2R0DA

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
343
structure length
343
Chain Sequence
b'GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytohesin-3
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 114
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r0dA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r0dA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r0dA03
2P0FA 2GS0A 1WGUA 3T06A 2UZSA 4A5KA 1MKEA 2GCLA 1WVHA 3GYPA 1NI2A 5D3XA 1V61A 1KI1B 1SHCA 2D9XA 5J3QA 1M7EA 3DXCA 1Q67A 2R0DA 1XODA 3HW2B 4HAZB 1KU1A 4P7IA 5JHHA 5DH9B 4HB4B 4BBKA 5KQ4A 5DIFB 2G35A 2BCJA 2KGXB 4ZRJA 4HB2B 1DYNA 4ZRKA 1U2BA 2QKLA 3NSUA 2E2XA 2QKMA 1TXDA 2DHJA 1BAKA 2ZPYA 2VRWB 2N0YA 2UZRA 4EMOA 2MWNB 3ZDTA 1XD4A 1BTNA 1BC9A 1X05A 1R8SE 3VIAA 5C16A 4D7QA 3SO6A 4KVGB 4HDQA 3HQCA 2COAA 2CODA 2VKIA 1ZC3B 3D8FA 1PMSA 2D9ZA 5JP4A 1FB8A 3WYFB 1LW3A 4Z21A 1U5EA 5DHAB 3KZ1A 3ML4A 1XT0B 1MAIA 2HE7A 2COFA 3QIJA 1X1FA 3KY9A 4JXHA 4XWXA 2D4QA 4D7RA 2RUKB 2Y8GA 1MPHA 4F7HA 1XR0B 4L5MA 3FEHA 1U5GA 3TO1A 1H4RA 2K2UA 3DXEA 2W2XD 4DX90 1FHOA 1DROA 2Y7BA 2K00A 1RJ2A 3RCPA 3SNHA 5C79A 1GC6A 1QQGA 2I1JA 5GOWB 1P3RA 2Z0QA 1S9DE 5LONB 2AL6A 5FI1A 3KSYA 3F0WA 2J0MA 1DBHA 1DDWA 1B55A 1U5DA 2DTCA 2W2WA 5D3YA 1WJ1A 4TYZA 4F7GA 1UNQA 2FJLA 4YONA 2DYNA 4WVFB 5D3VA 5KCVA 1XSZA 2D10A 3A8QA 3LJUX 3D8EA 2LULA 1H10A 1ZVRA 3OANA 1KZGA 2D2QA 4GZUA 2YT0A 2RNRB 1R8QE 1PBVA 1FGYA 1OY2A 1IRSA 1U27A 3PP2A 4JWLA 5EFXA 1WGQA 3TFMA 2KCJA 5D27A 1V89A 2EC1A 4HDOA 1DDMA 4HAUB 2D11A 5JLJB 2D9YA 1Y5OA 4K81A 2Y8FA 3SV1A 1K5DB 3AJ4A 4K2PA 4DXAB 2I1KA 2RGNB 2CRFA 2IFSA 1Y19B 5CLLB 4EJNA 3TW1A 3MDBC 1ZSQA 1W1GA 1TQZA 4NY0A 2DKPA 4ZRIA 2DHKA 2EJ8A 3QBVB 2N23A 3PVLA 3UZTA 4MT7A 1OQNA 1LB1A 1MK9B 3PZDA 5HE1A 4D0NB 3CIKA 1ZC4B 2ADZA 3WA0A 1I7AA 1FHXA 2DYQA 1DDVA 1UNRA 2Z0OA 4K2OA 1XKEA 1W1DA 2MDXA 3TVVA 5HE2A 3D8DA 1SGHA 2DLWA 2V76A 2HTHB 1TJ6A 1ZM0A 4KHOA 1FAOA 4C0AA 1EVHA 4H8SA 4MY6A 2DX5A 3V5WA 4A6KA 2M38A 1AQCA 1K5GB 2RVBB 2MFQA 2D9WA 1R8ME 1EF1A 1PLSA 4CYEA 4DBBA 3A98B 4F7UP 3LTLA 2M14A 2J0JA 1AWEA 1FGZA 1WI1A 4TKNA 4C7PA 3BINA 4DX8A 2KUPA 3KRXA 1NU2A 4MK0A 2GJYA 3P6AA 2YS3A 1XCGA 3SWVA 1UPQA 3O96A 4HATB 2P0DA 1N3HA 4Y94A 1V5MA 3ULBA 2Q13A 3BJIA 3PVWA 4CHJA 1EGXA 1MK7B 5JHGA 2J0KA 1GC7A 5HE0A 1U5FA 2YS1A 5DHFB 1W1HA 2I5CA 5C5BB 4A4PA 2LKOA 3AU4A 3G9WA 1RRPB 2DHIA 3X23A 3P7ZA 1UNPA 3U7DA 3SYXA 2DFKA 5C6RA 1X1GA 1NTYA 2GCJA 4JMIA 1V5UA 1NTVA 1Z87A 2YS5A 2ELAA 4B6HA 1QC6A 2J59M 2H7DA 4HB3B 2NZ8B 1X11A 2LYDA 4A6FB 1MIZB 3N7CA 4A6FA 2CY4A 2ROZB 2XQNM 2OTXA 1UEFA 2PZ1A 3A8PA 5J3TA 3ODOA 2LG1A 2DN6A 3FSSA 1M7RA 2IYBA 4IOYX 3GYOA 3L8NA 2CY5A 2RSGA 4KAXB 3KRWA 5L81A 4K17A 2LOZA 2L1CA 2RLOA 2L2IA 3FM8C 1OMWA 4KHBB 2EMSA 1XX0A 4JMOA 4L6EA 5FI0A 1J19A 1WJMA 4GXBA 2YT1A 4EKUA 4YL8A 1ISNA 2UVMA 1FHWA 2EMTA 3CXBB 3DXDA 2P0HA 4HAXB 4HB0B 1GG3A 3PEGA 1P5TA 2COCA 5HE3A 2YF0A 3PG7A 3F5RA 3AU5A 4IFSA 1X86A 3HK0A 3M1IB 2R09A 4PQ0A 2NMBA 3ODXA 4WSFA 2LOXA 4A6HA 3TCAA 1I2HA 5J3YA 3VOQA 2ELBA 5DI9B 4HAVB 4HAWB 1WG7A 1J0WA 2JP2A 2I5FA 2MKRA 2CAYA 2YVCA 3ULCA 2YSZA 2X18A 3IVFA 1FOEA 4HHVA 4OIYA 4GN1A 2VSZA 3PSCA 2DA0A 1U29A 4GMXB 4NSWA 4WJ7A 5KQ1A 1MIXA 2K2JA 2ROVA 1RE0B 2YRYA 5LOPB 2OQBA 2D9VA 3SUZA 1EAZA 2H7EA 4GMVA 1V88A 4GPTB 2DKQA 1KZ7A 3U8ZA 3QWMA 2AEHA 2Z0PA 4KHAA 1E5WA 2P8VA 4Z2NA 3ZVRA 3ODWA 1P6SA 1V5PA 4HAYB 5C5BA 1BTKA 3MPXA 3PVUA 4CHMA 4PNKA 2DX1A 5D3WA 1PFJA 4Z2MB 1UPRA 5CLQB 4IAPA 1BWNA 2W2XC
chains in the Genus database with same CATH superfamily
2P0FA 2GS0A 1WGUA 3T06A 2UZSA 4MDUA 4A5KA 1MKEA 2GCLA 3HIEA 1WVHA 3GYPA 1NI2A 5D3XA 4X9PA 3HJLA 1V61A 1KI1B 1SHCA 2D9XA 5J3QA 3ABRA 1M7EA 3DXCA 1Q67A 2R0DA 1XODA 3HW2B 4HAZB 1KU1A 4P7IA 5JHHA 2K6XA 5DH9B 4HB4B 4JK1X 4BBKA 1W45A 4KN7X 5KQ4A 2ZHIA 5DIFB 2G35A 2RANA 2KIGA 1G5NA 1AEIA 2BCJA 2KGXB 4ZRJA 1A8AA 1DYNA 4HB2B 4ZRKA 1YGMA 1U2BA 1DM5A 2QKLA 3NSUA 2E2XA 2QKMA 1TXDA 2DHJA 1BAKA 3U12A 2ZPYA 2VRWB 2N0YA 2UZRA 2IE7A 4EMOA 2MWNB 3ZDTA 1XD4A 1BTNA 1BC9A 1X05A 1R8SE 3VIAA 5C16A 4D7QA 3SO6A 4KVGB 1W3WA 4HDQA 3HQCA 2COAA 2CODA 2VKIA 1ZC3B 3D8FA 1HVGA 1PMSA 2D9ZA 5JP4A 1FB8A 3WYFB 1LW3A 4Z21A 3USYA 1U5EA 5DHAB 3KZ1A 1BC1A 3ML4A 1XT0B 1MAIA 2H0LA 2R2YA 2HE7A 2COFA 3QIJA 1X1FA 3KY9A 2H0MA 4JXHA 4XWXA 2D4QA 4D7RA 2RUKB 2Y8GA 1MPHA 5M4YB 4F7HA 1XR0B 4L5MA 3FEHA 1U5GA 3TO1A 1H4RA 2K2UA 3DXEA 2W2XD 4DX90 1FHOA 3AJCA 1DROA 2Y7BA 2K00A 1RJ2A 3RCPA 3SNHA 5C79A 1GC6A 1QQGA 2I1JA 5GOWB 2GUMA 1P3RA 2Z0QA 1S9DE 3NWAA 5LONB 2AL6A 3B77A 4GOUA 5FI1A 4OT1A 3KSYA 3F0WA 2J0MA 1DBHA 1BCYA 1DDWA 1B55A 1BCWA 3NWDA 1U5DA 2DTCA 2W2WA 5D3YA 1WJ1A 2XO3A 4TYZA 4F7GA 1UNQA 2FJLA 4YONA 3NWFA 2RRFA 2DYNA 4WVFB 3OHMB 5D3VA 5KCVA 4GNKB 1XSZA 2D10A 3A8QA 3LJUX 3D8EA 2LULA 5I2MA 1H10A 1ZVRA 3OANA 1KZGA 4KMUX 2D2QA 4GZUA 2YT0A 1N00A 2RNRB 1R8QE 1PBVA 1FGYA 1OY2A 1IRSA 2KR0A 2YT2A 1U27A 3PP2A 4JWLA 5EFXA 1WGQA 3TFMA 2KCJA 5D27A 1V89A 2EC1A 4HDOA 1DDMA 1ZYIA 4HAUB 2D11A 5JLJB 2D9YA 1Q8DA 1Y5OA 1BCZA 2Y8FA 2Z13A 1K5DB 4K81A 3SV1A 2ZKMX 1N44A 1AVRA 3AJ4A 4K2PA 4DXAB 2I1KA 2RGNB 2CRFA 2IFSA 1Y19B 5CLLB 4EJNA 3TW1A 2FJUB 3AO0A 1XJLA 3MDBC 4KN4X 1ZSQA 1W1GA 4Q2SA 1BO9A 1TQZA 4NY0A 2Z14A 2DKPA 4CSQA 4ZRIA 2DHKA 1N41A 2EJ8A 3QBVB 2N23A 3PVLA 3UZTA 2K8EA 4MT7A 1OQNA 1LB1A 1MK9B 3FVCA 3PZDA 5HE1A 4D0NB 3CIKA 1SAVA 1ZC4B 1BC0A 2ADZA 3WA0A 1I7AA 1FHXA 2DYQA 1DDVA 1UNRA 2Z0OA 4K2OA 1XKEA 1W1DA 2MDXA 5I2SA 3TVVA 3A58A 5HE2A 3D8DA 1AVCA 1HVEA 1M9IA 1SGHA 2DLWA 2V76A 2HTHB 3SOHB 1TJ6A 4OSNA 1ZM0A 4KHOA 1FAOA 2Z4DA 4C0AA 1EVHA 4H8SA 4MY6A 2DX5A 3V5WA 4A6KA 2VXGA 1DK5A 2M38A 1AQCA 1A8BA 1YJ0A 1UPTB 1K5GB 2RVBB 2MFQA 2D9WA 2NBVA 1R8ME 1EF1A 1PLSA 4CYEA 4DBBA 3A98B 4F7UP 4HSIA 3LTLA 2M14A 1QC7A 2J0JA 1AWEA 1FGZA 1WI1A 1BC3A 4QJ3B 4TKNA 1I4AA 4C7PA 3BINA 4DX8A 2H0KA 2KUPA 1ANXA 3KRXA 2K49A 1NU2A 4MK0A 2GJYA 3ANYA 3P6AA 2YS3A 1XCGA 3SWVA 1UPQA 3O96A 4HATB 2P0DA 2QEZA 2ZHJA 5IRSA 1N3HA 2HYWA 1AOWA 3DCXA 4Y94A 2IICA 1V5MA 2Q13A 3BJIA 3PVWA 3ULBA 4CHJA 1EGXA 1MK7B 5JHGA 2J0KA 1GC7A 5HE0A 1U5FA 2YS1A 5DHFB 3ABQA 1W1HA 2I5CA 5C5BB 4A4PA 2LKOA 3AU4A 3G9WA 1RRPB 2DHIA 3X23A 3P7ZA 1UNPA 3U7DA 3SYXA 2DFKA 5C6RA 3USWA 1X1GA 1NTYA 2GCJA 4JMIA 1V5UA 1NTVA 1Z87A 2YS5A 1T77A 2ELAA 4B6HA 1QC6A 2J59M 2H7DA 3ABOA 4HB3B 2NZ8B 1X11A 2ZOCA 2LYDA 4A6FB 1MIZB 1HAKA 3N7CA 4A6FA 2IE6A 2CY4A 1YCNA 2OY9A 1AXNA 2ROZB 2OTXA 2XQNM 3NW8A 2II2A 1ALAA 4QJ5B 1UEFA 2PZ1A 3A8PA 5J3TA 3ODOA 2LG1A 2HYUA 2DN6A 3FSSA 1M7RA 2IYBA 4IOYX 3GYOA 3L8NA 2CY5A 4D6WA 2RSGA 4KAXB 3KRWA 1HM6A 5L81A 4K17A 2LOZA 2L1CA 2RLOA 2L2IA 3FM8C 1OMWA 4KHBB 4DIXA 2EMSA 1XX0A 4QJ4B 4JMOA 4L6EA 5FI0A 1J19A 5LG4B 1WJMA 4GXBA 2YT1A 4KHBA 4EKUA 4YL8A 1ISNA 2UVMA 1FHWA 2EMTA 3CXBB 3DXDA 2P0HA 4HAXB 4HB0B 1GG3A 3HSAA 3PEGA 1P5TA 2COCA 5HE3A 2HYVA 4EVFA 2YF0A 3PG7A 3F5RA 3AU5A 2KUQA 4IFSA 1X86A 1LKVX 3HK0A 3M1IB 2R09A 4L1RA 4PQ0A 1R4AE 2NMBA 3ODXA 4WSFA 2LOXA 4A6HA 3TCAA 1C1KA 1I2HA 4QXAB 5J3YA 2XO2A 3VOQA 4EVHA 2ELBA 5DI9B 4HAVB 4HAWB 3TW5A 1WG7A 1J0WA 2JP2A 1ANNA 1MI1A 2I5FA 2MKRA 2CAYA 4FQ0C 2YVCA 3ULCA 2YSZA 2X18A 3IVFA 1FOEA 1AIIA 4HHVA 4OIYA 4GN1A 2VSZA 1W7BA 3PSCA 2DA0A 1U29A 4GMXB 2HSNA 1N42A 4NSWA 4WJ7A 5KQ1A 1MIXA 2K2JA 2ROVA 1RE0B 2YRYA 2Q4CA 4MDVA 5LOPB 2OQBA 1MCXA 3ABSA 2D9VA 3SUZA 1EAZA 2H7EA 4GMVA 1V88A 4GPTB 2DKQA 1KZ7A 3U8ZA 3QWMA 2AEHA 2Z0PA 4KHAA 1E5WA 2P8VA 4Z2NA 3ZVRA 3ODWA 1P6SA 1V5PA 4HAYB 2Z59A 5C5BA 4FHRB 1BTKA 3MPXA 3PVUA 1HVDA 4CHMA 4PNKA 1AVHA 4HREA 2DX1A 2KIEA 3BRXA 5D3WA 1PFJA 4Z2MB 1UPRA 5CLQB 1YIIA 4IAPA 1BWNA 1ANWA 1HVFA 2W2XC
chains in the Genus database with same CATH topology
2P0FA 2GS0A 1WGUA 3T06A 2UZSA 4A5KA 1MKEA 2GCLA 1WVHA 3GYPA 1NI2A 5D3XA 3HJLA 1V61A 1KI1B 1SHCA 2D9XA 5J3QA 1M7EA 3DXCA 1Q67A 2R0DA 1XODA 3HW2B 4HAZB 1KU1A 4P7IA 5JHHA 2K6XA 5DH9B 4HB4B 4JK1X 4BBKA 4KN7X 5KQ4A 5DIFB 2G35A 2BCJA 2KGXB 4ZRJA 4HB2B 1DYNA 4ZRKA 1U2BA 2QKLA 3NSUA 2E2XA 2QKMA 1TXDA 2DHJA 1BAKA 2ZPYA 2VRWB 2N0YA 2UZRA 4EMOA 2MWNB 3ZDTA 1XD4A 1BTNA 1BC9A 1X05A 1R8SE 3VIAA 5C16A 4D7QA 3SO6A 4KVGB 4HDQA 3HQCA 2COAA 2CODA 2VKIA 1ZC3B 3D8FA 1PMSA 2D9ZA 5JP4A 1FB8A 3WYFB 1LW3A 4Z21A 3USYA 1U5EA 5DHAB 3KZ1A 3ML4A 1XT0B 1MAIA 2HE7A 2COFA 3QIJA 1X1FA 3KY9A 4JXHA 4XWXA 2D4QA 4D7RA 2RUKB 2Y8GA 1MPHA 4F7HA 1XR0B 4L5MA 3FEHA 1U5GA 3TO1A 1H4RA 2K2UA 3DXEA 2W2XD 4DX90 1FHOA 3AJCA 1DROA 2Y7BA 2K00A 1RJ2A 3RCPA 3SNHA 5C79A 1GC6A 1QQGA 2I1JA 5GOWB 1P3RA 2Z0QA 1S9DE 5LONB 2AL6A 5FI1A 3KSYA 3F0WA 2J0MA 1DBHA 1DDWA 1B55A 1U5DA 2DTCA 2W2WA 5D3YA 1WJ1A 4TYZA 4F7GA 1UNQA 2FJLA 4YONA 2DYNA 4WVFB 5D3VA 5KCVA 1XSZA 2D10A 3A8QA 3LJUX 3D8EA 2LULA 1H10A 1ZVRA 3OANA 1KZGA 4KMUX 2D2QA 4GZUA 2YT0A 2RNRB 1R8QE 1PBVA 1FGYA 1OY2A 1IRSA 1U27A 3PP2A 4JWLA 5EFXA 1WGQA 3TFMA 2KCJA 5D27A 1V89A 2EC1A 4HDOA 1DDMA 4HAUB 2D11A 5JLJB 2D9YA 1Q8DA 1Y5OA 4K81A 2Y8FA 3SV1A 1K5DB 3AJ4A 4K2PA 4DXAB 2I1KA 2RGNB 2CRFA 2IFSA 1Y19B 5CLLB 4EJNA 3TW1A 3MDBC 4KN4X 1ZSQA 1W1GA 1TQZA 4NY0A 2DKPA 4ZRIA 2DHKA 2EJ8A 3QBVB 2N23A 3PVLA 3UZTA 4MT7A 1OQNA 1LB1A 1MK9B 3PZDA 5HE1A 4D0NB 3CIKA 1ZC4B 2ADZA 3WA0A 1I7AA 1FHXA 2DYQA 1DDVA 1UNRA 2Z0OA 4K2OA 1XKEA 1W1DA 2MDXA 3TVVA 5HE2A 3D8DA 1SGHA 2DLWA 2V76A 2HTHB 3SOHB 1TJ6A 1ZM0A 4KHOA 1FAOA 4C0AA 1EVHA 4H8SA 4MY6A 2DX5A 3V5WA 4A6KA 2M38A 1AQCA 1K5GB 2RVBB 2MFQA 2D9WA 1R8ME 1EF1A 1PLSA 4CYEA 4DBBA 3A98B 4F7UP 3LTLA 2M14A 1QC7A 2J0JA 1AWEA 1FGZA 1WI1A 4TKNA 4C7PA 3BINA 4DX8A 2KUPA 3KRXA 1NU2A 4MK0A 2GJYA 3P6AA 2YS3A 1XCGA 3SWVA 1UPQA 3O96A 4HATB 2P0DA 1N3HA 4Y94A 1V5MA 3ULBA 2Q13A 3BJIA 3PVWA 4CHJA 1EGXA 1MK7B 5JHGA 2J0KA 1GC7A 5HE0A 1U5FA 2YS1A 5DHFB 1W1HA 2I5CA 5C5BB 4A4PA 2LKOA 3AU4A 3G9WA 1RRPB 2DHIA 3X23A 3P7ZA 1UNPA 3U7DA 3SYXA 2DFKA 5C6RA 3USWA 1X1GA 1NTYA 2GCJA 4JMIA 1V5UA 1NTVA 1Z87A 2YS5A 2ELAA 4B6HA 1QC6A 2J59M 2H7DA 4HB3B 2NZ8B 1X11A 2LYDA 4A6FB 1MIZB 3N7CA 4A6FA 2CY4A 2ROZB 2XQNM 2OTXA 1UEFA 2PZ1A 3A8PA 5J3TA 3ODOA 2LG1A 2DN6A 3FSSA 1M7RA 2IYBA 4IOYX 3GYOA 3L8NA 2CY5A 2RSGA 4KAXB 3KRWA 5L81A 4K17A 2LOZA 2L1CA 2RLOA 2L2IA 3FM8C 1OMWA 4KHBB 2EMSA 1XX0A 4JMOA 4L6EA 5FI0A 1J19A 1WJMA 4GXBA 2YT1A 4EKUA 4YL8A 1ISNA 2UVMA 1FHWA 2EMTA 3CXBB 3DXDA 2P0HA 4HAXB 4HB0B 1GG3A 3PEGA 1P5TA 2COCA 5HE3A 2YF0A 3PG7A 3F5RA 3AU5A 4IFSA 1X86A 1LKVX 3HK0A 3M1IB 2R09A 4PQ0A 2NMBA 3ODXA 4WSFA 2LOXA 4A6HA 3TCAA 1I2HA 5J3YA 3VOQA 2ELBA 5DI9B 4HAVB 4HAWB 3TW5A 1WG7A 1J0WA 2JP2A 2I5FA 2MKRA 2CAYA 4FQ0C 2YVCA 3ULCA 2YSZA 2X18A 3IVFA 1FOEA 4HHVA 4OIYA 4GN1A 2VSZA 3PSCA 2DA0A 1U29A 4GMXB 2HSNA 4NSWA 4WJ7A 5KQ1A 1MIXA 2K2JA 2ROVA 1RE0B 2YRYA 5LOPB 2OQBA 2D9VA 3SUZA 1EAZA 2H7EA 4GMVA 1V88A 4GPTB 2DKQA 1KZ7A 3U8ZA 3QWMA 2AEHA 2Z0PA 4KHAA 1E5WA 2P8VA 4Z2NA 3ZVRA 3ODWA 1P6SA 1V5PA 4HAYB 5C5BA 4FHRB 1BTKA 3MPXA 3PVUA 4CHMA 4PNKA 2DX1A 5D3WA 1PFJA 4Z2MB 1UPRA 5CLQB 4IAPA 1BWNA 2W2XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0F A;  2GS0 A;  1WGU A;  3T06 A;  2UZS A;  4A5K A;  1MKE A;  2GCL A;  1WVH A;  3GYP A;  1NI2 A;  5D3X A;  1V61 A;  1KI1 B;  1SHC A;  2D9X A;  5J3Q A;  1M7E A;  3DXC A;  1Q67 A;  2R0D A;  1XOD A;  3HW2 B;  4HAZ B;  1KU1 A;  4P7I A;  5JHH A;  5DH9 B;  4HB4 B;  4BBK A;  5KQ4 A;  5DIF B;  2G35 A;  2BCJ A;  2KGX B;  4ZRJ A;  4HB2 B;  1DYN A;  4ZRK A;  1U2B A;  2QKL A;  3NSU A;  2E2X A;  2QKM A;  1TXD A;  2DHJ A;  1BAK A;  2ZPY A;  2VRW B;  2N0Y A;  2UZR A;  4EMO A;  2MWN B;  3ZDT A;  1XD4 A;  1BTN A;  1BC9 A;  1X05 A;  1R8S E;  3VIA A;  5C16 A;  4D7Q A;  3SO6 A;  4KVG B;  4HDQ A;  3HQC A;  2COA A;  2COD A;  2VKI A;  1ZC3 B;  3D8F A;  1PMS A;  2D9Z A;  5JP4 A;  1FB8 A;  3WYF B;  1LW3 A;  4Z21 A;  1U5E A;  5DHA B;  3KZ1 A;  3ML4 A;  1XT0 B;  1MAI A;  2HE7 A;  2COF A;  3QIJ A;  1X1F A;  3KY9 A;  4JXH A;  4XWX A;  2D4Q A;  4D7R A;  2RUK B;  2Y8G A;  1MPH A;  4F7H A;  1XR0 B;  4L5M A;  3FEH A;  1U5G A;  3TO1 A;  1H4R A;  2K2U A;  3DXE A;  2W2X D;  4DX9 0;  1FHO A;  1DRO A;  2Y7B A;  2K00 A;  1RJ2 A;  3RCP A;  3SNH A;  5C79 A;  1GC6 A;  1QQG A;  2I1J A;  5GOW B;  1P3R A;  2Z0Q A;  1S9D E;  5LON B;  2AL6 A;  5FI1 A;  3KSY A;  3F0W A;  2J0M A;  1DBH A;  1DDW A;  1B55 A;  1U5D A;  2DTC A;  2W2W A;  5D3Y A;  1WJ1 A;  4TYZ A;  4F7G A;  1UNQ A;  2FJL A;  4YON A;  2DYN A;  4WVF B;  5D3V A;  5KCV A;  1XSZ A;  2D10 A;  3A8Q A;  3LJU X;  3D8E A;  2LUL A;  1H10 A;  1ZVR A;  3OAN A;  1KZG A;  2D2Q A;  4GZU A;  2YT0 A;  2RNR B;  1R8Q E;  1PBV A;  1FGY A;  1OY2 A;  1IRS A;  1U27 A;  3PP2 A;  4JWL A;  5EFX A;  1WGQ A;  3TFM A;  2KCJ A;  5D27 A;  1V89 A;  2EC1 A;  4HDO A;  1DDM A;  4HAU B;  2D11 A;  5JLJ B;  2D9Y A;  1Y5O A;  4K81 A;  2Y8F A;  3SV1 A;  1K5D B;  3AJ4 A;  4K2P A;  4DXA B;  2I1K A;  2RGN B;  2CRF A;  2IFS A;  1Y19 B;  5CLL B;  4EJN A;  3TW1 A;  3MDB C;  1ZSQ A;  1W1G A;  1TQZ A;  4NY0 A;  2DKP A;  4ZRI A;  2DHK A;  2EJ8 A;  3QBV B;  2N23 A;  3PVL A;  3UZT A;  4MT7 A;  1OQN A;  1LB1 A;  1MK9 B;  3PZD A;  5HE1 A;  4D0N B;  3CIK A;  1ZC4 B;  2ADZ A;  3WA0 A;  1I7A A;  1FHX A;  2DYQ A;  1DDV A;  1UNR A;  2Z0O A;  4K2O A;  1XKE A;  1W1D A;  2MDX A;  3TVV A;  5HE2 A;  3D8D A;  1SGH A;  2DLW A;  2V76 A;  2HTH B;  1TJ6 A;  1ZM0 A;  4KHO A;  1FAO A;  4C0A A;  1EVH A;  4H8S A;  4MY6 A;  2DX5 A;  3V5W A;  4A6K A;  2M38 A;  1AQC A;  1K5G B;  2RVB B;  2MFQ A;  2D9W A;  1R8M E;  1EF1 A;  1PLS A;  4CYE A;  4DBB A;  3A98 B;  4F7U P;  3LTL A;  2M14 A;  2J0J A;  1AWE A;  1FGZ A;  1WI1 A;  4TKN A;  4C7P A;  3BIN A;  4DX8 A;  2KUP A;  3KRX A;  1NU2 A;  4MK0 A;  2GJY A;  3P6A A;  2YS3 A;  1XCG A;  3SWV A;  1UPQ A;  3O96 A;  4HAT B;  2P0D A;  1N3H A;  4Y94 A;  1V5M A;  3ULB A;  2Q13 A;  3BJI A;  3PVW A;  4CHJ A;  1EGX A;  1MK7 B;  5JHG A;  2J0K A;  1GC7 A;  5HE0 A;  1U5F A;  2YS1 A;  5DHF B;  1W1H A;  2I5C A;  5C5B B;  4A4P A;  2LKO A;  3AU4 A;  3G9W A;  1RRP B;  2DHI A;  3X23 A;  3P7Z A;  1UNP A;  3U7D A;  3SYX A;  2DFK A;  5C6R A;  1X1G A;  1NTY A;  2GCJ A;  4JMI A;  1V5U A;  1NTV A;  1Z87 A;  2YS5 A;  2ELA A;  4B6H A;  1QC6 A;  2J59 M;  2H7D A;  4HB3 B;  2NZ8 B;  1X11 A;  2LYD A;  4A6F B;  1MIZ B;  3N7C A;  4A6F A;  2CY4 A;  2ROZ B;  2XQN M;  2OTX A;  1UEF A;  2PZ1 A;  3A8P A;  5J3T A;  3ODO A;  2LG1 A;  2DN6 A;  3FSS A;  1M7R A;  2IYB A;  4IOY X;  3GYO A;  3L8N A;  2CY5 A;  2RSG A;  4KAX B;  3KRW A;  5L81 A;  4K17 A;  2LOZ A;  2L1C A;  2RLO A;  2L2I A;  3FM8 C;  1OMW A;  4KHB B;  2EMS A;  1XX0 A;  4JMO A;  4L6E A;  5FI0 A;  1J19 A;  1WJM A;  4GXB A;  2YT1 A;  4EKU A;  4YL8 A;  1ISN A;  2UVM A;  1FHW A;  2EMT A;  3CXB B;  3DXD A;  2P0H A;  4HAX B;  4HB0 B;  1GG3 A;  3PEG A;  1P5T A;  2COC A;  5HE3 A;  2YF0 A;  3PG7 A;  3F5R A;  3AU5 A;  4IFS A;  1X86 A;  3HK0 A;  3M1I B;  2R09 A;  4PQ0 A;  2NMB A;  3ODX A;  4WSF A;  2LOX A;  4A6H A;  3TCA A;  1I2H A;  5J3Y A;  3VOQ A;  2ELB A;  5DI9 B;  4HAV B;  4HAW B;  1WG7 A;  1J0W A;  2JP2 A;  2I5F A;  2MKR A;  2CAY A;  2YVC A;  3ULC A;  2YSZ A;  2X18 A;  3IVF A;  1FOE A;  4HHV A;  4OIY A;  4GN1 A;  2VSZ A;  3PSC A;  2DA0 A;  1U29 A;  4GMX B;  4NSW A;  4WJ7 A;  5KQ1 A;  1MIX A;  2K2J A;  2ROV A;  1RE0 B;  2YRY A;  5LOP B;  2OQB A;  2D9V A;  3SUZ A;  1EAZ A;  2H7E A;  4GMV A;  1V88 A;  4GPT B;  2DKQ A;  1KZ7 A;  3U8Z A;  3QWM A;  2AEH A;  2Z0P A;  4KHA A;  1E5W A;  2P8V A;  4Z2N A;  3ZVR A;  3ODW A;  1P6S A;  1V5P A;  4HAY B;  5C5B A;  1BTK A;  3MPX A;  3PVU A;  4CHM A;  4PNK A;  2DX1 A;  5D3W A;  1PFJ A;  4Z2M B;  1UPR A;  5CLQ B;  4IAP A;  1BWN A;  2W2X C; 
#chains in the Genus database with same CATH topology
 2P0F A;  2GS0 A;  1WGU A;  3T06 A;  2UZS A;  4MDU A;  4A5K A;  1MKE A;  2GCL A;  3HIE A;  1WVH A;  3GYP A;  1NI2 A;  5D3X A;  4X9P A;  3HJL A;  1V61 A;  1KI1 B;  1SHC A;  2D9X A;  5J3Q A;  3ABR A;  1M7E A;  3DXC A;  1Q67 A;  2R0D A;  1XOD A;  3HW2 B;  4HAZ B;  1KU1 A;  4P7I A;  5JHH A;  2K6X A;  5DH9 B;  4HB4 B;  4JK1 X;  4BBK A;  1W45 A;  4KN7 X;  5KQ4 A;  2ZHI A;  5DIF B;  2G35 A;  2RAN A;  2KIG A;  1G5N A;  1AEI A;  2BCJ A;  2KGX B;  4ZRJ A;  1A8A A;  1DYN A;  4HB2 B;  4ZRK A;  1YGM A;  1U2B A;  1DM5 A;  2QKL A;  3NSU A;  2E2X A;  2QKM A;  1TXD A;  2DHJ A;  1BAK A;  3U12 A;  2ZPY A;  2VRW B;  2N0Y A;  2UZR A;  2IE7 A;  4EMO A;  2MWN B;  3ZDT A;  1XD4 A;  1BTN A;  1BC9 A;  1X05 A;  1R8S E;  3VIA A;  5C16 A;  4D7Q A;  3SO6 A;  4KVG B;  1W3W A;  4HDQ A;  3HQC A;  2COA A;  2COD A;  2VKI A;  1ZC3 B;  3D8F A;  1HVG A;  1PMS A;  2D9Z A;  5JP4 A;  1FB8 A;  3WYF B;  1LW3 A;  4Z21 A;  3USY A;  1U5E A;  5DHA B;  3KZ1 A;  1BC1 A;  3ML4 A;  1XT0 B;  1MAI A;  2H0L A;  2R2Y A;  2HE7 A;  2COF A;  3QIJ A;  1X1F A;  3KY9 A;  2H0M A;  4JXH A;  4XWX A;  2D4Q A;  4D7R A;  2RUK B;  2Y8G A;  1MPH A;  5M4Y B;  4F7H A;  1XR0 B;  4L5M A;  3FEH A;  1U5G A;  3TO1 A;  1H4R A;  2K2U A;  3DXE A;  2W2X D;  4DX9 0;  1FHO A;  3AJC A;  1DRO A;  2Y7B A;  2K00 A;  1RJ2 A;  3RCP A;  3SNH A;  5C79 A;  1GC6 A;  1QQG A;  2I1J A;  5GOW B;  2GUM A;  1P3R A;  2Z0Q A;  1S9D E;  3NWA A;  5LON B;  2AL6 A;  3B77 A;  4GOU A;  5FI1 A;  4OT1 A;  3KSY A;  3F0W A;  2J0M A;  1DBH A;  1BCY A;  1DDW A;  1B55 A;  1BCW A;  3NWD A;  1U5D A;  2DTC A;  2W2W A;  5D3Y A;  1WJ1 A;  2XO3 A;  4TYZ A;  4F7G A;  1UNQ A;  2FJL A;  4YON A;  3NWF A;  2RRF A;  2DYN A;  4WVF B;  3OHM B;  5D3V A;  5KCV A;  4GNK B;  1XSZ A;  2D10 A;  3A8Q A;  3LJU X;  3D8E A;  2LUL A;  5I2M A;  1H10 A;  1ZVR A;  3OAN A;  1KZG A;  4KMU X;  2D2Q A;  4GZU A;  2YT0 A;  1N00 A;  2RNR B;  1R8Q E;  1PBV A;  1FGY A;  1OY2 A;  1IRS A;  2KR0 A;  2YT2 A;  1U27 A;  3PP2 A;  4JWL A;  5EFX A;  1WGQ A;  3TFM A;  2KCJ A;  5D27 A;  1V89 A;  2EC1 A;  4HDO A;  1DDM A;  1ZYI A;  4HAU B;  2D11 A;  5JLJ B;  2D9Y A;  1Q8D A;  1Y5O A;  1BCZ A;  2Y8F A;  2Z13 A;  1K5D B;  4K81 A;  3SV1 A;  2ZKM X;  1N44 A;  1AVR A;  3AJ4 A;  4K2P A;  4DXA B;  2I1K A;  2RGN B;  2CRF A;  2IFS A;  1Y19 B;  5CLL B;  4EJN A;  3TW1 A;  2FJU B;  3AO0 A;  1XJL A;  3MDB C;  4KN4 X;  1ZSQ A;  1W1G A;  4Q2S A;  1BO9 A;  1TQZ A;  4NY0 A;  2Z14 A;  2DKP A;  4CSQ A;  4ZRI A;  2DHK A;  1N41 A;  2EJ8 A;  3QBV B;  2N23 A;  3PVL A;  3UZT A;  2K8E A;  4MT7 A;  1OQN A;  1LB1 A;  1MK9 B;  3FVC A;  3PZD A;  5HE1 A;  4D0N B;  3CIK A;  1SAV A;  1ZC4 B;  1BC0 A;  2ADZ A;  3WA0 A;  1I7A A;  1FHX A;  2DYQ A;  1DDV A;  1UNR A;  2Z0O A;  4K2O A;  1XKE A;  1W1D A;  2MDX A;  5I2S A;  3TVV A;  3A58 A;  5HE2 A;  3D8D A;  1AVC A;  1HVE A;  1M9I A;  1SGH A;  2DLW A;  2V76 A;  2HTH B;  3SOH B;  1TJ6 A;  4OSN A;  1ZM0 A;  4KHO A;  1FAO A;  2Z4D A;  4C0A A;  1EVH A;  4H8S A;  4MY6 A;  2DX5 A;  3V5W A;  4A6K A;  2VXG A;  1DK5 A;  2M38 A;  1AQC A;  1A8B A;  1YJ0 A;  1UPT B;  1K5G B;  2RVB B;  2MFQ A;  2D9W A;  2NBV A;  1R8M E;  1EF1 A;  1PLS A;  4CYE A;  4DBB A;  3A98 B;  4F7U P;  4HSI A;  3LTL A;  2M14 A;  1QC7 A;  2J0J A;  1AWE A;  1FGZ A;  1WI1 A;  1BC3 A;  4QJ3 B;  4TKN A;  1I4A A;  4C7P A;  3BIN A;  4DX8 A;  2H0K A;  2KUP A;  1ANX A;  3KRX A;  2K49 A;  1NU2 A;  4MK0 A;  2GJY A;  3ANY A;  3P6A A;  2YS3 A;  1XCG A;  3SWV A;  1UPQ A;  3O96 A;  4HAT B;  2P0D A;  2QEZ A;  2ZHJ A;  5IRS A;  1N3H A;  2HYW A;  1AOW A;  3DCX A;  4Y94 A;  2IIC A;  1V5M A;  2Q13 A;  3BJI A;  3PVW A;  3ULB A;  4CHJ A;  1EGX A;  1MK7 B;  5JHG A;  2J0K A;  1GC7 A;  5HE0 A;  1U5F A;  2YS1 A;  5DHF B;  3ABQ A;  1W1H A;  2I5C A;  5C5B B;  4A4P A;  2LKO A;  3AU4 A;  3G9W A;  1RRP B;  2DHI A;  3X23 A;  3P7Z A;  1UNP A;  3U7D A;  3SYX A;  2DFK A;  5C6R A;  3USW A;  1X1G A;  1NTY A;  2GCJ A;  4JMI A;  1V5U A;  1NTV A;  1Z87 A;  2YS5 A;  1T77 A;  2ELA A;  4B6H A;  1QC6 A;  2J59 M;  2H7D A;  3ABO A;  4HB3 B;  2NZ8 B;  1X11 A;  2ZOC A;  2LYD A;  4A6F B;  1MIZ B;  1HAK A;  3N7C A;  4A6F A;  2IE6 A;  2CY4 A;  1YCN A;  2OY9 A;  1AXN A;  2ROZ B;  2OTX A;  2XQN M;  3NW8 A;  2II2 A;  1ALA A;  4QJ5 B;  1UEF A;  2PZ1 A;  3A8P A;  5J3T A;  3ODO A;  2LG1 A;  2HYU A;  2DN6 A;  3FSS A;  1M7R A;  2IYB A;  4IOY X;  3GYO A;  3L8N A;  2CY5 A;  4D6W A;  2RSG A;  4KAX B;  3KRW A;  1HM6 A;  5L81 A;  4K17 A;  2LOZ A;  2L1C A;  2RLO A;  2L2I A;  3FM8 C;  1OMW A;  4KHB B;  4DIX A;  2EMS A;  1XX0 A;  4QJ4 B;  4JMO A;  4L6E A;  5FI0 A;  1J19 A;  5LG4 B;  1WJM A;  4GXB A;  2YT1 A;  4KHB A;  4EKU A;  4YL8 A;  1ISN A;  2UVM A;  1FHW A;  2EMT A;  3CXB B;  3DXD A;  2P0H A;  4HAX B;  4HB0 B;  1GG3 A;  3HSA A;  3PEG A;  1P5T A;  2COC A;  5HE3 A;  2HYV A;  4EVF A;  2YF0 A;  3PG7 A;  3F5R A;  3AU5 A;  2KUQ A;  4IFS A;  1X86 A;  1LKV X;  3HK0 A;  3M1I B;  2R09 A;  4L1R A;  4PQ0 A;  1R4A E;  2NMB A;  3ODX A;  4WSF A;  2LOX A;  4A6H A;  3TCA A;  1C1K A;  1I2H A;  4QXA B;  5J3Y A;  2XO2 A;  3VOQ A;  4EVH A;  2ELB A;  5DI9 B;  4HAV B;  4HAW B;  3TW5 A;  1WG7 A;  1J0W A;  2JP2 A;  1ANN A;  1MI1 A;  2I5F A;  2MKR A;  2CAY A;  4FQ0 C;  2YVC A;  3ULC A;  2YSZ A;  2X18 A;  3IVF A;  1FOE A;  1AII A;  4HHV A;  4OIY A;  4GN1 A;  2VSZ A;  1W7B A;  3PSC A;  2DA0 A;  1U29 A;  4GMX B;  2HSN A;  1N42 A;  4NSW A;  4WJ7 A;  5KQ1 A;  1MIX A;  2K2J A;  2ROV A;  1RE0 B;  2YRY A;  2Q4C A;  4MDV A;  5LOP B;  2OQB A;  1MCX A;  3ABS A;  2D9V A;  3SUZ A;  1EAZ A;  2H7E A;  4GMV A;  1V88 A;  4GPT B;  2DKQ A;  1KZ7 A;  3U8Z A;  3QWM A;  2AEH A;  2Z0P A;  4KHA A;  1E5W A;  2P8V A;  4Z2N A;  3ZVR A;  3ODW A;  1P6S A;  1V5P A;  4HAY B;  2Z59 A;  5C5B A;  4FHR B;  1BTK A;  3MPX A;  3PVU A;  1HVD A;  4CHM A;  4PNK A;  1AVH A;  4HRE A;  2DX1 A;  2KIE A;  3BRX A;  5D3W A;  1PFJ A;  4Z2M B;  1UPR A;  5CLQ B;  1YII A;  4IAP A;  1BWN A;  1ANW A;  1HVF A;  2W2X C; 
#chains in the Genus database with same CATH homology
 2P0F A;  2GS0 A;  1WGU A;  3T06 A;  2UZS A;  4A5K A;  1MKE A;  2GCL A;  1WVH A;  3GYP A;  1NI2 A;  5D3X A;  3HJL A;  1V61 A;  1KI1 B;  1SHC A;  2D9X A;  5J3Q A;  1M7E A;  3DXC A;  1Q67 A;  2R0D A;  1XOD A;  3HW2 B;  4HAZ B;  1KU1 A;  4P7I A;  5JHH A;  2K6X A;  5DH9 B;  4HB4 B;  4JK1 X;  4BBK A;  4KN7 X;  5KQ4 A;  5DIF B;  2G35 A;  2BCJ A;  2KGX B;  4ZRJ A;  4HB2 B;  1DYN A;  4ZRK A;  1U2B A;  2QKL A;  3NSU A;  2E2X A;  2QKM A;  1TXD A;  2DHJ A;  1BAK A;  2ZPY A;  2VRW B;  2N0Y A;  2UZR A;  4EMO A;  2MWN B;  3ZDT A;  1XD4 A;  1BTN A;  1BC9 A;  1X05 A;  1R8S E;  3VIA A;  5C16 A;  4D7Q A;  3SO6 A;  4KVG B;  4HDQ A;  3HQC A;  2COA A;  2COD A;  2VKI A;  1ZC3 B;  3D8F A;  1PMS A;  2D9Z A;  5JP4 A;  1FB8 A;  3WYF B;  1LW3 A;  4Z21 A;  3USY A;  1U5E A;  5DHA B;  3KZ1 A;  3ML4 A;  1XT0 B;  1MAI A;  2HE7 A;  2COF A;  3QIJ A;  1X1F A;  3KY9 A;  4JXH A;  4XWX A;  2D4Q A;  4D7R A;  2RUK B;  2Y8G A;  1MPH A;  4F7H A;  1XR0 B;  4L5M A;  3FEH A;  1U5G A;  3TO1 A;  1H4R A;  2K2U A;  3DXE A;  2W2X D;  4DX9 0;  1FHO A;  3AJC A;  1DRO A;  2Y7B A;  2K00 A;  1RJ2 A;  3RCP A;  3SNH A;  5C79 A;  1GC6 A;  1QQG A;  2I1J A;  5GOW B;  1P3R A;  2Z0Q A;  1S9D E;  5LON B;  2AL6 A;  5FI1 A;  3KSY A;  3F0W A;  2J0M A;  1DBH A;  1DDW A;  1B55 A;  1U5D A;  2DTC A;  2W2W A;  5D3Y A;  1WJ1 A;  4TYZ A;  4F7G A;  1UNQ A;  2FJL A;  4YON A;  2DYN A;  4WVF B;  5D3V A;  5KCV A;  1XSZ A;  2D10 A;  3A8Q A;  3LJU X;  3D8E A;  2LUL A;  1H10 A;  1ZVR A;  3OAN A;  1KZG A;  4KMU X;  2D2Q A;  4GZU A;  2YT0 A;  2RNR B;  1R8Q E;  1PBV A;  1FGY A;  1OY2 A;  1IRS A;  1U27 A;  3PP2 A;  4JWL A;  5EFX A;  1WGQ A;  3TFM A;  2KCJ A;  5D27 A;  1V89 A;  2EC1 A;  4HDO A;  1DDM A;  4HAU B;  2D11 A;  5JLJ B;  2D9Y A;  1Q8D A;  1Y5O A;  4K81 A;  2Y8F A;  3SV1 A;  1K5D B;  3AJ4 A;  4K2P A;  4DXA B;  2I1K A;  2RGN B;  2CRF A;  2IFS A;  1Y19 B;  5CLL B;  4EJN A;  3TW1 A;  3MDB C;  4KN4 X;  1ZSQ A;  1W1G A;  1TQZ A;  4NY0 A;  2DKP A;  4ZRI A;  2DHK A;  2EJ8 A;  3QBV B;  2N23 A;  3PVL A;  3UZT A;  4MT7 A;  1OQN A;  1LB1 A;  1MK9 B;  3PZD A;  5HE1 A;  4D0N B;  3CIK A;  1ZC4 B;  2ADZ A;  3WA0 A;  1I7A A;  1FHX A;  2DYQ A;  1DDV A;  1UNR A;  2Z0O A;  4K2O A;  1XKE A;  1W1D A;  2MDX A;  3TVV A;  5HE2 A;  3D8D A;  1SGH A;  2DLW A;  2V76 A;  2HTH B;  3SOH B;  1TJ6 A;  1ZM0 A;  4KHO A;  1FAO A;  4C0A A;  1EVH A;  4H8S A;  4MY6 A;  2DX5 A;  3V5W A;  4A6K A;  2M38 A;  1AQC A;  1K5G B;  2RVB B;  2MFQ A;  2D9W A;  1R8M E;  1EF1 A;  1PLS A;  4CYE A;  4DBB A;  3A98 B;  4F7U P;  3LTL A;  2M14 A;  1QC7 A;  2J0J A;  1AWE A;  1FGZ A;  1WI1 A;  4TKN A;  4C7P A;  3BIN A;  4DX8 A;  2KUP A;  3KRX A;  1NU2 A;  4MK0 A;  2GJY A;  3P6A A;  2YS3 A;  1XCG A;  3SWV A;  1UPQ A;  3O96 A;  4HAT B;  2P0D A;  1N3H A;  4Y94 A;  1V5M A;  3ULB A;  2Q13 A;  3BJI A;  3PVW A;  4CHJ A;  1EGX A;  1MK7 B;  5JHG A;  2J0K A;  1GC7 A;  5HE0 A;  1U5F A;  2YS1 A;  5DHF B;  1W1H A;  2I5C A;  5C5B B;  4A4P A;  2LKO A;  3AU4 A;  3G9W A;  1RRP B;  2DHI A;  3X23 A;  3P7Z A;  1UNP A;  3U7D A;  3SYX A;  2DFK A;  5C6R A;  3USW A;  1X1G A;  1NTY A;  2GCJ A;  4JMI A;  1V5U A;  1NTV A;  1Z87 A;  2YS5 A;  2ELA A;  4B6H A;  1QC6 A;  2J59 M;  2H7D A;  4HB3 B;  2NZ8 B;  1X11 A;  2LYD A;  4A6F B;  1MIZ B;  3N7C A;  4A6F A;  2CY4 A;  2ROZ B;  2XQN M;  2OTX A;  1UEF A;  2PZ1 A;  3A8P A;  5J3T A;  3ODO A;  2LG1 A;  2DN6 A;  3FSS A;  1M7R A;  2IYB A;  4IOY X;  3GYO A;  3L8N A;  2CY5 A;  2RSG A;  4KAX B;  3KRW A;  5L81 A;  4K17 A;  2LOZ A;  2L1C A;  2RLO A;  2L2I A;  3FM8 C;  1OMW A;  4KHB B;  2EMS A;  1XX0 A;  4JMO A;  4L6E A;  5FI0 A;  1J19 A;  1WJM A;  4GXB A;  2YT1 A;  4EKU A;  4YL8 A;  1ISN A;  2UVM A;  1FHW A;  2EMT A;  3CXB B;  3DXD A;  2P0H A;  4HAX B;  4HB0 B;  1GG3 A;  3PEG A;  1P5T A;  2COC A;  5HE3 A;  2YF0 A;  3PG7 A;  3F5R A;  3AU5 A;  4IFS A;  1X86 A;  1LKV X;  3HK0 A;  3M1I B;  2R09 A;  4PQ0 A;  2NMB A;  3ODX A;  4WSF A;  2LOX A;  4A6H A;  3TCA A;  1I2H A;  5J3Y A;  3VOQ A;  2ELB A;  5DI9 B;  4HAV B;  4HAW B;  3TW5 A;  1WG7 A;  1J0W A;  2JP2 A;  2I5F A;  2MKR A;  2CAY A;  4FQ0 C;  2YVC A;  3ULC A;  2YSZ A;  2X18 A;  3IVF A;  1FOE A;  4HHV A;  4OIY A;  4GN1 A;  2VSZ A;  3PSC A;  2DA0 A;  1U29 A;  4GMX B;  2HSN A;  4NSW A;  4WJ7 A;  5KQ1 A;  1MIX A;  2K2J A;  2ROV A;  1RE0 B;  2YRY A;  5LOP B;  2OQB A;  2D9V A;  3SUZ A;  1EAZ A;  2H7E A;  4GMV A;  1V88 A;  4GPT B;  2DKQ A;  1KZ7 A;  3U8Z A;  3QWM A;  2AEH A;  2Z0P A;  4KHA A;  1E5W A;  2P8V A;  4Z2N A;  3ZVR A;  3ODW A;  1P6S A;  1V5P A;  4HAY B;  5C5B A;  4FHR B;  1BTK A;  3MPX A;  3PVU A;  4CHM A;  4PNK A;  2DX1 A;  5D3W A;  1PFJ A;  4Z2M B;  1UPR A;  5CLQ B;  4IAP A;  1BWN A;  2W2X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...