2D9V A;  5LOP B;  1P6S A;  3UZT A;  1X1F A;  2KCJ A;  1LW3 A;  1SHC A;  1QC6 A;  4KN4 X;  2MFQ A;  2J0K A;  1UNQ A;  1UNR A;  2RVB B;  2YVC A;  3A8P A;  3FM8 C;  2DFK A;  2KUP A;  3AU4 A;  3SWV A;  2DX1 A;  1MPH A;  2GCL A;  1PMS A;  1P5T A;  1FHO A;  1EGX A;  1I7A A;  3GYO A;  2EC1 A;  5C5B B;  4D7R A;  4BBK A;  1OY2 A;  1U5G A;  2J59 M;  4KVG B;  3TFM A;  1J0W A;  3BIN A;  1FGY A;  2UZR A;  1SGH A;  4L6E A;  4HAV B;  2NZ8 B;  1PLS A;  1NTY A;  4IFS A;  4MY6 A;  3LTL A;  2LG1 A;  2UZS A;  2V76 A;  3TW1 A;  4PQ0 A;  2JP2 A;  2COD A;  1ZM0 A;  4GMX B;  3MDB C;  4TYZ A;  3RCP A;  2RSG A;  1BTK A;  3FSS A;  2RLO A;  1EF1 A;  4NSW A;  2I5C A;  2AL6 A;  1EVH A;  3ULB A;  1XCG A;  3PP2 A;  4KN7 X;  1TQZ A;  4CHM A;  1QQG A;  4DBB A;  1UEF A;  2VRW B;  3KRW A;  4YL8 A;  4D0N B;  2BCJ A;  1H4R A;  4HAU B;  1V5U A;  2GJY A;  4K17 A;  3SV1 A;  4IOY X;  1UNP A;  2J0J A;  2N23 A;  4K2P A;  1I2H A;  1KI1 B;  5DIF B;  2D9X A;  2UVM A;  3FEH A;  2DHI A;  2YRY A;  3SO6 A;  4CYE A;  4F7U P;  1QC7 A;  3ZVR A;  2D9Z A;  3QBV B;  2LYD A;  4F7G A;  2DYN A;  4EKU A;  4GPT B;  3WYF B;  2W2X D;  3U7D A;  5EFX A;  4NY0 A;  3PZD A;  4YON A;  5D3X A;  1K5G B;  1AQC A;  3A98 B;  1TXD A;  3PVU A;  4MT7 A;  5D3Y A;  2DX5 A;  4A6K A;  3USW A;  1MAI A;  2OTX A;  1LB1 A;  4HHV A;  1R8M E;  1W1D A;  4EMO A;  2Z0P A;  1W1G A;  2Q13 A;  5C5B A;  4DX9 0;  2VSZ A;  4DX8 A;  4K81 A;  1DYN A;  4HDQ A;  1MK7 B;  1ZSQ A;  1WGU A;  4Z21 A;  2K00 A;  4HDO A;  1MK9 B;  1EAZ A;  4JK1 X;  4WJ7 A;  1GC6 A;  2I1K A;  1OMW A;  3P6A A;  5HE1 A;  3D8E A;  2K2U A;  2MWN B;  1KU1 A;  2CAY A;  3CXB B;  4A6F A;  2P0D A;  2DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...