2R0DA

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Cytohesin-3
total genus 114
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r0dA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r0dA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r0dA03
3NSUA 2M14A 4GZUA 1DYNA 2YRYA 4ZRKA 2DHKA 1V89A 3KSYA 4DXAB 2KGXB 2DKPA 2Z0QA 3LJUX 2PZ1A 3ODOA 4HAZB 2YS3A 2Y8GA 1M7RA 5D3XA 4GXBA 3RCPA 1R8QE 3ZVRA 4HB4B 4NSWA 1KU1A 2L2IA 2XQNM 1ZC4B 2MDXA 3BINA 3SUZA 2DX1A 1U5FA 2GJYA 2OTXA 3KRXA 3AU5A 3QWMA 2DLWA 1OMWA 1FOEA 4EMOA 1W1DA 2KCJA 5CLLB 2IYBA 4PQ0A 4YONA 4WVFB 5D27A 2YS5A 2VKIA 1P5TA 4HAUB 2DYNA 2YS1A 3N7CA 4L6EA 1SGHA 3ODXA 1KZGA 3SNHA 2D9YA 1RRPB 1X05A 3TCAA 1PLSA 4C0AA 4C7PA 2VRWB 2HE7A 1P3RA 5DIFB 3L8NA 2LKOA 3SV1A 3A8QA 1R8ME 4IAPA 1AQCA 1XSZA 1X11A 4WJ7A 4D0NB 1QC6A 3PVUA 4MK0A 4JMOA 1FGYA 3PVLA 4GN1A 1XODA 4D7RA 3HK0A 2UVMA 4IFSA 1SHCA 1FAOA 2UZSA 2YT1A 3QBVB 1Q67A 3P6AA 2MWNB 1X86A 4HHVA 4KHAA 4EKUA 1NI2A 2LYDA 5JLJB 4HB0B 5EFXA 1PMSA 2COAA 2P0FA 4IOYX 2COFA 4GMVA 2D2QA 2H7EA 2RUKB 2GS0A 2J0JA 2DX5A 1Y19B 5KQ4A 5KCVA 1FHWA 3A8PA 2CY5A 2Y7BA 1U2BA 2ELAA 2YSZA 1MPHA 1BWNA 2P0HA 2ROVA 1XD4A 5HE2A 2Z0PA 4F7UP 2EMTA 1RE0B 3VOQA 5LOPB 1WGQA 3DXCA 2R0DA 2I5FA 3D8FA 3ML4A 5GOWB 2AEHA 5JHGA 5KQ1A 3O96A 5CLQB 3LTLA 4P7IA 3KZ1A 1UNPA 3G9WA 3HQCA 1DDVA 3WA0A 5HE3A 2D9XA 4K17A 1ZC3B 3TVVA 4A6FA 1GC6A 1R8SE 1ISNA 1BTKA 1UPQA 2DHJA 3SWVA 2D9WA 2I1KA 4GPTB 3MPXA 2HTHB 1MKEA 2RSGA 2J59M 2V76A 2DYQA 2N23A 5DH9B 5C16A 1U5GA 1NTVA 1V61A 1BAKA 1P6SA 2OQBA 5DHAB 2DHIA 2Y8FA 1FGZA 2D9ZA 3AJ4A 3DXDA 4DBBA 5D3YA 1GG3A 2W2XC 5L81A 1FHXA 2YVCA 4WSFA 1V5UA 4TYZA 4BBKA 2MFQA 2I5CA 2FJLA 2QKMA 4JWLA 4XWXA 2YF0A 1MAIA 1X1GA 4K2PA 4OIYA 1DBHA 3PSCA 4Y94A 2VSZA 3U7DA 1EF1A 4ZRJA 4ZRIA 4A4PA 2GCLA 4B6HA 4H8SA 1XR0B 4NY0A 3ULBA 2P8VA 5C5BB 1WI1A 2D9VA 1V88A 1KZ7A 2COCA 3ZDTA 2UZRA 4MT7A 2LULA 1DROA 1FHOA 3PZDA 3M1IB 3F5RA 4A5KA 1ZSQA 2CAYA 2H7DA 4HAWB 1EAZA 3HW2B 2AL6A 3KRWA 4TKNA 2NMBA 3PG7A 2ADZA 5C79A 2DFKA 4GMXB 2D11A 4KAXB 4HAVB 1EGXA 2IFSA 3DXEA 2L1CA 2GCJA 4F7GA 4Z2NA 1K5DB 2ELBA 1DDMA 1MIZB 5D3VA 1TQZA 2W2XD 1WJ1A 5HE1A 4EJNA 1MIXA 4A6HA 2EMSA 2DTCA 4CHJA 1WG7A 4HB2B 1BTNA 2EJ8A 2G35A 1LW3A 4HAYB 1U29A 3GYOA 3MDBC 1U5DA 2BCJA 1I2HA 5DI9B 1BC9A 2CRFA 3X23A 2MKRA 3VIAA 4HAXB 3A98B 1OQNA 2EC1A 1I7AA 5FI1A 4D7QA 2M38A 5D3WA 2DN6A 1XT0B 2D10A 5J3TA 4PNKA 2LG1A 2RNRB 1IRSA 2P0DA 1DDWA 5LONB 4KHBB 3ODWA 3SO6A 3V5WA 1N3HA 3UZTA 2D4QA 2LOZA 3D8DA 3TFMA 4HDQA 1X1FA 1UNRA 3BJIA 4JXHA 2YT0A 3F0WA 3PVWA 4HATB 4A6FB 2J0MA 1W1HA 1ZM0A 5HE0A 2R09A 2ROZB 4Z21A 3TO1A 5J3YA 1PFJA 2KUPA 1U5EA 3PEGA 3IVFA 1XCGA 2K2JA 3FSSA 1RJ2A 4K2OA 2DKQA 1TJ6A 1Z87A 4CHMA 1MK9B 2QKLA 5FI0A 1V5MA 3T06A 5JP4A 2RGNB 1ZVRA 4HDOA 4K81A 2I1JA 1FB8A 1V5PA 2ZPYA 1XKEA 4JMIA 5DHFB 3KY9A 1QQGA 2X18A 1Y5OA 1J19A 1H10A 2Q13A 1W1GA 1NU2A 2NZ8B 2DA0A 1M7EA 4Z2MB 3TW1A 3ULCA 2RLOA 2Z0OA 2CODA 3WYFB 3CXBB 5C5BA 1U27A 2W2WA 1TXDA 2CY4A 5JHHA 4DX90 2RVBB 3FM8C 1UPRA 1OY2A 3P7ZA 5C6RA 5J3QA 3D8EA 4KHOA 2JP2A 4KVGB 3U8ZA 4L5MA 1K5GB 2E2XA 3CIKA 2N0YA 1EVHA 1PBVA 1WJMA 3QIJA 1S9DE 3AU4A 4MY6A 1WVHA 1GC7A 4YL8A 3OANA 1NTYA 1UNQA 4F7HA 1MK7B 2K2UA 1H4RA 1B55A 1LB1A 1WGUA 3GYPA 2J0KA 4HB3B 2K00A 3PP2A 1E5WA 1J0WA 3SYXA 4CYEA 2LOXA 1AWEA 4DX8A 3FEHA 1UEFA 1KI1B 4A6KA 1XX0A
chains in the Genus database with same CATH superfamily
3AO0A 3NSUA 1YIIA 2M14A 4GZUA 2KR0A 1T77A 1DYNA 2YRYA 4KMUX 4ZRKA 2DHKA 1V89A 3KSYA 1G5NA 4DXAB 2KGXB 2DKPA 2Z13A 2Z0QA 3LJUX 5IRSA 2PZ1A 3ODOA 4HAZB 2YS3A 2Y8GA 1M7RA 5D3XA 4GXBA 3RCPA 1R8QE 4D6WA 3ZVRA 4HB4B 4NSWA 4GNKB 1KU1A 2L2IA 2XQNM 1ZC4B 2MDXA 3BINA 3SUZA 1DM5A 2DX1A 1U5FA 1BC3A 2GJYA 2OTXA 2ZOCA 3KRXA 3AU5A 3QWMA 4KHBA 1I4AA 2II2A 2DLWA 1OMWA 1FOEA 4EMOA 4FQ0C 2RRFA 1W1DA 2KCJA 5CLLB 2IYBA 4PQ0A 4YONA 4WVFB 5D27A 2YS5A 2VKIA 1P5TA 4HAUB 2DYNA 2YS1A 3N7CA 4L6EA 1BCYA 1SGHA 3ODXA 1KZGA 1SAVA 3SNHA 2D9YA 1RRPB 1R4AE 1X05A 1N44A 3TCAA 1PLSA 2IICA 4C0AA 4C7PA 2VRWB 2HE7A 1P3RA 5DIFB 3L8NA 2LKOA 3SV1A 3A8QA 1R8ME 4IAPA 1ALAA 1AQCA 1ANXA 1XSZA 4QJ3B 1X11A 4WJ7A 4D0NB 1QC6A 3PVUA 4MK0A 4JMOA 1FGYA 3PVLA 1XODA 4GN1A 4D7RA 3HK0A 2R2YA 4HSIA 2UVMA 4DIXA 4IFSA 1ANWA 1SHCA 1FAOA 2UZSA 2YT1A 3QBVB 2HYUA 1Q67A 3P6AA 2MWNB 1X86A 4HHVA 3A58A 4KHAA 1YCNA 4EKUA 1NI2A 2LYDA 5JLJB 4HB0B 5EFXA 2H0MA 1PMSA 2COAA 2P0FA 4IOYX 1YGMA 2COFA 4GMVA 2D2QA 2H7EA 2GS0A 2J0JA 3ABSA 2RUKB 2H0LA 2DX5A 1Y19B 5KQ4A 5KCVA 2K6XA 1FHWA 3A8PA 2CY5A 2Y7BA 2VXGA 1U2BA 2ELAA 2YSZA 1MPHA 2KIEA 1BWNA 2P0HA 2ROVA 2Z59A 1XD4A 5HE2A 2Z0PA 4F7UP 2EMTA 3BRXA 1DK5A 1RE0B 3ABRA 1HM6A 3VOQA 5LOPB 1WGQA 1M9IA 3DXCA 2IE6A 2R0DA 4X9PA 2I5FA 3NW8A 3D8FA 3ML4A 5GOWB 2AEHA 5JHGA 5KQ1A 3O96A 4MDUA 5CLQB 1N42A 3LTLA 4P7IA 4MDVA 3KZ1A 1UNPA 3G9WA 3HQCA 1DDVA 2OY9A 1ZYIA 3WA0A 5HE3A 2D9XA 1YJ0A 4K17A 1ZC3B 3TVVA 4A6FA 1GC6A 1N41A 1R8SE 1UPTB 1ISNA 1BTKA 1UPQA 3SWVA 3ABQA 2DHJA 2D9WA 2I1KA 4GPTB 3MPXA 2HTHB 1AEIA 2IE7A 3USYA 1MKEA 2RSGA 2J59M 2V76A 2DYQA 2N23A 5DH9B 5C16A 1U5GA 1NTVA 1V61A 1BAKA 2HYWA 1P6SA 2OQBA 5DHAB 2DHIA 2Y8FA 1FGZA 2D9ZA 3AJ4A 3DXDA 4DBBA 5D3YA 1GG3A 2W2XC 5L81A 2XO3A 1FHXA 2YVCA 4WSFA 1V5UA 4TYZA 4BBKA 2MFQA 1HAKA 2I5CA 3HSAA 4QJ4B 2FJLA 2QKMA 4JWLA 4XWXA 2YF0A 1MAIA 1X1GA 4K2PA 4OIYA 1DBHA 3PSCA 4Y94A 4Q2SA 2VSZA 2K49A 3U7DA 4FHRB 1EF1A 4ZRJA 1BCZA 4ZRIA 4A4PA 2GCLA 4B6HA 4H8SA 1XR0B 3NWDA 4NY0A 3ULBA 2P8VA 2QEZA 5C5BB 1WI1A 2D9VA 4EVHA 1V88A 2ZHIA 1QC7A 3OHMB 1KZ7A 1AOWA 5I2SA 3AJCA 2COCA 3ZDTA 2UZRA 4MT7A 2LULA 1DROA 1FHOA 1HVEA 3M1IB 3PZDA 3F5RA 4A5KA 1W3WA 2XO2A 1ZSQA 1XJLA 2CAYA 2H7DA 4HAWB 1EAZA 3HW2B 1HVGA 2AL6A 3KRWA 4TKNA 4QJ5B 2NMBA 3PG7A 3U12A 2ADZA 4EVFA 1HVFA 5C79A 2DFKA 4GMXB 4HREA 2D11A 4KAXB 4HAVB 1EGXA 2IFSA 3DXEA 2FJUB 2KUQA 3HIEA 2L1CA 2GCJA 4F7GA 4Z2NA 1K5DB 2ELBA 1DDMA 1MIZB 1BCWA 5D3VA 1TQZA 2W2XD 1WJ1A 3FVCA 5HE1A 4EJNA 2H0KA 1MIXA 4A6HA 5LG4B 2NBVA 2EMSA 2DTCA 4CHJA 1WG7A 4HB2B 1BTNA 2EJ8A 2G35A 2Z14A 1LW3A 4HAYB 1W45A 1U29A 3GYOA 2Q4CA 3MDBC 1U5DA 1AIIA 2BCJA 1I2HA 5DI9B 1BC9A 2HYVA 2CRFA 3TW5A 3X23A 2MKRA 3VIAA 4HAXB 2Z4DA 1OQNA 3A98B 2EC1A 1I7AA 1AVHA 5FI1A 4D7QA 2YT2A 2M38A 5D3WA 2DN6A 1XT0B 1C1KA 2D10A 5J3TA 2GUMA 3ANYA 4PNKA 2LG1A 2RNRB 1BO9A 1IRSA 2P0DA 1DDWA 5LONB 4KHBB 4OT1A 3ODWA 3SO6A 1A8BA 3V5WA 1N3HA 3UZTA 2D4QA 2LOZA 3D8DA 3TFMA 4HDQA 1X1FA 3DCXA 1UNRA 3BJIA 4JXHA 2YT0A 1MCXA 2RANA 3F0WA 3PVWA 4HATB 4A6FB 2J0MA 1W7BA 3SOHB 1W1HA 2HSNA 1ZM0A 5HE0A 5I2MA 2R09A 2ROZB 4Z21A 4KN7X 3TO1A 5J3YA 1PFJA 2KUPA 1U5EA 5M4YB 3PEGA 3IVFA 1XCGA 2K2JA 3FSSA 4JK1X 1RJ2A 3HJLA 4K2OA 2DKQA 1TJ6A 1Z87A 4CHMA 1MK9B 1ANNA 2QKLA 5FI0A 1V5MA 3T06A 5JP4A 1AXNA 2RGNB 1ZVRA 4HDOA 4K81A 1AVCA 2I1JA 1FB8A 1V5PA 2ZPYA 1XKEA 1A8AA 4JMIA 5DHFB 3KY9A 3USWA 1Q8DA 1QQGA 2X18A 1Y5OA 4L1RA 1J19A 1H10A 2Q13A 1W1GA 1NU2A 2NZ8B 1MI1A 1M7EA 2DA0A 1BC1A 4Z2MB 2RLOA 3TW1A 2Z0OA 3ULCA 2CODA 3WYFB 3CXBB 5C5BA 1U27A 2W2WA 1TXDA 2CY4A 1BC0A 5JHHA 3NWAA 4DX90 2RVBB 1AVRA 3FM8C 1UPRA 4GOUA 1OY2A 3P7ZA 5C6RA 5J3QA 3D8EA 4KHOA 2JP2A 4KVGB 3U8ZA 4L5MA 1K5GB 2E2XA 3CIKA 2N0YA 1EVHA 1HVDA 1PBVA 1WJMA 3NWFA 3QIJA 1S9DE 1LKVX 2K8EA 3AU4A 4MY6A 1WVHA 2ZKMX 3ABOA 1GC7A 4YL8A 3OANA 1NTYA 1UNQA 4F7HA 1MK7B 4KN4X 2K2UA 1H4RA 1B55A 1LB1A 3B77A 1WGUA 3GYPA 4QXAB 2J0KA 4HB3B 2K00A 3PP2A 1E5WA 1J0WA 3SYXA 4CSQA 4CYEA 2ZHJA 2LOXA 1AWEA 1N00A 4DX8A 2KIGA 3FEHA 1UEFA 1KI1B 4OSNA 4A6KA 1XX0A
chains in the Genus database with same CATH topology
3NSUA 2M14A 4GZUA 1DYNA 2YRYA 4KMUX 4ZRKA 2DHKA 1V89A 3KSYA 4DXAB 2KGXB 2DKPA 2Z0QA 3LJUX 2PZ1A 3ODOA 4HAZB 2YS3A 2Y8GA 1M7RA 5D3XA 4GXBA 3RCPA 1R8QE 3ZVRA 4HB4B 4NSWA 1KU1A 2L2IA 2XQNM 1ZC4B 2MDXA 3BINA 3SUZA 2DX1A 1U5FA 2GJYA 2OTXA 3KRXA 3AU5A 3QWMA 2DLWA 1OMWA 1FOEA 4EMOA 4FQ0C 1W1DA 2KCJA 5CLLB 2IYBA 4PQ0A 4YONA 4WVFB 5D27A 2YS5A 2VKIA 1P5TA 4HAUB 2DYNA 2YS1A 3N7CA 4L6EA 1SGHA 3ODXA 1KZGA 3SNHA 2D9YA 1RRPB 1X05A 3TCAA 1PLSA 4C0AA 4C7PA 2VRWB 2HE7A 1P3RA 5DIFB 3L8NA 2LKOA 3SV1A 3A8QA 1R8ME 4IAPA 1AQCA 1XSZA 1X11A 4WJ7A 4D0NB 1QC6A 3PVUA 4MK0A 4JMOA 1FGYA 3PVLA 1XODA 4GN1A 4D7RA 3HK0A 2UVMA 4IFSA 1SHCA 1FAOA 2UZSA 2YT1A 3QBVB 1Q67A 3P6AA 2MWNB 1X86A 4HHVA 4KHAA 4EKUA 1NI2A 2LYDA 5JLJB 4HB0B 5EFXA 1PMSA 2COAA 2P0FA 4IOYX 2COFA 4GMVA 2D2QA 2H7EA 2RUKB 2GS0A 2J0JA 2DX5A 1Y19B 5KQ4A 5KCVA 2K6XA 1FHWA 3A8PA 2CY5A 2Y7BA 1U2BA 2ELAA 2YSZA 1MPHA 1BWNA 2P0HA 2ROVA 1XD4A 5HE2A 2Z0PA 4F7UP 2EMTA 1RE0B 3VOQA 5LOPB 1WGQA 3DXCA 2R0DA 2I5FA 3D8FA 3ML4A 5GOWB 2AEHA 5JHGA 5KQ1A 3O96A 5CLQB 3LTLA 4P7IA 3KZ1A 1UNPA 3G9WA 3HQCA 1DDVA 3WA0A 5HE3A 2D9XA 4K17A 1ZC3B 3TVVA 4A6FA 1GC6A 1R8SE 1ISNA 1BTKA 1UPQA 2DHJA 3SWVA 2D9WA 2I1KA 4GPTB 3MPXA 2HTHB 3USYA 1MKEA 2RSGA 2J59M 2V76A 2DYQA 2N23A 5DH9B 5C16A 1U5GA 1NTVA 1V61A 1BAKA 1P6SA 2OQBA 5DHAB 2DHIA 2Y8FA 1FGZA 2D9ZA 3AJ4A 3DXDA 4DBBA 5D3YA 1GG3A 2W2XC 5L81A 1FHXA 2YVCA 4WSFA 1V5UA 4TYZA 4BBKA 2MFQA 2I5CA 2FJLA 2QKMA 4JWLA 4XWXA 2YF0A 1MAIA 1X1GA 4K2PA 4OIYA 1DBHA 3PSCA 4Y94A 2VSZA 3U7DA 4FHRB 1EF1A 4ZRJA 4ZRIA 4A4PA 2GCLA 4B6HA 4H8SA 1XR0B 4NY0A 3ULBA 2P8VA 5C5BB 1WI1A 2D9VA 1V88A 1QC7A 1KZ7A 3AJCA 2COCA 3ZDTA 2UZRA 4MT7A 2LULA 1DROA 1FHOA 3M1IB 3PZDA 3F5RA 4A5KA 1ZSQA 2CAYA 2H7DA 4HAWB 1EAZA 3HW2B 2AL6A 3KRWA 4TKNA 2NMBA 3PG7A 2ADZA 5C79A 2DFKA 4GMXB 2D11A 4KAXB 4HAVB 1EGXA 2IFSA 3DXEA 2L1CA 2GCJA 4F7GA 4Z2NA 1K5DB 2ELBA 1DDMA 1MIZB 5D3VA 1TQZA 2W2XD 1WJ1A 5HE1A 4EJNA 1MIXA 4A6HA 2EMSA 2DTCA 4CHJA 1WG7A 4HB2B 1BTNA 2EJ8A 2G35A 1LW3A 4HAYB 1U29A 3GYOA 3MDBC 1U5DA 2BCJA 1I2HA 5DI9B 1BC9A 2CRFA 3TW5A 3X23A 2MKRA 3VIAA 4HAXB 3A98B 1OQNA 2EC1A 1I7AA 5FI1A 4D7QA 2M38A 5D3WA 2DN6A 1XT0B 2D10A 5J3TA 4PNKA 2LG1A 2RNRB 1IRSA 2P0DA 1DDWA 5LONB 4KHBB 3ODWA 3SO6A 3V5WA 1N3HA 3UZTA 2D4QA 2LOZA 3D8DA 3TFMA 4HDQA 1X1FA 1UNRA 3BJIA 4JXHA 2YT0A 3F0WA 3PVWA 4HATB 4A6FB 2J0MA 3SOHB 1W1HA 2HSNA 1ZM0A 5HE0A 2R09A 2ROZB 4Z21A 4KN7X 3TO1A 5J3YA 1PFJA 2KUPA 1U5EA 3PEGA 3IVFA 1XCGA 2K2JA 3FSSA 4JK1X 1RJ2A 3HJLA 4K2OA 2DKQA 1TJ6A 1Z87A 4CHMA 1MK9B 2QKLA 5FI0A 1V5MA 3T06A 5JP4A 2RGNB 1ZVRA 4HDOA 4K81A 2I1JA 1FB8A 1V5PA 2ZPYA 1XKEA 4JMIA 5DHFB 3KY9A 3USWA 1Q8DA 1QQGA 2X18A 1Y5OA 1J19A 1H10A 2Q13A 1W1GA 1NU2A 2NZ8B 2DA0A 1M7EA 4Z2MB 3TW1A 3ULCA 2RLOA 2Z0OA 2CODA 3WYFB 3CXBB 5C5BA 1U27A 2W2WA 1TXDA 2CY4A 5JHHA 4DX90 2RVBB 3FM8C 1UPRA 1OY2A 3P7ZA 5C6RA 5J3QA 3D8EA 4KHOA 2JP2A 4KVGB 3U8ZA 4L5MA 1K5GB 2E2XA 3CIKA 2N0YA 1EVHA 1PBVA 1WJMA 3QIJA 1S9DE 1LKVX 3AU4A 4MY6A 1WVHA 1GC7A 4YL8A 3OANA 1NTYA 1UNQA 4F7HA 1MK7B 4KN4X 2K2UA 1H4RA 1B55A 1LB1A 1WGUA 3GYPA 2J0KA 4HB3B 2K00A 3PP2A 1E5WA 1J0WA 3SYXA 4CYEA 2LOXA 1AWEA 4DX8A 3FEHA 1UEFA 1KI1B 4A6KA 1XX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSU A;  2M14 A;  4GZU A;  1DYN A;  2YRY A;  4ZRK A;  2DHK A;  1V89 A;  3KSY A;  4DXA B;  2KGX B;  2DKP A;  2Z0Q A;  3LJU X;  2PZ1 A;  3ODO A;  4HAZ B;  2YS3 A;  2Y8G A;  1M7R A;  5D3X A;  4GXB A;  3RCP A;  1R8Q E;  3ZVR A;  4HB4 B;  4NSW A;  1KU1 A;  2L2I A;  2XQN M;  1ZC4 B;  2MDX A;  3BIN A;  3SUZ A;  2DX1 A;  1U5F A;  2GJY A;  2OTX A;  3KRX A;  3AU5 A;  3QWM A;  2DLW A;  1OMW A;  1FOE A;  4EMO A;  1W1D A;  2KCJ A;  5CLL B;  2IYB A;  4PQ0 A;  4YON A;  4WVF B;  5D27 A;  2YS5 A;  2VKI A;  1P5T A;  4HAU B;  2DYN A;  2YS1 A;  3N7C A;  4L6E A;  1SGH A;  3ODX A;  1KZG A;  3SNH A;  2D9Y A;  1RRP B;  1X05 A;  3TCA A;  1PLS A;  4C0A A;  4C7P A;  2VRW B;  2HE7 A;  1P3R A;  5DIF B;  3L8N A;  2LKO A;  3SV1 A;  3A8Q A;  1R8M E;  4IAP A;  1AQC A;  1XSZ A;  1X11 A;  4WJ7 A;  4D0N B;  1QC6 A;  3PVU A;  4MK0 A;  4JMO A;  1FGY A;  3PVL A;  4GN1 A;  1XOD A;  4D7R A;  3HK0 A;  2UVM A;  4IFS A;  1SHC A;  1FAO A;  2UZS A;  2YT1 A;  3QBV B;  1Q67 A;  3P6A A;  2MWN B;  1X86 A;  4HHV A;  4KHA A;  4EKU A;  1NI2 A;  2LYD A;  5JLJ B;  4HB0 B;  5EFX A;  1PMS A;  2COA A;  2P0F A;  4IOY X;  2COF A;  4GMV A;  2D2Q A;  2H7E A;  2RUK B;  2GS0 A;  2J0J A;  2DX5 A;  1Y19 B;  5KQ4 A;  5KCV A;  1FHW A;  3A8P A;  2CY5 A;  2Y7B A;  1U2B A;  2ELA A;  2YSZ A;  1MPH A;  1BWN A;  2P0H A;  2ROV A;  1XD4 A;  5HE2 A;  2Z0P A;  4F7U P;  2EMT A;  1RE0 B;  3VOQ A;  5LOP B;  1WGQ A;  3DXC A;  2R0D A;  2I5F A;  3D8F A;  3ML4 A;  5GOW B;  2AEH A;  5JHG A;  5KQ1 A;  3O96 A;  5CLQ B;  3LTL A;  4P7I A;  3KZ1 A;  1UNP A;  3G9W A;  3HQC A;  1DDV A;  3WA0 A;  5HE3 A;  2D9X A;  4K17 A;  1ZC3 B;  3TVV A;  4A6F A;  1GC6 A;  1R8S E;  1ISN A;  1BTK A;  1UPQ A;  2DHJ A;  3SWV A;  2D9W A;  2I1K A;  4GPT B;  3MPX A;  2HTH B;  1MKE A;  2RSG A;  2J59 M;  2V76 A;  2DYQ A;  2N23 A;  5DH9 B;  5C16 A;  1U5G A;  1NTV A;  1V61 A;  1BAK A;  1P6S A;  2OQB A;  5DHA B;  2DHI A;  2Y8F A;  1FGZ A;  2D9Z A;  3AJ4 A;  3DXD A;  4DBB A;  5D3Y A;  1GG3 A;  2W2X C;  5L81 A;  1FHX A;  2YVC A;  4WSF A;  1V5U A;  4TYZ A;  4BBK A;  2MFQ A;  2I5C A;  2FJL A;  2QKM A;  4JWL A;  4XWX A;  2YF0 A;  1MAI A;  1X1G A;  4K2P A;  4OIY A;  1DBH A;  3PSC A;  4Y94 A;  2VSZ A;  3U7D A;  1EF1 A;  4ZRJ A;  4ZRI A;  4A4P A;  2GCL A;  4B6H A;  4H8S A;  1XR0 B;  4NY0 A;  3ULB A;  2P8V A;  5C5B B;  1WI1 A;  2D9V A;  1V88 A;  1KZ7 A;  2COC A;  3ZDT A;  2UZR A;  4MT7 A;  2LUL A;  1DRO A;  1FHO A;  3PZD A;  3M1I B;  3F5R A;  4A5K A;  1ZSQ A;  2CAY A;  2H7D A;  4HAW B;  1EAZ A;  3HW2 B;  2AL6 A;  3KRW A;  4TKN A;  2NMB A;  3PG7 A;  2ADZ A;  5C79 A;  2DFK A;  4GMX B;  2D11 A;  4KAX B;  4HAV B;  1EGX A;  2IFS A;  3DXE A;  2L1C A;  2GCJ A;  4F7G A;  4Z2N A;  1K5D B;  2ELB A;  1DDM A;  1MIZ B;  5D3V A;  1TQZ A;  2W2X D;  1WJ1 A;  5HE1 A;  4EJN A;  1MIX A;  4A6H A;  2EMS A;  2DTC A;  4CHJ A;  1WG7 A;  4HB2 B;  1BTN A;  2EJ8 A;  2G35 A;  1LW3 A;  4HAY B;  1U29 A;  3GYO A;  3MDB C;  1U5D A;  2BCJ A;  1I2H A;  5DI9 B;  1BC9 A;  2CRF A;  3X23 A;  2MKR A;  3VIA A;  4HAX B;  3A98 B;  1OQN A;  2EC1 A;  1I7A A;  5FI1 A;  4D7Q A;  2M38 A;  5D3W A;  2DN6 A;  1XT0 B;  2D10 A;  5J3T A;  4PNK A;  2LG1 A;  2RNR B;  1IRS A;  2P0D A;  1DDW A;  5LON B;  4KHB B;  3ODW A;  3SO6 A;  3V5W A;  1N3H A;  3UZT A;  2D4Q A;  2LOZ A;  3D8D A;  3TFM A;  4HDQ A;  1X1F A;  1UNR A;  3BJI A;  4JXH A;  2YT0 A;  3F0W A;  3PVW A;  4HAT B;  4A6F B;  2J0M A;  1W1H A;  1ZM0 A;  5HE0 A;  2R09 A;  2ROZ B;  4Z21 A;  3TO1 A;  5J3Y A;  1PFJ A;  2KUP A;  1U5E A;  3PEG A;  3IVF A;  1XCG A;  2K2J A;  3FSS A;  1RJ2 A;  4K2O A;  2DKQ A;  1TJ6 A;  1Z87 A;  4CHM A;  1MK9 B;  2QKL A;  5FI0 A;  1V5M A;  3T06 A;  5JP4 A;  2RGN B;  1ZVR A;  4HDO A;  4K81 A;  2I1J A;  1FB8 A;  1V5P A;  2ZPY A;  1XKE A;  4JMI A;  5DHF B;  3KY9 A;  1QQG A;  2X18 A;  1Y5O A;  1J19 A;  1H10 A;  2Q13 A;  1W1G A;  1NU2 A;  2NZ8 B;  2DA0 A;  1M7E A;  4Z2M B;  3TW1 A;  3ULC A;  2RLO A;  2Z0O A;  2COD A;  3WYF B;  3CXB B;  5C5B A;  1U27 A;  2W2W A;  1TXD A;  2CY4 A;  5JHH A;  4DX9 0;  2RVB B;  3FM8 C;  1UPR A;  1OY2 A;  3P7Z A;  5C6R A;  5J3Q A;  3D8E A;  4KHO A;  2JP2 A;  4KVG B;  3U8Z A;  4L5M A;  1K5G B;  2E2X A;  3CIK A;  2N0Y A;  1EVH A;  1PBV A;  1WJM A;  3QIJ A;  1S9D E;  3AU4 A;  4MY6 A;  1WVH A;  1GC7 A;  4YL8 A;  3OAN A;  1NTY A;  1UNQ A;  4F7H A;  1MK7 B;  2K2U A;  1H4R A;  1B55 A;  1LB1 A;  1WGU A;  3GYP A;  2J0K A;  4HB3 B;  2K00 A;  3PP2 A;  1E5W A;  1J0W A;  3SYX A;  4CYE A;  2LOX A;  1AWE A;  4DX8 A;  3FEH A;  1UEF A;  1KI1 B;  4A6K A;  1XX0 A; 
#chains in the Genus database with same CATH topology
 3AO0 A;  3NSU A;  1YII A;  2M14 A;  4GZU A;  2KR0 A;  1T77 A;  1DYN A;  2YRY A;  4KMU X;  4ZRK A;  2DHK A;  1V89 A;  3KSY A;  1G5N A;  4DXA B;  2KGX B;  2DKP A;  2Z13 A;  2Z0Q A;  3LJU X;  5IRS A;  2PZ1 A;  3ODO A;  4HAZ B;  2YS3 A;  2Y8G A;  1M7R A;  5D3X A;  4GXB A;  3RCP A;  1R8Q E;  4D6W A;  3ZVR A;  4HB4 B;  4NSW A;  4GNK B;  1KU1 A;  2L2I A;  2XQN M;  1ZC4 B;  2MDX A;  3BIN A;  3SUZ A;  1DM5 A;  2DX1 A;  1U5F A;  1BC3 A;  2GJY A;  2OTX A;  2ZOC A;  3KRX A;  3AU5 A;  3QWM A;  4KHB A;  1I4A A;  2II2 A;  2DLW A;  1OMW A;  1FOE A;  4EMO A;  4FQ0 C;  2RRF A;  1W1D A;  2KCJ A;  5CLL B;  2IYB A;  4PQ0 A;  4YON A;  4WVF B;  5D27 A;  2YS5 A;  2VKI A;  1P5T A;  4HAU B;  2DYN A;  2YS1 A;  3N7C A;  4L6E A;  1BCY A;  1SGH A;  3ODX A;  1KZG A;  1SAV A;  3SNH A;  2D9Y A;  1RRP B;  1R4A E;  1X05 A;  1N44 A;  3TCA A;  1PLS A;  2IIC A;  4C0A A;  4C7P A;  2VRW B;  2HE7 A;  1P3R A;  5DIF B;  3L8N A;  2LKO A;  3SV1 A;  3A8Q A;  1R8M E;  4IAP A;  1ALA A;  1AQC A;  1ANX A;  1XSZ A;  4QJ3 B;  1X11 A;  4WJ7 A;  4D0N B;  1QC6 A;  3PVU A;  4MK0 A;  4JMO A;  1FGY A;  3PVL A;  1XOD A;  4GN1 A;  4D7R A;  3HK0 A;  2R2Y A;  4HSI A;  2UVM A;  4DIX A;  4IFS A;  1ANW A;  1SHC A;  1FAO A;  2UZS A;  2YT1 A;  3QBV B;  2HYU A;  1Q67 A;  3P6A A;  2MWN B;  1X86 A;  4HHV A;  3A58 A;  4KHA A;  1YCN A;  4EKU A;  1NI2 A;  2LYD A;  5JLJ B;  4HB0 B;  5EFX A;  2H0M A;  1PMS A;  2COA A;  2P0F A;  4IOY X;  1YGM A;  2COF A;  4GMV A;  2D2Q A;  2H7E A;  2GS0 A;  2J0J A;  3ABS A;  2RUK B;  2H0L A;  2DX5 A;  1Y19 B;  5KQ4 A;  5KCV A;  2K6X A;  1FHW A;  3A8P A;  2CY5 A;  2Y7B A;  2VXG A;  1U2B A;  2ELA A;  2YSZ A;  1MPH A;  2KIE A;  1BWN A;  2P0H A;  2ROV A;  2Z59 A;  1XD4 A;  5HE2 A;  2Z0P A;  4F7U P;  2EMT A;  3BRX A;  1DK5 A;  1RE0 B;  3ABR A;  1HM6 A;  3VOQ A;  5LOP B;  1WGQ A;  1M9I A;  3DXC A;  2IE6 A;  2R0D A;  4X9P A;  2I5F A;  3NW8 A;  3D8F A;  3ML4 A;  5GOW B;  2AEH A;  5JHG A;  5KQ1 A;  3O96 A;  4MDU A;  5CLQ B;  1N42 A;  3LTL A;  4P7I A;  4MDV A;  3KZ1 A;  1UNP A;  3G9W A;  3HQC A;  1DDV A;  2OY9 A;  1ZYI A;  3WA0 A;  5HE3 A;  2D9X A;  1YJ0 A;  4K17 A;  1ZC3 B;  3TVV A;  4A6F A;  1GC6 A;  1N41 A;  1R8S E;  1UPT B;  1ISN A;  1BTK A;  1UPQ A;  3SWV A;  3ABQ A;  2DHJ A;  2D9W A;  2I1K A;  4GPT B;  3MPX A;  2HTH B;  1AEI A;  2IE7 A;  3USY A;  1MKE A;  2RSG A;  2J59 M;  2V76 A;  2DYQ A;  2N23 A;  5DH9 B;  5C16 A;  1U5G A;  1NTV A;  1V61 A;  1BAK A;  2HYW A;  1P6S A;  2OQB A;  5DHA B;  2DHI A;  2Y8F A;  1FGZ A;  2D9Z A;  3AJ4 A;  3DXD A;  4DBB A;  5D3Y A;  1GG3 A;  2W2X C;  5L81 A;  2XO3 A;  1FHX A;  2YVC A;  4WSF A;  1V5U A;  4TYZ A;  4BBK A;  2MFQ A;  1HAK A;  2I5C A;  3HSA A;  4QJ4 B;  2FJL A;  2QKM A;  4JWL A;  4XWX A;  2YF0 A;  1MAI A;  1X1G A;  4K2P A;  4OIY A;  1DBH A;  3PSC A;  4Y94 A;  4Q2S A;  2VSZ A;  2K49 A;  3U7D A;  4FHR B;  1EF1 A;  4ZRJ A;  1BCZ A;  4ZRI A;  4A4P A;  2GCL A;  4B6H A;  4H8S A;  1XR0 B;  3NWD A;  4NY0 A;  3ULB A;  2P8V A;  2QEZ A;  5C5B B;  1WI1 A;  2D9V A;  4EVH A;  1V88 A;  2ZHI A;  1QC7 A;  3OHM B;  1KZ7 A;  1AOW A;  5I2S A;  3AJC A;  2COC A;  3ZDT A;  2UZR A;  4MT7 A;  2LUL A;  1DRO A;  1FHO A;  1HVE A;  3M1I B;  3PZD A;  3F5R A;  4A5K A;  1W3W A;  2XO2 A;  1ZSQ A;  1XJL A;  2CAY A;  2H7D A;  4HAW B;  1EAZ A;  3HW2 B;  1HVG A;  2AL6 A;  3KRW A;  4TKN A;  4QJ5 B;  2NMB A;  3PG7 A;  3U12 A;  2ADZ A;  4EVF A;  1HVF A;  5C79 A;  2DFK A;  4GMX B;  4HRE A;  2D11 A;  4KAX B;  4HAV B;  1EGX A;  2IFS A;  3DXE A;  2FJU B;  2KUQ A;  3HIE A;  2L1C A;  2GCJ A;  4F7G A;  4Z2N A;  1K5D B;  2ELB A;  1DDM A;  1MIZ B;  1BCW A;  5D3V A;  1TQZ A;  2W2X D;  1WJ1 A;  3FVC A;  5HE1 A;  4EJN A;  2H0K A;  1MIX A;  4A6H A;  5LG4 B;  2NBV A;  2EMS A;  2DTC A;  4CHJ A;  1WG7 A;  4HB2 B;  1BTN A;  2EJ8 A;  2G35 A;  2Z14 A;  1LW3 A;  4HAY B;  1W45 A;  1U29 A;  3GYO A;  2Q4C A;  3MDB C;  1U5D A;  1AII A;  2BCJ A;  1I2H A;  5DI9 B;  1BC9 A;  2HYV A;  2CRF A;  3TW5 A;  3X23 A;  2MKR A;  3VIA A;  4HAX B;  2Z4D A;  1OQN A;  3A98 B;  2EC1 A;  1I7A A;  1AVH A;  5FI1 A;  4D7Q A;  2YT2 A;  2M38 A;  5D3W A;  2DN6 A;  1XT0 B;  1C1K A;  2D10 A;  5J3T A;  2GUM A;  3ANY A;  4PNK A;  2LG1 A;  2RNR B;  1BO9 A;  1IRS A;  2P0D A;  1DDW A;  5LON B;  4KHB B;  4OT1 A;  3ODW A;  3SO6 A;  1A8B A;  3V5W A;  1N3H A;  3UZT A;  2D4Q A;  2LOZ A;  3D8D A;  3TFM A;  4HDQ A;  1X1F A;  3DCX A;  1UNR A;  3BJI A;  4JXH A;  2YT0 A;  1MCX A;  2RAN A;  3F0W A;  3PVW A;  4HAT B;  4A6F B;  2J0M A;  1W7B A;  3SOH B;  1W1H A;  2HSN A;  1ZM0 A;  5HE0 A;  5I2M A;  2R09 A;  2ROZ B;  4Z21 A;  4KN7 X;  3TO1 A;  5J3Y A;  1PFJ A;  2KUP A;  1U5E A;  5M4Y B;  3PEG A;  3IVF A;  1XCG A;  2K2J A;  3FSS A;  4JK1 X;  1RJ2 A;  3HJL A;  4K2O A;  2DKQ A;  1TJ6 A;  1Z87 A;  4CHM A;  1MK9 B;  1ANN A;  2QKL A;  5FI0 A;  1V5M A;  3T06 A;  5JP4 A;  1AXN A;  2RGN B;  1ZVR A;  4HDO A;  4K81 A;  1AVC A;  2I1J A;  1FB8 A;  1V5P A;  2ZPY A;  1XKE A;  1A8A A;  4JMI A;  5DHF B;  3KY9 A;  3USW A;  1Q8D A;  1QQG A;  2X18 A;  1Y5O A;  4L1R A;  1J19 A;  1H10 A;  2Q13 A;  1W1G A;  1NU2 A;  2NZ8 B;  1MI1 A;  1M7E A;  2DA0 A;  1BC1 A;  4Z2M B;  2RLO A;  3TW1 A;  2Z0O A;  3ULC A;  2COD A;  3WYF B;  3CXB B;  5C5B A;  1U27 A;  2W2W A;  1TXD A;  2CY4 A;  1BC0 A;  5JHH A;  3NWA A;  4DX9 0;  2RVB B;  1AVR A;  3FM8 C;  1UPR A;  4GOU A;  1OY2 A;  3P7Z A;  5C6R A;  5J3Q A;  3D8E A;  4KHO A;  2JP2 A;  4KVG B;  3U8Z A;  4L5M A;  1K5G B;  2E2X A;  3CIK A;  2N0Y A;  1EVH A;  1HVD A;  1PBV A;  1WJM A;  3NWF A;  3QIJ A;  1S9D E;  1LKV X;  2K8E A;  3AU4 A;  4MY6 A;  1WVH A;  2ZKM X;  3ABO A;  1GC7 A;  4YL8 A;  3OAN A;  1NTY A;  1UNQ A;  4F7H A;  1MK7 B;  4KN4 X;  2K2U A;  1H4R A;  1B55 A;  1LB1 A;  3B77 A;  1WGU A;  3GYP A;  4QXA B;  2J0K A;  4HB3 B;  2K00 A;  3PP2 A;  1E5W A;  1J0W A;  3SYX A;  4CSQ A;  4CYE A;  2ZHJ A;  2LOX A;  1AWE A;  1N00 A;  4DX8 A;  2KIG A;  3FEH A;  1UEF A;  1KI1 B;  4OSN A;  4A6K A;  1XX0 A; 
#chains in the Genus database with same CATH homology
 3NSU A;  2M14 A;  4GZU A;  1DYN A;  2YRY A;  4KMU X;  4ZRK A;  2DHK A;  1V89 A;  3KSY A;  4DXA B;  2KGX B;  2DKP A;  2Z0Q A;  3LJU X;  2PZ1 A;  3ODO A;  4HAZ B;  2YS3 A;  2Y8G A;  1M7R A;  5D3X A;  4GXB A;  3RCP A;  1R8Q E;  3ZVR A;  4HB4 B;  4NSW A;  1KU1 A;  2L2I A;  2XQN M;  1ZC4 B;  2MDX A;  3BIN A;  3SUZ A;  2DX1 A;  1U5F A;  2GJY A;  2OTX A;  3KRX A;  3AU5 A;  3QWM A;  2DLW A;  1OMW A;  1FOE A;  4EMO A;  4FQ0 C;  1W1D A;  2KCJ A;  5CLL B;  2IYB A;  4PQ0 A;  4YON A;  4WVF B;  5D27 A;  2YS5 A;  2VKI A;  1P5T A;  4HAU B;  2DYN A;  2YS1 A;  3N7C A;  4L6E A;  1SGH A;  3ODX A;  1KZG A;  3SNH A;  2D9Y A;  1RRP B;  1X05 A;  3TCA A;  1PLS A;  4C0A A;  4C7P A;  2VRW B;  2HE7 A;  1P3R A;  5DIF B;  3L8N A;  2LKO A;  3SV1 A;  3A8Q A;  1R8M E;  4IAP A;  1AQC A;  1XSZ A;  1X11 A;  4WJ7 A;  4D0N B;  1QC6 A;  3PVU A;  4MK0 A;  4JMO A;  1FGY A;  3PVL A;  1XOD A;  4GN1 A;  4D7R A;  3HK0 A;  2UVM A;  4IFS A;  1SHC A;  1FAO A;  2UZS A;  2YT1 A;  3QBV B;  1Q67 A;  3P6A A;  2MWN B;  1X86 A;  4HHV A;  4KHA A;  4EKU A;  1NI2 A;  2LYD A;  5JLJ B;  4HB0 B;  5EFX A;  1PMS A;  2COA A;  2P0F A;  4IOY X;  2COF A;  4GMV A;  2D2Q A;  2H7E A;  2RUK B;  2GS0 A;  2J0J A;  2DX5 A;  1Y19 B;  5KQ4 A;  5KCV A;  2K6X A;  1FHW A;  3A8P A;  2CY5 A;  2Y7B A;  1U2B A;  2ELA A;  2YSZ A;  1MPH A;  1BWN A;  2P0H A;  2ROV A;  1XD4 A;  5HE2 A;  2Z0P A;  4F7U P;  2EMT A;  1RE0 B;  3VOQ A;  5LOP B;  1WGQ A;  3DXC A;  2R0D A;  2I5F A;  3D8F A;  3ML4 A;  5GOW B;  2AEH A;  5JHG A;  5KQ1 A;  3O96 A;  5CLQ B;  3LTL A;  4P7I A;  3KZ1 A;  1UNP A;  3G9W A;  3HQC A;  1DDV A;  3WA0 A;  5HE3 A;  2D9X A;  4K17 A;  1ZC3 B;  3TVV A;  4A6F A;  1GC6 A;  1R8S E;  1ISN A;  1BTK A;  1UPQ A;  2DHJ A;  3SWV A;  2D9W A;  2I1K A;  4GPT B;  3MPX A;  2HTH B;  3USY A;  1MKE A;  2RSG A;  2J59 M;  2V76 A;  2DYQ A;  2N23 A;  5DH9 B;  5C16 A;  1U5G A;  1NTV A;  1V61 A;  1BAK A;  1P6S A;  2OQB A;  5DHA B;  2DHI A;  2Y8F A;  1FGZ A;  2D9Z A;  3AJ4 A;  3DXD A;  4DBB A;  5D3Y A;  1GG3 A;  2W2X C;  5L81 A;  1FHX A;  2YVC A;  4WSF A;  1V5U A;  4TYZ A;  4BBK A;  2MFQ A;  2I5C A;  2FJL A;  2QKM A;  4JWL A;  4XWX A;  2YF0 A;  1MAI A;  1X1G A;  4K2P A;  4OIY A;  1DBH A;  3PSC A;  4Y94 A;  2VSZ A;  3U7D A;  4FHR B;  1EF1 A;  4ZRJ A;  4ZRI A;  4A4P A;  2GCL A;  4B6H A;  4H8S A;  1XR0 B;  4NY0 A;  3ULB A;  2P8V A;  5C5B B;  1WI1 A;  2D9V A;  1V88 A;  1QC7 A;  1KZ7 A;  3AJC A;  2COC A;  3ZDT A;  2UZR A;  4MT7 A;  2LUL A;  1DRO A;  1FHO A;  3M1I B;  3PZD A;  3F5R A;  4A5K A;  1ZSQ A;  2CAY A;  2H7D A;  4HAW B;  1EAZ A;  3HW2 B;  2AL6 A;  3KRW A;  4TKN A;  2NMB A;  3PG7 A;  2ADZ A;  5C79 A;  2DFK A;  4GMX B;  2D11 A;  4KAX B;  4HAV B;  1EGX A;  2IFS A;  3DXE A;  2L1C A;  2GCJ A;  4F7G A;  4Z2N A;  1K5D B;  2ELB A;  1DDM A;  1MIZ B;  5D3V A;  1TQZ A;  2W2X D;  1WJ1 A;  5HE1 A;  4EJN A;  1MIX A;  4A6H A;  2EMS A;  2DTC A;  4CHJ A;  1WG7 A;  4HB2 B;  1BTN A;  2EJ8 A;  2G35 A;  1LW3 A;  4HAY B;  1U29 A;  3GYO A;  3MDB C;  1U5D A;  2BCJ A;  1I2H A;  5DI9 B;  1BC9 A;  2CRF A;  3TW5 A;  3X23 A;  2MKR A;  3VIA A;  4HAX B;  3A98 B;  1OQN A;  2EC1 A;  1I7A A;  5FI1 A;  4D7Q A;  2M38 A;  5D3W A;  2DN6 A;  1XT0 B;  2D10 A;  5J3T A;  4PNK A;  2LG1 A;  2RNR B;  1IRS A;  2P0D A;  1DDW A;  5LON B;  4KHB B;  3ODW A;  3SO6 A;  3V5W A;  1N3H A;  3UZT A;  2D4Q A;  2LOZ A;  3D8D A;  3TFM A;  4HDQ A;  1X1F A;  1UNR A;  3BJI A;  4JXH A;  2YT0 A;  3F0W A;  3PVW A;  4HAT B;  4A6F B;  2J0M A;  3SOH B;  1W1H A;  2HSN A;  1ZM0 A;  5HE0 A;  2R09 A;  2ROZ B;  4Z21 A;  4KN7 X;  3TO1 A;  5J3Y A;  1PFJ A;  2KUP A;  1U5E A;  3PEG A;  3IVF A;  1XCG A;  2K2J A;  3FSS A;  4JK1 X;  1RJ2 A;  3HJL A;  4K2O A;  2DKQ A;  1TJ6 A;  1Z87 A;  4CHM A;  1MK9 B;  2QKL A;  5FI0 A;  1V5M A;  3T06 A;  5JP4 A;  2RGN B;  1ZVR A;  4HDO A;  4K81 A;  2I1J A;  1FB8 A;  1V5P A;  2ZPY A;  1XKE A;  4JMI A;  5DHF B;  3KY9 A;  3USW A;  1Q8D A;  1QQG A;  2X18 A;  1Y5O A;  1J19 A;  1H10 A;  2Q13 A;  1W1G A;  1NU2 A;  2NZ8 B;  2DA0 A;  1M7E A;  4Z2M B;  3TW1 A;  3ULC A;  2RLO A;  2Z0O A;  2COD A;  3WYF B;  3CXB B;  5C5B A;  1U27 A;  2W2W A;  1TXD A;  2CY4 A;  5JHH A;  4DX9 0;  2RVB B;  3FM8 C;  1UPR A;  1OY2 A;  3P7Z A;  5C6R A;  5J3Q A;  3D8E A;  4KHO A;  2JP2 A;  4KVG B;  3U8Z A;  4L5M A;  1K5G B;  2E2X A;  3CIK A;  2N0Y A;  1EVH A;  1PBV A;  1WJM A;  3QIJ A;  1S9D E;  1LKV X;  3AU4 A;  4MY6 A;  1WVH A;  1GC7 A;  4YL8 A;  3OAN A;  1NTY A;  1UNQ A;  4F7H A;  1MK7 B;  4KN4 X;  2K2U A;  1H4R A;  1B55 A;  1LB1 A;  1WGU A;  3GYP A;  2J0K A;  4HB3 B;  2K00 A;  3PP2 A;  1E5W A;  1J0W A;  3SYX A;  4CYE A;  2LOX A;  1AWE A;  4DX8 A;  3FEH A;  1UEF A;  1KI1 B;  4A6K A;  1XX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...