2R0DA

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytohesin-3
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 114
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r0dA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r0dA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r0dA03
2D9WA 2LYDA 2DHIA 2Y7BA 3HK0A 5JHGA 1U5FA 2YRYA 3ML4A 4PNKA 3T06A 5DHAB 3SV1A 3MPXA 3TW1A 5DI9B 1DYNA 2P0HA 1X1GA 2YS1A 1ZVRA 1XT0B 1M7RA 4KVGB 2K00A 2CODA 4A6FB 5D27A 4GMXB 2COAA 4Z2MB 3SO6A 4ZRIA 3GYPA 2RLOA 1GC7A 4HHVA 3ULCA 1FHXA 1V61A 4A6KA 5FI0A 2CY4A 1GC6A 4DXAB 1XKEA 1BAKA 4JMOA 3X23A 4IFSA 1TXDA 5JHHA 1BC9A 1ISNA 2BCJA 3VIAA 2IYBA 2J0JA 3P6AA 4H8SA 1AQCA 1OY2A 2ROZB 2I5FA 1AWEA 3TO1A 2CAYA 1WG7A 1K5GB 1V5MA 5FI1A 2RVBB 3VOQA 1XR0B 4Y94A 3FM8C 2Z0OA 4OIYA 3F0WA 5DH9B 2YVCA 3PP2A 4HDOA 4GN1A 3U8ZA 2D9VA 2DTCA 2DKPA 3PG7A 5C16A 2Q13A 1MAIA 1XD4A 5EFXA 1UNPA 1IRSA 5D3YA 1ZM0A 5DIFB 5KCVA 1FHOA 3SWVA 2VKIA 2DHKA 5KQ1A 1MKEA 1KZGA 4HB4B 4CHMA 2LULA 2GCJA 4F7HA 3L8NA 3BJIA 3PVLA 1BWNA 4MY6A 2RSGA 4BBKA 3D8EA 1ZC3B 3WYFB 1UPQA 1WVHA 1J0WA 4K2PA 2AEHA 2Y8FA 3PVUA 4DBBA 3F5RA 2KCJA 1U5GA 3U7DA 5HE2A 1TQZA 2PZ1A 1U29A 1SHCA 2L1CA 3AU4A 2N23A 1J19A 3ODOA 4Z2NA 4GZUA 1UEFA 1WJ1A 1V89A 1W1GA 1QC6A 3PVWA 2X18A 2YS5A 1N3HA 1B55A 1WJMA 1X11A 3QIJA 4KHBB 5HE1A 4HAYB 2GCLA 5C5BA 1PMSA 2ADZA 3LTLA 4TKNA 2D4QA 2J59M 4YONA 5HE0A 1XX0A 2RGNB 1ZC4B 2MDXA 2LKOA 1MIXA 3DXEA 2UZRA 4KHOA 2QKLA 4KAXB 2K2JA 4HB2B 1RRPB 2D9YA 4ZRKA 3IVFA 1NU2A 2P0FA 4EMOA 1Z87A 2UVMA 4A4PA 1W1DA 3PSCA 4DX90 2I1KA 4EKUA 2I5CA 2EMSA 3DXCA 2Z0QA 1EAZA 1OQNA 2W2XC 3WA0A 4GPTB 2M38A 2J0KA 4DX8A 4IOYX 4A6FA 1UNQA 1Y19B 1GG3A 5CLLB 1P3RA 3FSSA 2DHJA 2D11A 3AU5A 3GYOA 1BTKA 1WI1A 2ROVA 1K5DB 5D3WA 1LW3A 1Q67A 2EJ8A 4L5MA 1TJ6A 4HAZB 3PZDA 4D0NB 4F7GA 4NY0A 2E2XA 1PBVA 4A6HA 4JWLA 2DLWA 2RUKB 3RCPA 4GXBA 3O96A 2MWNB 4MK0A 2H7DA 2M14A 5GOWB 3SYXA 1UPRA 3ODXA 2QKMA 2VRWB 4Z21A 1I2HA 2D9XA 1Y5OA 2D9ZA 5C79A 1M7EA 4HB0B 4NSWA 4P7IA 1X1FA 4XWXA 1S9DE 5D3XA 3KY9A 2UZSA 1RJ2A 3ZVRA 4EJNA 1KZ7A 1XCGA 1H4RA 1LB1A 2DKQA 5D3VA 1R8SE 4JMIA 1DBHA 2DX1A 4C0AA 3D8DA 4WSFA 4HB3B 1ZSQA 3HW2B 2XQNM 2ELBA 2H7EA 4ZRJA 4HATB 1EF1A 2R09A 4HAVB 5JLJB 1WGQA 1PFJA 1MK9B 5HE3A 2COCA 1UNRA 2DFKA 2DN6A 3UZTA 3KRWA 5CLQB 2DX5A 4HAWB 5LONB 2W2XD 4TYZA 3ZDTA 2V76A 1H10A 3CXBB 5L81A 2KUPA 4MT7A 4HAUB 1EGXA 3D8FA 3BINA 1R8ME 2L2IA 2W2WA 4K81A 2KGXB 5C6RA 3KRXA 1P6SA 2Y8GA 2YSZA 5KQ4A 1XSZA 2I1JA 4K17A 1V88A 3TCAA 3AJ4A 3V5WA 2EC1A 2IFSA 1FGYA 1SGHA 3KSYA 2G35A 4KHAA 3ULBA 1DROA 3CIKA 4YL8A 2D2QA 4WJ7A 1P5TA 2P0DA 2N0YA 1NI2A 4JXHA 1U2BA 2YT1A 1MK7B 3A8PA 3M1IB 3QWMA 4C7PA 1RE0B 4GMVA 2DYNA 3KZ1A 2AL6A 4A5KA 1MIZB 1MPHA 3MDBC 1U27A 2LG1A 3QBVB 1U5DA 4B6HA 2MFQA 2DYQA 2ZPYA 4CHJA 1U5EA 2LOZA 1FHWA 1R8QE 2LOXA 3G9WA 2D10A 1FOEA 3TVVA 3TFMA 4WVFB 4K2OA 1I7AA 5J3TA 3SUZA 2OTXA 1EVHA 3OANA 1OMWA 1KU1A 1DDVA 1X86A 2DA0A 3LJUX 1NTVA 4D7QA 2P8VA 1FAOA 5JP4A 2YF0A 4F7UP 1V5PA 2J0MA 2FJLA 3A8QA 2R0DA 2VSZA 2HE7A 4D7RA 4PQ0A 1QQGA 1PLSA 1DDMA 4CYEA 1NTYA 2NMBA 2COFA 2YT0A 1FGZA 4IAPA 2JP2A 2GJYA 2CY5A 2K2UA 5LOPB 3P7ZA 1DDWA 2ELAA 4HAXB 2OQBA 5C5BB 3HQCA 3N7CA 3PEGA 5DHFB 2YS3A 2EMTA 4HDQA 1BTNA 3A98B 1KI1B 1W1HA 4L6EA 1WGUA 1V5UA 1X05A 1FB8A 1E5WA 2CRFA 2GS0A 2MKRA 3FEHA 2NZ8B 1XODA 5J3QA 3ODWA 2Z0PA 5J3YA 3SNHA 3NSUA 3DXDA 2HTHB 2RNRB
chains in the Genus database with same CATH superfamily
2D9WA 2LYDA 1A8BA 2DHIA 2Y7BA 3HK0A 5JHGA 1U5FA 2H0KA 2NBVA 2YRYA 3ML4A 4PNKA 3T06A 5DHAB 3SV1A 4X9PA 3MPXA 2II2A 2QEZA 3TW1A 5DI9B 1DYNA 2P0HA 5IRSA 1X1GA 2YS1A 1ZVRA 1XT0B 1M7RA 1G5NA 4KVGB 2K00A 2CODA 4A6FB 2Z4DA 5D27A 4GMXB 2COAA 2XO3A 4Z2MB 3SO6A 4ZRIA 3GYPA 2RLOA 1GC7A 4HHVA 3ULCA 1HVGA 1N42A 1FHXA 1V61A 4A6KA 3A58A 2CY4A 5FI0A 1GC6A 5I2MA 4DXAB 1XKEA 2K49A 1BAKA 4JMOA 3X23A 4IFSA 1TXDA 5JHHA 1BC9A 1YJ0A 1ISNA 2KIEA 2BCJA 2IE6A 2RRFA 2IYBA 3VIAA 2J0JA 3P6AA 4H8SA 1AQCA 1OY2A 2ROZB 2I5FA 1AWEA 1UPTB 3TO1A 2CAYA 1WG7A 1K5GB 1V5MA 4EVFA 5FI1A 1BCYA 2RVBB 1W7BA 3VOQA 1XR0B 4Y94A 3FM8C 2Z0OA 1ANXA 4OIYA 3F0WA 5DH9B 2YVCA 3PP2A 4HDOA 4GN1A 3U8ZA 4FQ0C 2D9VA 2DTCA 2DKPA 1T77A 3PG7A 5C16A 2Q13A 1MAIA 1XD4A 5EFXA 1A8AA 1UNPA 1IRSA 5D3YA 1ZM0A 5DIFB 1BCWA 5KCVA 1FHOA 3SWVA 2VKIA 3NWDA 2DHKA 5KQ1A 1SAVA 1MKEA 1KZGA 4HB4B 4CHMA 2LULA 4D6WA 2GCJA 4F7HA 3L8NA 3BJIA 3PVLA 1BWNA 3SOHB 4MY6A 2RSGA 4BBKA 3D8EA 1ZC3B 3WYFB 1UPQA 1WVHA 1J0WA 4K2PA 2AEHA 2Y8FA 3PVUA 1M9IA 4DBBA 3F5RA 2KCJA 3U12A 1U5GA 3U7DA 1R4AE 5HE2A 1LKVX 3HIEA 4FHRB 1TQZA 1ANWA 2PZ1A 1U29A 1SHCA 2K6XA 4KMUX 2L1CA 3AU4A 2N23A 1J19A 3ODOA 4Z2NA 4GZUA 1UEFA 1WJ1A 1V89A 1W1GA 1QC6A 3PVWA 2X18A 2YS5A 2YT2A 1N3HA 1B55A 1WJMA 1X11A 3QIJA 4KHBB 5HE1A 4HAYB 2GCLA 5C5BA 1PMSA 2ADZA 3LTLA 4TKNA 2D4QA 2J59M 4YONA 5HE0A 1XX0A 2ZKMX 2RGNB 1ZC4B 1HVFA 2MDXA 2LKOA 3NWFA 1MIXA 2HSNA 2UZRA 3DXEA 4KHOA 2QKLA 4KAXB 2K2JA 1HVDA 4HB2B 1RRPB 1I4AA 2D9YA 4ZRKA 3IVFA 1BC1A 1NU2A 4QJ4B 1BO9A 2P0FA 4CSQA 4EMOA 3HJLA 1Z87A 2UVMA 4A4PA 1W1DA 3PSCA 4DX90 2I1KA 1HVEA 4EKUA 2I5CA 2EMSA 1AVRA 3DXCA 2Z0QA 5LG4B 1EAZA 1OQNA 2W2XC 2KIGA 2IICA 3WA0A 4GPTB 2M38A 2J0KA 4OSNA 1BC0A 4DX8A 4IOYX 4A6FA 2Z14A 1UNQA 1Y19B 1GG3A 5CLLB 1AEIA 1HM6A 1P3RA 4QXAB 3FSSA 2DHJA 2D11A 4JK1X 3AU5A 1BTKA 3GYOA 1WI1A 2ROVA 4L1RA 1K5DB 5D3WA 1LW3A 1Q67A 2EJ8A 4L5MA 1TJ6A 4HAZB 3PZDA 4D0NB 1DK5A 2Q4CA 4F7GA 4HREA 4NY0A 2E2XA 2RANA 3BRXA 1PBVA 4A6HA 4JWLA 2HYUA 1W3WA 2DLWA 2RUKB 4GXBA 3RCPA 3O96A 2MWNB 4MK0A 2H7DA 1QC7A 2M14A 2K8EA 5GOWB 3SYXA 1AIIA 1UPRA 3ODXA 3TW5A 3USWA 2ZHJA 2QKMA 4DIXA 2VRWB 4Z21A 1I2HA 2D9XA 1Y5OA 2D9ZA 5C79A 1HAKA 1M7EA 4HB0B 4NSWA 1AXNA 4P7IA 1X1FA 4XWXA 1S9DE 5D3XA 1Q8DA 3KY9A 2UZSA 2H0MA 1RJ2A 1MCXA 5M4YB 3ZVRA 4EJNA 1KZ7A 1XCGA 1H4RA 1LB1A 2HYWA 2VXGA 4QJ3B 1ANNA 2DKQA 5D3VA 2IE7A 1R8SE 4JMIA 1DBHA 2DX1A 4C0AA 3D8DA 3OHMB 1XJLA 4WSFA 4HB3B 2HYVA 1ALAA 1ZSQA 3HW2B 2XQNM 2ELBA 2H7EA 2Z13A 1W45A 4ZRJA 4HATB 1EF1A 1N44A 2R09A 1N00A 4HAVB 3USYA 5JLJB 1WGQA 4GNKB 1PFJA 1MK9B 5HE3A 2COCA 3AJCA 1UNRA 2DFKA 2DN6A 3UZTA 3KRWA 5CLQB 2DX5A 4HAWB 5LONB 4MDVA 1BCZA 2W2XD 3FVCA 4TYZA 3ZDTA 2KR0A 2V76A 1C1KA 1H10A 3CXBB 5L81A 2KUPA 1MI1A 4HAUB 4MT7A 1EGXA 3D8FA 1YGMA 3BINA 1R8ME 2L2IA 2W2WA 4K81A 4GOUA 1AVHA 2KGXB 5C6RA 3KRXA 1P6SA 4QJ5B 2Y8GA 2YSZA 5KQ4A 1XSZA 2I1JA 2KUQA 4K17A 2H0LA 1V88A 3TCAA 3AJ4A 3V5WA 2EC1A 2IFSA 3DCXA 1FGYA 1SGHA 4KHBA 3KSYA 2G35A 4KHAA 3HSAA 3ULBA 3AO0A 3CIKA 4YL8A 2D2QA 1DROA 4WJ7A 1P5TA 2P0DA 2N0YA 1NI2A 4JXHA 1U2BA 2YT1A 1MK7B 3ABSA 3A8PA 3M1IB 3QWMA 4C7PA 3NW8A 1RE0B 4GMVA 2DYNA 3ABOA 3KZ1A 1AVCA 2AL6A 4A5KA 4OT1A 4EVHA 1MIZB 2XO2A 1MPHA 3MDBC 1U27A 2LG1A 3QBVB 1ZYIA 1U5DA 4B6HA 2MFQA 4MDUA 2DYQA 2ZPYA 4CHJA 1U5EA 2LOZA 1FHWA 1R8QE 2LOXA 1N41A 3G9WA 2D10A 1FOEA 3TVVA 3TFMA 4WVFB 4K2OA 1I7AA 5J3TA 3SUZA 2OTXA 4KN7X 1EVHA 3OANA 1OMWA 1KU1A 1DDVA 1X86A 2DA0A 3LJUX 1NTVA 4D7QA 2P8VA 3ABRA 1YCNA 1FAOA 5JP4A 3NWAA 2GUMA 1YIIA 2YF0A 3B77A 4F7UP 2ZHIA 1V5PA 2J0MA 2FJLA 2OY9A 3A8QA 2Z59A 2R0DA 2VSZA 2HE7A 4D7RA 4PQ0A 1QQGA 3ABQA 1PLSA 1DDMA 4CYEA 2ZOCA 1NTYA 2NMBA 2COFA 4Q2SA 5I2SA 2YT0A 1FGZA 4IAPA 2JP2A 2GJYA 2CY5A 2K2UA 2FJUB 1BC3A 5LOPB 3P7ZA 1DDWA 2ELAA 1AOWA 1DM5A 4HAXB 2R2YA 2OQBA 5C5BB 3HQCA 3N7CA 3PEGA 5DHFB 2YS3A 2EMTA 4HSIA 4HDQA 4KN4X 1BTNA 3A98B 1KI1B 1W1HA 4L6EA 1WGUA 1V5UA 1X05A 1FB8A 1E5WA 2CRFA 2GS0A 2MKRA 3FEHA 2NZ8B 1XODA 5J3QA 3ODWA 2Z0PA 3ANYA 5J3YA 3SNHA 3NSUA 3DXDA 2HTHB 2RNRB
chains in the Genus database with same CATH topology
2D9WA 2LYDA 2DHIA 2Y7BA 3HK0A 5JHGA 1U5FA 2YRYA 3ML4A 4PNKA 3T06A 5DHAB 3SV1A 3MPXA 3TW1A 5DI9B 1DYNA 2P0HA 1X1GA 2YS1A 1ZVRA 1XT0B 1M7RA 4KVGB 2K00A 2CODA 4A6FB 5D27A 4GMXB 2COAA 4Z2MB 3SO6A 4ZRIA 3GYPA 2RLOA 1GC7A 4HHVA 3ULCA 1FHXA 1V61A 4A6KA 5FI0A 2CY4A 1GC6A 4DXAB 1XKEA 1BAKA 4JMOA 3X23A 4IFSA 1TXDA 5JHHA 1BC9A 1ISNA 2BCJA 3VIAA 2IYBA 2J0JA 3P6AA 4H8SA 1AQCA 1OY2A 2ROZB 2I5FA 1AWEA 3TO1A 2CAYA 1WG7A 1K5GB 1V5MA 5FI1A 2RVBB 3VOQA 1XR0B 4Y94A 3FM8C 2Z0OA 4OIYA 3F0WA 5DH9B 2YVCA 3PP2A 4HDOA 4GN1A 3U8ZA 4FQ0C 2D9VA 2DTCA 2DKPA 3PG7A 5C16A 2Q13A 1MAIA 1XD4A 5EFXA 1UNPA 1IRSA 5D3YA 1ZM0A 5DIFB 5KCVA 1FHOA 3SWVA 2VKIA 2DHKA 5KQ1A 1MKEA 1KZGA 4HB4B 4CHMA 2LULA 2GCJA 4F7HA 3L8NA 3BJIA 3PVLA 1BWNA 3SOHB 4MY6A 2RSGA 4BBKA 3D8EA 1ZC3B 3WYFB 1UPQA 1WVHA 1J0WA 4K2PA 2AEHA 2Y8FA 3PVUA 4DBBA 3F5RA 2KCJA 1U5GA 3U7DA 5HE2A 1LKVX 4FHRB 1TQZA 2PZ1A 1U29A 1SHCA 2K6XA 4KMUX 2L1CA 3AU4A 2N23A 1J19A 3ODOA 4Z2NA 4GZUA 1UEFA 1WJ1A 1V89A 1W1GA 1QC6A 3PVWA 2X18A 2YS5A 1N3HA 1B55A 1WJMA 1X11A 3QIJA 4KHBB 5HE1A 4HAYB 2GCLA 5C5BA 1PMSA 2ADZA 3LTLA 4TKNA 2D4QA 2J59M 4YONA 5HE0A 1XX0A 2RGNB 1ZC4B 2MDXA 2LKOA 1MIXA 2HSNA 2UZRA 3DXEA 4KHOA 2QKLA 4KAXB 2K2JA 4HB2B 1RRPB 2D9YA 4ZRKA 3IVFA 1NU2A 2P0FA 4EMOA 3HJLA 1Z87A 2UVMA 4A4PA 1W1DA 3PSCA 4DX90 2I1KA 4EKUA 2I5CA 2EMSA 3DXCA 2Z0QA 1EAZA 1OQNA 2W2XC 3WA0A 4GPTB 2M38A 2J0KA 4DX8A 4IOYX 4A6FA 1UNQA 1Y19B 1GG3A 5CLLB 1P3RA 3FSSA 2DHJA 2D11A 4JK1X 3AU5A 1BTKA 3GYOA 1WI1A 2ROVA 1K5DB 5D3WA 1LW3A 1Q67A 2EJ8A 4L5MA 1TJ6A 4HAZB 3PZDA 4D0NB 4F7GA 4NY0A 2E2XA 1PBVA 4A6HA 4JWLA 2DLWA 2RUKB 3RCPA 4GXBA 3O96A 2MWNB 4MK0A 2H7DA 1QC7A 2M14A 5GOWB 3SYXA 1UPRA 3ODXA 3TW5A 3USWA 2QKMA 2VRWB 4Z21A 1I2HA 2D9XA 1Y5OA 2D9ZA 5C79A 1M7EA 4HB0B 4NSWA 4P7IA 1X1FA 4XWXA 1S9DE 5D3XA 1Q8DA 3KY9A 2UZSA 1RJ2A 3ZVRA 4EJNA 1KZ7A 1XCGA 1H4RA 1LB1A 2DKQA 5D3VA 1R8SE 4JMIA 1DBHA 2DX1A 4C0AA 3D8DA 4WSFA 4HB3B 1ZSQA 3HW2B 2XQNM 2ELBA 2H7EA 4ZRJA 4HATB 1EF1A 2R09A 4HAVB 3USYA 5JLJB 1WGQA 1PFJA 1MK9B 5HE3A 2COCA 3AJCA 1UNRA 2DFKA 2DN6A 3UZTA 3KRWA 5CLQB 2DX5A 4HAWB 5LONB 2W2XD 4TYZA 3ZDTA 2V76A 1H10A 3CXBB 5L81A 2KUPA 4MT7A 4HAUB 1EGXA 3D8FA 3BINA 1R8ME 2L2IA 2W2WA 4K81A 2KGXB 5C6RA 3KRXA 1P6SA 2Y8GA 2YSZA 5KQ4A 1XSZA 2I1JA 4K17A 1V88A 3TCAA 3AJ4A 3V5WA 2EC1A 2IFSA 1FGYA 1SGHA 3KSYA 2G35A 4KHAA 3ULBA 1DROA 3CIKA 4YL8A 2D2QA 4WJ7A 1P5TA 2P0DA 2N0YA 1NI2A 4JXHA 1U2BA 2YT1A 1MK7B 3A8PA 3M1IB 3QWMA 4C7PA 1RE0B 4GMVA 2DYNA 3KZ1A 2AL6A 4A5KA 1MIZB 1MPHA 3MDBC 1U27A 2LG1A 3QBVB 1U5DA 4B6HA 2MFQA 2DYQA 2ZPYA 4CHJA 1U5EA 2LOZA 1FHWA 1R8QE 2LOXA 3G9WA 2D10A 1FOEA 3TVVA 3TFMA 4WVFB 4K2OA 1I7AA 5J3TA 3SUZA 2OTXA 4KN7X 1EVHA 3OANA 1OMWA 1KU1A 1DDVA 1X86A 2DA0A 3LJUX 1NTVA 4D7QA 2P8VA 1FAOA 5JP4A 2YF0A 4F7UP 1V5PA 2J0MA 2FJLA 3A8QA 2R0DA 2VSZA 2HE7A 4D7RA 4PQ0A 1QQGA 1PLSA 1DDMA 4CYEA 1NTYA 2NMBA 2COFA 2YT0A 1FGZA 4IAPA 2JP2A 2GJYA 2CY5A 2K2UA 5LOPB 3P7ZA 1DDWA 2ELAA 4HAXB 2OQBA 5C5BB 3HQCA 3N7CA 3PEGA 5DHFB 2YS3A 2EMTA 4HDQA 4KN4X 1BTNA 3A98B 1KI1B 1W1HA 4L6EA 1WGUA 1V5UA 1X05A 1FB8A 1E5WA 2CRFA 2GS0A 2MKRA 3FEHA 2NZ8B 1XODA 5J3QA 3ODWA 2Z0PA 5J3YA 3SNHA 3NSUA 3DXDA 2HTHB 2RNRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9W A;  2LYD A;  2DHI A;  2Y7B A;  3HK0 A;  5JHG A;  1U5F A;  2YRY A;  3ML4 A;  4PNK A;  3T06 A;  5DHA B;  3SV1 A;  3MPX A;  3TW1 A;  5DI9 B;  1DYN A;  2P0H A;  1X1G A;  2YS1 A;  1ZVR A;  1XT0 B;  1M7R A;  4KVG B;  2K00 A;  2COD A;  4A6F B;  5D27 A;  4GMX B;  2COA A;  4Z2M B;  3SO6 A;  4ZRI A;  3GYP A;  2RLO A;  1GC7 A;  4HHV A;  3ULC A;  1FHX A;  1V61 A;  4A6K A;  5FI0 A;  2CY4 A;  1GC6 A;  4DXA B;  1XKE A;  1BAK A;  4JMO A;  3X23 A;  4IFS A;  1TXD A;  5JHH A;  1BC9 A;  1ISN A;  2BCJ A;  3VIA A;  2IYB A;  2J0J A;  3P6A A;  4H8S A;  1AQC A;  1OY2 A;  2ROZ B;  2I5F A;  1AWE A;  3TO1 A;  2CAY A;  1WG7 A;  1K5G B;  1V5M A;  5FI1 A;  2RVB B;  3VOQ A;  1XR0 B;  4Y94 A;  3FM8 C;  2Z0O A;  4OIY A;  3F0W A;  5DH9 B;  2YVC A;  3PP2 A;  4HDO A;  4GN1 A;  3U8Z A;  2D9V A;  2DTC A;  2DKP A;  3PG7 A;  5C16 A;  2Q13 A;  1MAI A;  1XD4 A;  5EFX A;  1UNP A;  1IRS A;  5D3Y A;  1ZM0 A;  5DIF B;  5KCV A;  1FHO A;  3SWV A;  2VKI A;  2DHK A;  5KQ1 A;  1MKE A;  1KZG A;  4HB4 B;  4CHM A;  2LUL A;  2GCJ A;  4F7H A;  3L8N A;  3BJI A;  3PVL A;  1BWN A;  4MY6 A;  2RSG A;  4BBK A;  3D8E A;  1ZC3 B;  3WYF B;  1UPQ A;  1WVH A;  1J0W A;  4K2P A;  2AEH A;  2Y8F A;  3PVU A;  4DBB A;  3F5R A;  2KCJ A;  1U5G A;  3U7D A;  5HE2 A;  1TQZ A;  2PZ1 A;  1U29 A;  1SHC A;  2L1C A;  3AU4 A;  2N23 A;  1J19 A;  3ODO A;  4Z2N A;  4GZU A;  1UEF A;  1WJ1 A;  1V89 A;  1W1G A;  1QC6 A;  3PVW A;  2X18 A;  2YS5 A;  1N3H A;  1B55 A;  1WJM A;  1X11 A;  3QIJ A;  4KHB B;  5HE1 A;  4HAY B;  2GCL A;  5C5B A;  1PMS A;  2ADZ A;  3LTL A;  4TKN A;  2D4Q A;  2J59 M;  4YON A;  5HE0 A;  1XX0 A;  2RGN B;  1ZC4 B;  2MDX A;  2LKO A;  1MIX A;  3DXE A;  2UZR A;  4KHO A;  2QKL A;  4KAX B;  2K2J A;  4HB2 B;  1RRP B;  2D9Y A;  4ZRK A;  3IVF A;  1NU2 A;  2P0F A;  4EMO A;  1Z87 A;  2UVM A;  4A4P A;  1W1D A;  3PSC A;  4DX9 0;  2I1K A;  4EKU A;  2I5C A;  2EMS A;  3DXC A;  2Z0Q A;  1EAZ A;  1OQN A;  2W2X C;  3WA0 A;  4GPT B;  2M38 A;  2J0K A;  4DX8 A;  4IOY X;  4A6F A;  1UNQ A;  1Y19 B;  1GG3 A;  5CLL B;  1P3R A;  3FSS A;  2DHJ A;  2D11 A;  3AU5 A;  3GYO A;  1BTK A;  1WI1 A;  2ROV A;  1K5D B;  5D3W A;  1LW3 A;  1Q67 A;  2EJ8 A;  4L5M A;  1TJ6 A;  4HAZ B;  3PZD A;  4D0N B;  4F7G A;  4NY0 A;  2E2X A;  1PBV A;  4A6H A;  4JWL A;  2DLW A;  2RUK B;  3RCP A;  4GXB A;  3O96 A;  2MWN B;  4MK0 A;  2H7D A;  2M14 A;  5GOW B;  3SYX A;  1UPR A;  3ODX A;  2QKM A;  2VRW B;  4Z21 A;  1I2H A;  2D9X A;  1Y5O A;  2D9Z A;  5C79 A;  1M7E A;  4HB0 B;  4NSW A;  4P7I A;  1X1F A;  4XWX A;  1S9D E;  5D3X A;  3KY9 A;  2UZS A;  1RJ2 A;  3ZVR A;  4EJN A;  1KZ7 A;  1XCG A;  1H4R A;  1LB1 A;  2DKQ A;  5D3V A;  1R8S E;  4JMI A;  1DBH A;  2DX1 A;  4C0A A;  3D8D A;  4WSF A;  4HB3 B;  1ZSQ A;  3HW2 B;  2XQN M;  2ELB A;  2H7E A;  4ZRJ A;  4HAT B;  1EF1 A;  2R09 A;  4HAV B;  5JLJ B;  1WGQ A;  1PFJ A;  1MK9 B;  5HE3 A;  2COC A;  1UNR A;  2DFK A;  2DN6 A;  3UZT A;  3KRW A;  5CLQ B;  2DX5 A;  4HAW B;  5LON B;  2W2X D;  4TYZ A;  3ZDT A;  2V76 A;  1H10 A;  3CXB B;  5L81 A;  2KUP A;  4MT7 A;  4HAU B;  1EGX A;  3D8F A;  3BIN A;  1R8M E;  2L2I A;  2W2W A;  4K81 A;  2KGX B;  5C6R A;  3KRX A;  1P6S A;  2Y8G A;  2YSZ A;  5KQ4 A;  1XSZ A;  2I1J A;  4K17 A;  1V88 A;  3TCA A;  3AJ4 A;  3V5W A;  2EC1 A;  2IFS A;  1FGY A;  1SGH A;  3KSY A;  2G35 A;  4KHA A;  3ULB A;  1DRO A;  3CIK A;  4YL8 A;  2D2Q A;  4WJ7 A;  1P5T A;  2P0D A;  2N0Y A;  1NI2 A;  4JXH A;  1U2B A;  2YT1 A;  1MK7 B;  3A8P A;  3M1I B;  3QWM A;  4C7P A;  1RE0 B;  4GMV A;  2DYN A;  3KZ1 A;  2AL6 A;  4A5K A;  1MIZ B;  1MPH A;  3MDB C;  1U27 A;  2LG1 A;  3QBV B;  1U5D A;  4B6H A;  2MFQ A;  2DYQ A;  2ZPY A;  4CHJ A;  1U5E A;  2LOZ A;  1FHW A;  1R8Q E;  2LOX A;  3G9W A;  2D10 A;  1FOE A;  3TVV A;  3TFM A;  4WVF B;  4K2O A;  1I7A A;  5J3T A;  3SUZ A;  2OTX A;  1EVH A;  3OAN A;  1OMW A;  1KU1 A;  1DDV A;  1X86 A;  2DA0 A;  3LJU X;  1NTV A;  4D7Q A;  2P8V A;  1FAO A;  5JP4 A;  2YF0 A;  4F7U P;  1V5P A;  2J0M A;  2FJL A;  3A8Q A;  2R0D A;  2VSZ A;  2HE7 A;  4D7R A;  4PQ0 A;  1QQG A;  1PLS A;  1DDM A;  4CYE A;  1NTY A;  2NMB A;  2COF A;  2YT0 A;  1FGZ A;  4IAP A;  2JP2 A;  2GJY A;  2CY5 A;  2K2U A;  5LOP B;  3P7Z A;  1DDW A;  2ELA A;  4HAX B;  2OQB A;  5C5B B;  3HQC A;  3N7C A;  3PEG A;  5DHF B;  2YS3 A;  2EMT A;  4HDQ A;  1BTN A;  3A98 B;  1KI1 B;  1W1H A;  4L6E A;  1WGU A;  1V5U A;  1X05 A;  1FB8 A;  1E5W A;  2CRF A;  2GS0 A;  2MKR A;  3FEH A;  2NZ8 B;  1XOD A;  5J3Q A;  3ODW A;  2Z0P A;  5J3Y A;  3SNH A;  3NSU A;  3DXD A;  2HTH B;  2RNR B; 
#chains in the Genus database with same CATH topology
 2D9W A;  2LYD A;  1A8B A;  2DHI A;  2Y7B A;  3HK0 A;  5JHG A;  1U5F A;  2H0K A;  2NBV A;  2YRY A;  3ML4 A;  4PNK A;  3T06 A;  5DHA B;  3SV1 A;  4X9P A;  3MPX A;  2II2 A;  2QEZ A;  3TW1 A;  5DI9 B;  1DYN A;  2P0H A;  5IRS A;  1X1G A;  2YS1 A;  1ZVR A;  1XT0 B;  1M7R A;  1G5N A;  4KVG B;  2K00 A;  2COD A;  4A6F B;  2Z4D A;  5D27 A;  4GMX B;  2COA A;  2XO3 A;  4Z2M B;  3SO6 A;  4ZRI A;  3GYP A;  2RLO A;  1GC7 A;  4HHV A;  3ULC A;  1HVG A;  1N42 A;  1FHX A;  1V61 A;  4A6K A;  3A58 A;  2CY4 A;  5FI0 A;  1GC6 A;  5I2M A;  4DXA B;  1XKE A;  2K49 A;  1BAK A;  4JMO A;  3X23 A;  4IFS A;  1TXD A;  5JHH A;  1BC9 A;  1YJ0 A;  1ISN A;  2KIE A;  2BCJ A;  2IE6 A;  2RRF A;  2IYB A;  3VIA A;  2J0J A;  3P6A A;  4H8S A;  1AQC A;  1OY2 A;  2ROZ B;  2I5F A;  1AWE A;  1UPT B;  3TO1 A;  2CAY A;  1WG7 A;  1K5G B;  1V5M A;  4EVF A;  5FI1 A;  1BCY A;  2RVB B;  1W7B A;  3VOQ A;  1XR0 B;  4Y94 A;  3FM8 C;  2Z0O A;  1ANX A;  4OIY A;  3F0W A;  5DH9 B;  2YVC A;  3PP2 A;  4HDO A;  4GN1 A;  3U8Z A;  4FQ0 C;  2D9V A;  2DTC A;  2DKP A;  1T77 A;  3PG7 A;  5C16 A;  2Q13 A;  1MAI A;  1XD4 A;  5EFX A;  1A8A A;  1UNP A;  1IRS A;  5D3Y A;  1ZM0 A;  5DIF B;  1BCW A;  5KCV A;  1FHO A;  3SWV A;  2VKI A;  3NWD A;  2DHK A;  5KQ1 A;  1SAV A;  1MKE A;  1KZG A;  4HB4 B;  4CHM A;  2LUL A;  4D6W A;  2GCJ A;  4F7H A;  3L8N A;  3BJI A;  3PVL A;  1BWN A;  3SOH B;  4MY6 A;  2RSG A;  4BBK A;  3D8E A;  1ZC3 B;  3WYF B;  1UPQ A;  1WVH A;  1J0W A;  4K2P A;  2AEH A;  2Y8F A;  3PVU A;  1M9I A;  4DBB A;  3F5R A;  2KCJ A;  3U12 A;  1U5G A;  3U7D A;  1R4A E;  5HE2 A;  1LKV X;  3HIE A;  4FHR B;  1TQZ A;  1ANW A;  2PZ1 A;  1U29 A;  1SHC A;  2K6X A;  4KMU X;  2L1C A;  3AU4 A;  2N23 A;  1J19 A;  3ODO A;  4Z2N A;  4GZU A;  1UEF A;  1WJ1 A;  1V89 A;  1W1G A;  1QC6 A;  3PVW A;  2X18 A;  2YS5 A;  2YT2 A;  1N3H A;  1B55 A;  1WJM A;  1X11 A;  3QIJ A;  4KHB B;  5HE1 A;  4HAY B;  2GCL A;  5C5B A;  1PMS A;  2ADZ A;  3LTL A;  4TKN A;  2D4Q A;  2J59 M;  4YON A;  5HE0 A;  1XX0 A;  2ZKM X;  2RGN B;  1ZC4 B;  1HVF A;  2MDX A;  2LKO A;  3NWF A;  1MIX A;  2HSN A;  2UZR A;  3DXE A;  4KHO A;  2QKL A;  4KAX B;  2K2J A;  1HVD A;  4HB2 B;  1RRP B;  1I4A A;  2D9Y A;  4ZRK A;  3IVF A;  1BC1 A;  1NU2 A;  4QJ4 B;  1BO9 A;  2P0F A;  4CSQ A;  4EMO A;  3HJL A;  1Z87 A;  2UVM A;  4A4P A;  1W1D A;  3PSC A;  4DX9 0;  2I1K A;  1HVE A;  4EKU A;  2I5C A;  2EMS A;  1AVR A;  3DXC A;  2Z0Q A;  5LG4 B;  1EAZ A;  1OQN A;  2W2X C;  2KIG A;  2IIC A;  3WA0 A;  4GPT B;  2M38 A;  2J0K A;  4OSN A;  1BC0 A;  4DX8 A;  4IOY X;  4A6F A;  2Z14 A;  1UNQ A;  1Y19 B;  1GG3 A;  5CLL B;  1AEI A;  1HM6 A;  1P3R A;  4QXA B;  3FSS A;  2DHJ A;  2D11 A;  4JK1 X;  3AU5 A;  1BTK A;  3GYO A;  1WI1 A;  2ROV A;  4L1R A;  1K5D B;  5D3W A;  1LW3 A;  1Q67 A;  2EJ8 A;  4L5M A;  1TJ6 A;  4HAZ B;  3PZD A;  4D0N B;  1DK5 A;  2Q4C A;  4F7G A;  4HRE A;  4NY0 A;  2E2X A;  2RAN A;  3BRX A;  1PBV A;  4A6H A;  4JWL A;  2HYU A;  1W3W A;  2DLW A;  2RUK B;  4GXB A;  3RCP A;  3O96 A;  2MWN B;  4MK0 A;  2H7D A;  1QC7 A;  2M14 A;  2K8E A;  5GOW B;  3SYX A;  1AII A;  1UPR A;  3ODX A;  3TW5 A;  3USW A;  2ZHJ A;  2QKM A;  4DIX A;  2VRW B;  4Z21 A;  1I2H A;  2D9X A;  1Y5O A;  2D9Z A;  5C79 A;  1HAK A;  1M7E A;  4HB0 B;  4NSW A;  1AXN A;  4P7I A;  1X1F A;  4XWX A;  1S9D E;  5D3X A;  1Q8D A;  3KY9 A;  2UZS A;  2H0M A;  1RJ2 A;  1MCX A;  5M4Y B;  3ZVR A;  4EJN A;  1KZ7 A;  1XCG A;  1H4R A;  1LB1 A;  2HYW A;  2VXG A;  4QJ3 B;  1ANN A;  2DKQ A;  5D3V A;  2IE7 A;  1R8S E;  4JMI A;  1DBH A;  2DX1 A;  4C0A A;  3D8D A;  3OHM B;  1XJL A;  4WSF A;  4HB3 B;  2HYV A;  1ALA A;  1ZSQ A;  3HW2 B;  2XQN M;  2ELB A;  2H7E A;  2Z13 A;  1W45 A;  4ZRJ A;  4HAT B;  1EF1 A;  1N44 A;  2R09 A;  1N00 A;  4HAV B;  3USY A;  5JLJ B;  1WGQ A;  4GNK B;  1PFJ A;  1MK9 B;  5HE3 A;  2COC A;  3AJC A;  1UNR A;  2DFK A;  2DN6 A;  3UZT A;  3KRW A;  5CLQ B;  2DX5 A;  4HAW B;  5LON B;  4MDV A;  1BCZ A;  2W2X D;  3FVC A;  4TYZ A;  3ZDT A;  2KR0 A;  2V76 A;  1C1K A;  1H10 A;  3CXB B;  5L81 A;  2KUP A;  1MI1 A;  4HAU B;  4MT7 A;  1EGX A;  3D8F A;  1YGM A;  3BIN A;  1R8M E;  2L2I A;  2W2W A;  4K81 A;  4GOU A;  1AVH A;  2KGX B;  5C6R A;  3KRX A;  1P6S A;  4QJ5 B;  2Y8G A;  2YSZ A;  5KQ4 A;  1XSZ A;  2I1J A;  2KUQ A;  4K17 A;  2H0L A;  1V88 A;  3TCA A;  3AJ4 A;  3V5W A;  2EC1 A;  2IFS A;  3DCX A;  1FGY A;  1SGH A;  4KHB A;  3KSY A;  2G35 A;  4KHA A;  3HSA A;  3ULB A;  3AO0 A;  3CIK A;  4YL8 A;  2D2Q A;  1DRO A;  4WJ7 A;  1P5T A;  2P0D A;  2N0Y A;  1NI2 A;  4JXH A;  1U2B A;  2YT1 A;  1MK7 B;  3ABS A;  3A8P A;  3M1I B;  3QWM A;  4C7P A;  3NW8 A;  1RE0 B;  4GMV A;  2DYN A;  3ABO A;  3KZ1 A;  1AVC A;  2AL6 A;  4A5K A;  4OT1 A;  4EVH A;  1MIZ B;  2XO2 A;  1MPH A;  3MDB C;  1U27 A;  2LG1 A;  3QBV B;  1ZYI A;  1U5D A;  4B6H A;  2MFQ A;  4MDU A;  2DYQ A;  2ZPY A;  4CHJ A;  1U5E A;  2LOZ A;  1FHW A;  1R8Q E;  2LOX A;  1N41 A;  3G9W A;  2D10 A;  1FOE A;  3TVV A;  3TFM A;  4WVF B;  4K2O A;  1I7A A;  5J3T A;  3SUZ A;  2OTX A;  4KN7 X;  1EVH A;  3OAN A;  1OMW A;  1KU1 A;  1DDV A;  1X86 A;  2DA0 A;  3LJU X;  1NTV A;  4D7Q A;  2P8V A;  3ABR A;  1YCN A;  1FAO A;  5JP4 A;  3NWA A;  2GUM A;  1YII A;  2YF0 A;  3B77 A;  4F7U P;  2ZHI A;  1V5P A;  2J0M A;  2FJL A;  2OY9 A;  3A8Q A;  2Z59 A;  2R0D A;  2VSZ A;  2HE7 A;  4D7R A;  4PQ0 A;  1QQG A;  3ABQ A;  1PLS A;  1DDM A;  4CYE A;  2ZOC A;  1NTY A;  2NMB A;  2COF A;  4Q2S A;  5I2S A;  2YT0 A;  1FGZ A;  4IAP A;  2JP2 A;  2GJY A;  2CY5 A;  2K2U A;  2FJU B;  1BC3 A;  5LOP B;  3P7Z A;  1DDW A;  2ELA A;  1AOW A;  1DM5 A;  4HAX B;  2R2Y A;  2OQB A;  5C5B B;  3HQC A;  3N7C A;  3PEG A;  5DHF B;  2YS3 A;  2EMT A;  4HSI A;  4HDQ A;  4KN4 X;  1BTN A;  3A98 B;  1KI1 B;  1W1H A;  4L6E A;  1WGU A;  1V5U A;  1X05 A;  1FB8 A;  1E5W A;  2CRF A;  2GS0 A;  2MKR A;  3FEH A;  2NZ8 B;  1XOD A;  5J3Q A;  3ODW A;  2Z0P A;  3ANY A;  5J3Y A;  3SNH A;  3NSU A;  3DXD A;  2HTH B;  2RNR B; 
#chains in the Genus database with same CATH homology
 2D9W A;  2LYD A;  2DHI A;  2Y7B A;  3HK0 A;  5JHG A;  1U5F A;  2YRY A;  3ML4 A;  4PNK A;  3T06 A;  5DHA B;  3SV1 A;  3MPX A;  3TW1 A;  5DI9 B;  1DYN A;  2P0H A;  1X1G A;  2YS1 A;  1ZVR A;  1XT0 B;  1M7R A;  4KVG B;  2K00 A;  2COD A;  4A6F B;  5D27 A;  4GMX B;  2COA A;  4Z2M B;  3SO6 A;  4ZRI A;  3GYP A;  2RLO A;  1GC7 A;  4HHV A;  3ULC A;  1FHX A;  1V61 A;  4A6K A;  5FI0 A;  2CY4 A;  1GC6 A;  4DXA B;  1XKE A;  1BAK A;  4JMO A;  3X23 A;  4IFS A;  1TXD A;  5JHH A;  1BC9 A;  1ISN A;  2BCJ A;  3VIA A;  2IYB A;  2J0J A;  3P6A A;  4H8S A;  1AQC A;  1OY2 A;  2ROZ B;  2I5F A;  1AWE A;  3TO1 A;  2CAY A;  1WG7 A;  1K5G B;  1V5M A;  5FI1 A;  2RVB B;  3VOQ A;  1XR0 B;  4Y94 A;  3FM8 C;  2Z0O A;  4OIY A;  3F0W A;  5DH9 B;  2YVC A;  3PP2 A;  4HDO A;  4GN1 A;  3U8Z A;  4FQ0 C;  2D9V A;  2DTC A;  2DKP A;  3PG7 A;  5C16 A;  2Q13 A;  1MAI A;  1XD4 A;  5EFX A;  1UNP A;  1IRS A;  5D3Y A;  1ZM0 A;  5DIF B;  5KCV A;  1FHO A;  3SWV A;  2VKI A;  2DHK A;  5KQ1 A;  1MKE A;  1KZG A;  4HB4 B;  4CHM A;  2LUL A;  2GCJ A;  4F7H A;  3L8N A;  3BJI A;  3PVL A;  1BWN A;  3SOH B;  4MY6 A;  2RSG A;  4BBK A;  3D8E A;  1ZC3 B;  3WYF B;  1UPQ A;  1WVH A;  1J0W A;  4K2P A;  2AEH A;  2Y8F A;  3PVU A;  4DBB A;  3F5R A;  2KCJ A;  1U5G A;  3U7D A;  5HE2 A;  1LKV X;  4FHR B;  1TQZ A;  2PZ1 A;  1U29 A;  1SHC A;  2K6X A;  4KMU X;  2L1C A;  3AU4 A;  2N23 A;  1J19 A;  3ODO A;  4Z2N A;  4GZU A;  1UEF A;  1WJ1 A;  1V89 A;  1W1G A;  1QC6 A;  3PVW A;  2X18 A;  2YS5 A;  1N3H A;  1B55 A;  1WJM A;  1X11 A;  3QIJ A;  4KHB B;  5HE1 A;  4HAY B;  2GCL A;  5C5B A;  1PMS A;  2ADZ A;  3LTL A;  4TKN A;  2D4Q A;  2J59 M;  4YON A;  5HE0 A;  1XX0 A;  2RGN B;  1ZC4 B;  2MDX A;  2LKO A;  1MIX A;  2HSN A;  2UZR A;  3DXE A;  4KHO A;  2QKL A;  4KAX B;  2K2J A;  4HB2 B;  1RRP B;  2D9Y A;  4ZRK A;  3IVF A;  1NU2 A;  2P0F A;  4EMO A;  3HJL A;  1Z87 A;  2UVM A;  4A4P A;  1W1D A;  3PSC A;  4DX9 0;  2I1K A;  4EKU A;  2I5C A;  2EMS A;  3DXC A;  2Z0Q A;  1EAZ A;  1OQN A;  2W2X C;  3WA0 A;  4GPT B;  2M38 A;  2J0K A;  4DX8 A;  4IOY X;  4A6F A;  1UNQ A;  1Y19 B;  1GG3 A;  5CLL B;  1P3R A;  3FSS A;  2DHJ A;  2D11 A;  4JK1 X;  3AU5 A;  1BTK A;  3GYO A;  1WI1 A;  2ROV A;  1K5D B;  5D3W A;  1LW3 A;  1Q67 A;  2EJ8 A;  4L5M A;  1TJ6 A;  4HAZ B;  3PZD A;  4D0N B;  4F7G A;  4NY0 A;  2E2X A;  1PBV A;  4A6H A;  4JWL A;  2DLW A;  2RUK B;  3RCP A;  4GXB A;  3O96 A;  2MWN B;  4MK0 A;  2H7D A;  1QC7 A;  2M14 A;  5GOW B;  3SYX A;  1UPR A;  3ODX A;  3TW5 A;  3USW A;  2QKM A;  2VRW B;  4Z21 A;  1I2H A;  2D9X A;  1Y5O A;  2D9Z A;  5C79 A;  1M7E A;  4HB0 B;  4NSW A;  4P7I A;  1X1F A;  4XWX A;  1S9D E;  5D3X A;  1Q8D A;  3KY9 A;  2UZS A;  1RJ2 A;  3ZVR A;  4EJN A;  1KZ7 A;  1XCG A;  1H4R A;  1LB1 A;  2DKQ A;  5D3V A;  1R8S E;  4JMI A;  1DBH A;  2DX1 A;  4C0A A;  3D8D A;  4WSF A;  4HB3 B;  1ZSQ A;  3HW2 B;  2XQN M;  2ELB A;  2H7E A;  4ZRJ A;  4HAT B;  1EF1 A;  2R09 A;  4HAV B;  3USY A;  5JLJ B;  1WGQ A;  1PFJ A;  1MK9 B;  5HE3 A;  2COC A;  3AJC A;  1UNR A;  2DFK A;  2DN6 A;  3UZT A;  3KRW A;  5CLQ B;  2DX5 A;  4HAW B;  5LON B;  2W2X D;  4TYZ A;  3ZDT A;  2V76 A;  1H10 A;  3CXB B;  5L81 A;  2KUP A;  4MT7 A;  4HAU B;  1EGX A;  3D8F A;  3BIN A;  1R8M E;  2L2I A;  2W2W A;  4K81 A;  2KGX B;  5C6R A;  3KRX A;  1P6S A;  2Y8G A;  2YSZ A;  5KQ4 A;  1XSZ A;  2I1J A;  4K17 A;  1V88 A;  3TCA A;  3AJ4 A;  3V5W A;  2EC1 A;  2IFS A;  1FGY A;  1SGH A;  3KSY A;  2G35 A;  4KHA A;  3ULB A;  1DRO A;  3CIK A;  4YL8 A;  2D2Q A;  4WJ7 A;  1P5T A;  2P0D A;  2N0Y A;  1NI2 A;  4JXH A;  1U2B A;  2YT1 A;  1MK7 B;  3A8P A;  3M1I B;  3QWM A;  4C7P A;  1RE0 B;  4GMV A;  2DYN A;  3KZ1 A;  2AL6 A;  4A5K A;  1MIZ B;  1MPH A;  3MDB C;  1U27 A;  2LG1 A;  3QBV B;  1U5D A;  4B6H A;  2MFQ A;  2DYQ A;  2ZPY A;  4CHJ A;  1U5E A;  2LOZ A;  1FHW A;  1R8Q E;  2LOX A;  3G9W A;  2D10 A;  1FOE A;  3TVV A;  3TFM A;  4WVF B;  4K2O A;  1I7A A;  5J3T A;  3SUZ A;  2OTX A;  4KN7 X;  1EVH A;  3OAN A;  1OMW A;  1KU1 A;  1DDV A;  1X86 A;  2DA0 A;  3LJU X;  1NTV A;  4D7Q A;  2P8V A;  1FAO A;  5JP4 A;  2YF0 A;  4F7U P;  1V5P A;  2J0M A;  2FJL A;  3A8Q A;  2R0D A;  2VSZ A;  2HE7 A;  4D7R A;  4PQ0 A;  1QQG A;  1PLS A;  1DDM A;  4CYE A;  1NTY A;  2NMB A;  2COF A;  2YT0 A;  1FGZ A;  4IAP A;  2JP2 A;  2GJY A;  2CY5 A;  2K2U A;  5LOP B;  3P7Z A;  1DDW A;  2ELA A;  4HAX B;  2OQB A;  5C5B B;  3HQC A;  3N7C A;  3PEG A;  5DHF B;  2YS3 A;  2EMT A;  4HDQ A;  4KN4 X;  1BTN A;  3A98 B;  1KI1 B;  1W1H A;  4L6E A;  1WGU A;  1V5U A;  1X05 A;  1FB8 A;  1E5W A;  2CRF A;  2GS0 A;  2MKR A;  3FEH A;  2NZ8 B;  1XOD A;  5J3Q A;  3ODW A;  2Z0P A;  5J3Y A;  3SNH A;  3NSU A;  3DXD A;  2HTH B;  2RNR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...