2R0DA

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cytohesin-3
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
total genus 114
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r0dA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r0dA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r0dA03
2UZSA 4D7RA 3UZTA 1ISNA 3ULBA 5D3XA 1WG7A 5DHFB 2YF0A 3TW1A 2GS0A 3LTLA 2LOXA 3DXDA 4IFSA 5KCVA 2K2JA 2P0FA 1MIXA 1R8ME 2MWNB 3ZDTA 2OQBA 3ML4A 2ELAA 2YSZA 4A6KA 4BBKA 3MDBC 1M7RA 4C7PA 2LULA 2VRWB 2BCJA 5LONB 3M1IB 4A6HA 3KRXA 4D0NB 3FSSA 3GYOA 2K00A 3WA0A 4L5MA 1FHOA 3N7CA 2LKOA 3TCAA 1FGYA 4KAXB 1UEFA 1FHXA 1XX0A 3QIJA 2P0DA 1XSZA 4NY0A 1X1GA 3AJ4A 1X86A 1KI1B 1OY2A 1OMWA 1W1HA 1SGHA 2DA0A 2Z0QA 1GC6A 1FHWA 2OTXA 4HAXB 2ELBA 2RLOA 2D9YA 2KUPA 4GXBA 3TO1A 4WSFA 3DXEA 1BTKA 5CLLB 1H10A 1LW3A 5C16A 2IFSA 4MY6A 3KY9A 1X1FA 2J0MA 1ZC3B 3TFMA 3VOQA 1K5DB 1PFJA 4GMXB 1RJ2A 4EKUA 1Y19B 1XD4A 5HE1A 2MKRA 4YL8A 4EJNA 3PVWA 3GYPA 3SYXA 1MK9B 1U5EA 3KZ1A 5C5BA 3PSCA 2MFQA 3BINA 1EVHA 1U2BA 1DDVA 1MPHA 4DX90 5CLQB 1LB1A 5D3WA 2QKMA 2Q13A 2N0YA 4HAVB 2VKIA 5C6RA 2KGXB 3D8DA 1XKEA 4GZUA 4H8SA 2E2XA 4GPTB 3HK0A 2COCA 1X05A 2CRFA 1RE0B 2H7EA 2N23A 1DDWA 1I2HA 5HE0A 2DKPA 4HAWB 1J0WA 4F7UP 2GCLA 5DH9B 2COFA 4HB3B 3SWVA 2DX5A 1R8QE 3ODWA 4HB2B 5JHHA 3P6AA 2DLWA 2NZ8B 5J3YA 2ROZB 1AWEA 1V5UA 2HTHB 2W2XD 1U5FA 4DXAB 4GN1A 1K5GB 1X11A 1TQZA 2KCJA 1IRSA 2J59M 3F5RA 4KHBB 2RNRB 2D9XA 4HDOA 3SUZA 1BAKA 4WVFB 1FB8A 2AEHA 2DFKA 3MPXA 2YS3A 2K2UA 2DX1A 1XODA 1XCGA 4F7GA 2EJ8A 2RSGA 2HE7A 4JMIA 1MIZB 3QWMA 5D27A 1TJ6A 1AQCA 2I1JA 5HE2A 1MK7B 4HB0B 4KHOA 1MKEA 4HAZB 2I5CA 3BJIA 5J3TA 1P3RA 3T06A 2DHKA 1U5DA 2X18A 5C5BB 2IYBA 1WGQA 3SV1A 1UPRA 1E5WA 2DHJA 2YS5A 1EAZA 1DDMA 1RRPB 5FI1A 2DTCA 3A8PA 4TKNA 1B55A 2YS1A 4B6HA 4K2PA 1UNQA 3U7DA 2D4QA 1NI2A 2D11A 1EF1A 1UNRA 2Z0OA 3LJUX 2LOZA 3PVLA 1Q67A 4EMOA 2ZPYA 1WI1A 4XWXA 4DX8A 4C0AA 2UVMA 2YVCA 1V88A 1NTVA 1U29A 4MT7A 5HE3A 5KQ4A 3U8ZA 1P6SA 1S9DE 1KZ7A 3X23A 3AU4A 1QQGA 4P7IA 2J0KA 3HW2B 3FM8C 3ODOA 1J19A 1GG3A 1WGUA 4PQ0A 3CIKA 4PNKA 2MDXA 4KHAA 1MAIA 2Y8GA 5EFXA 1ZVRA 1DBHA 3KSYA 2D9ZA 1PLSA 2AL6A 4HATB 2RUKB 1W1DA 1BWNA 1UPQA 3CXBB 1V61A 1KZGA 2CODA 2Z0PA 3PVUA 3SNHA 4HHVA 2V76A 1UNPA 4Z2MB 1XT0B 4DBBA 4HAUB 2D9VA 2Y7BA 1R8SE 5JP4A 4CYEA 1TXDA 1M7EA 3SO6A 3QBVB 5D3YA 2CAYA 5D3VA 1V89A 3PEGA 1FOEA 2EMTA 3RCPA 2CY4A 5DI9B 3VIAA 4A5KA 2VSZA 2DYQA 5L81A 2H7DA 3FEHA 1NU2A 3KRWA 1SHCA 2L2IA 1ZM0A 5FI0A 4MK0A 3F0WA 4JMOA 4IOYX 5KQ1A 4JWLA 4CHMA 1DYNA 1KU1A 2YRYA 5JLJB 4A6FA 4Y94A 1ZSQA 3ULCA 1BC9A 3O96A 2D10A 1XR0B 4GMVA 2Y8FA 4IAPA 2DYNA 3WYFB 2NMBA 3D8FA 2DN6A 4OIYA 4L6EA 2L1CA 1P5TA 4JXHA 2CY5A 3ZVRA 2DHIA 4ZRKA 4HB4B 2G35A 1V5PA 2P8VA 5J3QA 1PBVA 5DIFB 1NTYA 2ADZA 2YT1A 2J0JA 4HAYB 3DXCA 4A4PA 1DROA 2R0DA 3TVVA 1GC7A 1EGXA 4Z2NA 2GJYA 3P7ZA 1OQNA 2I1KA 3ODXA 1Z87A 4K2OA 4YONA 5C79A 2EC1A 3A8QA 4ZRJA 3A98B 4HDQA 2P0HA 3PP2A 1V5MA 2LG1A 2UZRA 3V5WA 2YT0A 2R09A 4KVGB 2I5FA 4WJ7A 2ROVA 3NSUA 3PG7A 1QC6A 1WJMA 2M38A 3PZDA 1H4RA 4CHJA 2QKLA 1U27A 2RVBB 2XQNM 1W1GA 3L8NA 4D7QA 4K81A 1U5GA 1PMSA 2FJLA 2GCJA 2W2XC 4F7HA 4K17A 4Z21A 5JHGA 5LOPB 2PZ1A 1WVHA 1I7AA 2JP2A 3D8EA 2DKQA 1FGZA 2D9WA 2D2QA 3HQCA 1BTNA 1Y5OA 1FAOA 3AU5A 3G9WA 1WJ1A 3OANA 5GOWB 2LYDA 1N3HA 3IVFA 4A6FB 2M14A 2COAA 4NSWA 2W2WA 1ZC4B 4TYZA 2RGNB 5DHAB 2EMSA 4ZRIA
chains in the Genus database with same CATH superfamily
2UZSA 4D7RA 3UZTA 1ISNA 3ULBA 5D3XA 1AXNA 1WG7A 2YF0A 5DHFB 3HJLA 2GS0A 3TW1A 3LTLA 2LOXA 2ZOCA 1BC1A 3DXDA 4IFSA 5KCVA 2QEZA 2K2JA 2P0FA 1MIXA 1R8ME 2MWNB 3ZDTA 2OQBA 3ML4A 2ZHJA 4FHRB 2ELAA 2YSZA 4A6KA 4BBKA 3MDBC 1M7RA 4C7PA 2LULA 2VRWB 2BCJA 5LONB 3M1IB 4A6HA 3KRXA 4D0NB 3FSSA 3GYOA 1ALAA 2K00A 4JK1X 3WA0A 4L5MA 4MDUA 1FHOA 2H0LA 2LKOA 3N7CA 3TCAA 1FGYA 4KAXB 1UEFA 1FHXA 1XX0A 3QIJA 2P0DA 1XSZA 2II2A 4NY0A 1X1GA 1A8BA 3AJ4A 2ZHIA 1X86A 1KI1B 1OY2A 1OMWA 1W1HA 1SGHA 2DA0A 1SAVA 2Q4CA 2Z0QA 1GC6A 1FHWA 4Q2SA 2OTXA 4HAXB 2ELBA 2RLOA 4HSIA 2RANA 2D9YA 1W45A 4KHBA 2KUPA 4GXBA 3TO1A 4WSFA 1YCNA 3DXEA 1BTKA 5CLLB 1YJ0A 1YIIA 1Q8DA 1H10A 1LW3A 5C16A 2IFSA 3OHMB 1AIIA 4MY6A 3KY9A 1X1FA 2J0MA 1ZC3B 4QXAB 3TFMA 3VOQA 1K5DB 1PFJA 4GMXB 1RJ2A 4EKUA 1Y19B 1BC0A 3USWA 1XD4A 5HE1A 2Z13A 2MKRA 4YL8A 4EJNA 3PVWA 3NWDA 3GYPA 1N00A 3SYXA 1HVDA 1MK9B 4KMUX 1U5EA 4GOUA 3KZ1A 2KUQA 5C5BA 3PSCA 2MFQA 4QJ5B 3BINA 4KN4X 1EVHA 1U2BA 1DDVA 1MPHA 2K49A 4DX90 5I2MA 5CLQB 1LB1A 2Z59A 5D3WA 2QKMA 2Q13A 2N0YA 4HAVB 2VKIA 5C6RA 2KGXB 3D8DA 3ABRA 1XKEA 2H0KA 4X9PA 4GZUA 4H8SA 2IICA 1ZYIA 2GUMA 2E2XA 4GPTB 3HK0A 3ANYA 2COCA 1X05A 2CRFA 1HVEA 1AVCA 1RE0B 2H7EA 2N23A 1DDWA 1R4AE 1I2HA 5HE0A 2DKPA 1AOWA 4HAWB 1J0WA 4F7UP 1AVHA 3AJCA 2GCLA 3HSAA 5DH9B 1C1KA 2COFA 4HB3B 3SWVA 1BO9A 2DX5A 2Z14A 1R8QE 1QC7A 3ODWA 4HB2B 5JHHA 2K6XA 3P6AA 2DLWA 1LKVX 2RRFA 2NZ8B 5J3YA 2HYWA 2ROZB 1AWEA 1V5UA 2HTHB 2W2XD 4D6WA 1U5FA 4DXAB 4GN1A 1K5GB 1X11A 1TQZA 2KCJA 3FVCA 1IRSA 2J59M 3F5RA 4KHBB 4QJ4B 2RNRB 2D9XA 4EVFA 3BRXA 4HDOA 2IE6A 1MI1A 3SUZA 1BAKA 5I2SA 4WVFB 1FB8A 2AEHA 2DFKA 3MPXA 2YS3A 2K2UA 2DX1A 1N42A 1XODA 1N44A 1XCGA 4F7GA 2EJ8A 2RSGA 2HE7A 4L1RA 4JMIA 1MIZB 3QWMA 5D27A 1TJ6A 4QJ3B 1AQCA 2I1JA 5HE2A 1AEIA 3B77A 1MK7B 4HB0B 4KHOA 3NWAA 1MKEA 2OY9A 3A58A 4HAZB 2I5CA 3BJIA 5J3TA 1P3RA 3T06A 2DHKA 1U5DA 2X18A 5C5BB 2IYBA 1WGQA 3SV1A 1UPRA 1E5WA 2DHJA 2YS5A 1EAZA 1DDMA 1RRPB 5FI1A 2DTCA 3A8PA 4TKNA 1B55A 2YS1A 4B6HA 4K2PA 1UNQA 3U7DA 2D4QA 1NI2A 2D11A 1EF1A 1UNRA 2Z0OA 3LJUX 2LOZA 3U12A 3PVLA 1Q67A 4EMOA 1HVFA 2ZPYA 1WI1A 4XWXA 4DX8A 4C0AA 2UVMA 2YVCA 1V88A 1NTVA 1XJLA 1YGMA 1U29A 4MT7A 5HE3A 5KQ4A 3U8ZA 1P6SA 1S9DE 1BCWA 1KZ7A 3X23A 3AU4A 1QQGA 5IRSA 3SOHB 4P7IA 2J0KA 2HYUA 3HW2B 3FM8C 2FJUB 3ODOA 1J19A 1W7BA 1GG3A 1WGUA 4PQ0A 3CIKA 4PNKA 2MDXA 1BC3A 4KHAA 1MAIA 2NBVA 2Y8GA 1HAKA 5EFXA 1ZVRA 1UPTB 1DBHA 3KSYA 2VXGA 2D9ZA 1PLSA 2AL6A 4HATB 2RUKB 1M9IA 1DK5A 1W1DA 1AVRA 1BWNA 1UPQA 3NW8A 3CXBB 2Z4DA 1V61A 1KZGA 2CODA 2Z0PA 3PVUA 3SNHA 4HHVA 2V76A 1UNPA 4Z2MB 1XT0B 4GNKB 4DBBA 4HAUB 2D9VA 2Y7BA 1R8SE 5JP4A 4CYEA 1TXDA 1M7EA 3SO6A 3QBVB 5D3YA 2CAYA 5D3VA 3ABOA 1V89A 3PEGA 1FOEA 2EMTA 3RCPA 2IE7A 1ANXA 1G5NA 2CY4A 5DI9B 3VIAA 4A5KA 2VSZA 2DYQA 2XO2A 5L81A 2H7DA 3FEHA 1NU2A 3KRWA 1SHCA 2KIGA 2L2IA 4KN7X 1HVGA 3ABQA 1ZM0A 5FI0A 4MK0A 3F0WA 4EVHA 4JMOA 4OSNA 4IOYX 5KQ1A 4JWLA 2HSNA 4CHMA 1DYNA 1KU1A 2YRYA 3ABSA 4A6FA 1N41A 5JLJB 4Y94A 1ZSQA 3ULCA 1BC9A 3O96A 2D10A 1XR0B 4GMVA 2Y8FA 4IAPA 2DYNA 3WYFB 2NMBA 3D8FA 2DN6A 1A8AA 2KR0A 4OIYA 4L6EA 2L1CA 4HREA 1P5TA 4JXHA 2CY5A 3ZVRA 2DHIA 3AO0A 4ZRKA 4HB4B 2XO3A 2G35A 1V5PA 2P8VA 5J3QA 1PBVA 5DIFB 1NTYA 2ADZA 2YT1A 2J0JA 4HAYB 3DXCA 4A4PA 1DROA 2R0DA 3TVVA 1GC7A 1EGXA 4Z2NA 5M4YB 2GJYA 3P7ZA 1OQNA 2I1KA 3ODXA 1Z87A 4MDVA 4K2OA 4YONA 5C79A 2EC1A 1HM6A 3A8QA 1ANWA 4ZRJA 3A98B 4HDQA 2P0HA 3PP2A 1V5MA 2KIEA 2LG1A 3NWFA 2UZRA 3V5WA 2YT0A 2R09A 4KVGB 2I5FA 1I4AA 4WJ7A 2ROVA 3NSUA 3PG7A 1W3WA 1QC6A 1WJMA 2M38A 3PZDA 3USYA 1H4RA 2QKLA 1U27A 2RVBB 4CHJA 2XQNM 1W1GA 3L8NA 4D7QA 3DCXA 4K81A 1BCZA 1U5GA 1PMSA 2FJLA 2GCJA 2R2YA 2YT2A 2W2XC 3HIEA 4F7HA 4K17A 1BCYA 1MCXA 4Z21A 5JHGA 5LOPB 2PZ1A 1ANNA 4OT1A 4CSQA 1T77A 5LG4B 1WVHA 1I7AA 2JP2A 3D8EA 2H0MA 2HYVA 4DIXA 3TW5A 2DKQA 1FGZA 2D9WA 2D2QA 4FQ0C 3HQCA 1BTNA 1Y5OA 1FAOA 3AU5A 3G9WA 1WJ1A 3OANA 5GOWB 2K8EA 2LYDA 1N3HA 3IVFA 4A6FB 2M14A 1DM5A 2COAA 4NSWA 2W2WA 2ZKMX 1ZC4B 4TYZA 2RGNB 5DHAB 2EMSA 4ZRIA
chains in the Genus database with same CATH topology
2UZSA 4D7RA 3UZTA 1ISNA 3ULBA 5D3XA 1WG7A 5DHFB 2YF0A 3TW1A 3HJLA 2GS0A 3LTLA 2LOXA 3DXDA 4IFSA 5KCVA 2K2JA 2P0FA 1MIXA 1R8ME 2MWNB 3ZDTA 2OQBA 3ML4A 4FHRB 2ELAA 2YSZA 4A6KA 4BBKA 3MDBC 1M7RA 4C7PA 2LULA 2VRWB 2BCJA 5LONB 3M1IB 4A6HA 3KRXA 4D0NB 3FSSA 3GYOA 2K00A 4JK1X 3WA0A 4L5MA 1FHOA 3N7CA 2LKOA 3TCAA 1FGYA 4KAXB 1UEFA 1FHXA 1XX0A 3QIJA 2P0DA 1XSZA 4NY0A 1X1GA 3AJ4A 1X86A 1KI1B 1OY2A 1OMWA 1W1HA 1SGHA 2DA0A 2Z0QA 1GC6A 1FHWA 2OTXA 4HAXB 2ELBA 2RLOA 2D9YA 2KUPA 4GXBA 3TO1A 4WSFA 3DXEA 1BTKA 5CLLB 1Q8DA 1H10A 1LW3A 5C16A 2IFSA 4MY6A 3KY9A 1X1FA 2J0MA 1ZC3B 3TFMA 3VOQA 1K5DB 1PFJA 4GMXB 1RJ2A 4EKUA 1Y19B 3USWA 1XD4A 5HE1A 2MKRA 4YL8A 4EJNA 3PVWA 3GYPA 3SYXA 1MK9B 1U5EA 4KMUX 3KZ1A 5C5BA 3PSCA 2MFQA 3BINA 4KN4X 1EVHA 1U2BA 1DDVA 1MPHA 4DX90 5CLQB 1LB1A 5D3WA 2QKMA 2Q13A 2N0YA 4HAVB 2VKIA 5C6RA 2KGXB 3D8DA 1XKEA 4GZUA 4H8SA 2E2XA 4GPTB 3HK0A 2COCA 1X05A 2CRFA 1RE0B 2H7EA 2N23A 1DDWA 1I2HA 5HE0A 2DKPA 4HAWB 1J0WA 4F7UP 3AJCA 2GCLA 5DH9B 2COFA 4HB3B 3SWVA 2DX5A 1R8QE 1QC7A 3ODWA 4HB2B 5JHHA 2K6XA 3P6AA 2DLWA 1LKVX 2NZ8B 5J3YA 2ROZB 1AWEA 1V5UA 2HTHB 2W2XD 1U5FA 4DXAB 4GN1A 1K5GB 1X11A 1TQZA 2KCJA 1IRSA 2J59M 3F5RA 4KHBB 2RNRB 2D9XA 4HDOA 3SUZA 1BAKA 4WVFB 1FB8A 2AEHA 2DFKA 3MPXA 2YS3A 2K2UA 2DX1A 1XODA 1XCGA 4F7GA 2EJ8A 2RSGA 2HE7A 4JMIA 1MIZB 3QWMA 5D27A 1TJ6A 1AQCA 2I1JA 5HE2A 1MK7B 4HB0B 4KHOA 1MKEA 4HAZB 2I5CA 3BJIA 5J3TA 1P3RA 3T06A 2DHKA 1U5DA 2X18A 5C5BB 2IYBA 1WGQA 3SV1A 1UPRA 1E5WA 2DHJA 2YS5A 1EAZA 1DDMA 1RRPB 5FI1A 2DTCA 3A8PA 4TKNA 1B55A 2YS1A 4B6HA 4K2PA 1UNQA 3U7DA 2D4QA 1NI2A 2D11A 1EF1A 1UNRA 2Z0OA 3LJUX 2LOZA 3PVLA 1Q67A 4EMOA 2ZPYA 1WI1A 4XWXA 4DX8A 4C0AA 2UVMA 2YVCA 1V88A 1NTVA 1U29A 4MT7A 5HE3A 5KQ4A 3U8ZA 1P6SA 1S9DE 1KZ7A 3X23A 3AU4A 1QQGA 3SOHB 4P7IA 2J0KA 3HW2B 3FM8C 3ODOA 1J19A 1GG3A 1WGUA 4PQ0A 3CIKA 4PNKA 2MDXA 4KHAA 1MAIA 2Y8GA 5EFXA 1ZVRA 1DBHA 3KSYA 2D9ZA 1PLSA 2AL6A 4HATB 2RUKB 1W1DA 1BWNA 1UPQA 3CXBB 1V61A 1KZGA 2CODA 2Z0PA 3PVUA 3SNHA 4HHVA 2V76A 1UNPA 4Z2MB 1XT0B 4DBBA 4HAUB 2D9VA 2Y7BA 1R8SE 5JP4A 4CYEA 1TXDA 1M7EA 3SO6A 3QBVB 5D3YA 2CAYA 5D3VA 1V89A 3PEGA 1FOEA 2EMTA 3RCPA 2CY4A 5DI9B 3VIAA 4A5KA 2VSZA 2DYQA 5L81A 2H7DA 3FEHA 1NU2A 3KRWA 1SHCA 2L2IA 4KN7X 1ZM0A 5FI0A 4MK0A 3F0WA 4JMOA 4IOYX 5KQ1A 4JWLA 2HSNA 4CHMA 1KU1A 1DYNA 2YRYA 5JLJB 4A6FA 4Y94A 1ZSQA 3ULCA 1BC9A 3O96A 2D10A 1XR0B 4GMVA 2Y8FA 4IAPA 2DYNA 3WYFB 2NMBA 3D8FA 2DN6A 4OIYA 4L6EA 2L1CA 1P5TA 4JXHA 2CY5A 3ZVRA 2DHIA 4ZRKA 4HB4B 2G35A 1V5PA 2P8VA 5J3QA 1PBVA 5DIFB 1NTYA 2ADZA 2YT1A 2J0JA 4HAYB 3DXCA 4A4PA 1DROA 2R0DA 3TVVA 1GC7A 1EGXA 4Z2NA 2GJYA 3P7ZA 1OQNA 2I1KA 3ODXA 1Z87A 4K2OA 4YONA 5C79A 2EC1A 3A8QA 4ZRJA 3A98B 4HDQA 2P0HA 3PP2A 1V5MA 2LG1A 2UZRA 3V5WA 2YT0A 2R09A 4KVGB 2I5FA 4WJ7A 2ROVA 3NSUA 3PG7A 1QC6A 1WJMA 2M38A 3PZDA 3USYA 1H4RA 2QKLA 1U27A 2RVBB 4CHJA 2XQNM 1W1GA 3L8NA 4D7QA 4K81A 1U5GA 1PMSA 2FJLA 2GCJA 2W2XC 4F7HA 4K17A 4Z21A 5JHGA 5LOPB 2PZ1A 1WVHA 1I7AA 2JP2A 3D8EA 3TW5A 2DKQA 1FGZA 2D9WA 2D2QA 4FQ0C 3HQCA 1BTNA 1Y5OA 1FAOA 3AU5A 3G9WA 1WJ1A 3OANA 5GOWB 2LYDA 1N3HA 3IVFA 4A6FB 2M14A 2COAA 4NSWA 2W2WA 1ZC4B 4TYZA 2RGNB 5DHAB 2EMSA 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZS A;  4D7R A;  3UZT A;  1ISN A;  3ULB A;  5D3X A;  1WG7 A;  5DHF B;  2YF0 A;  3TW1 A;  2GS0 A;  3LTL A;  2LOX A;  3DXD A;  4IFS A;  5KCV A;  2K2J A;  2P0F A;  1MIX A;  1R8M E;  2MWN B;  3ZDT A;  2OQB A;  3ML4 A;  2ELA A;  2YSZ A;  4A6K A;  4BBK A;  3MDB C;  1M7R A;  4C7P A;  2LUL A;  2VRW B;  2BCJ A;  5LON B;  3M1I B;  4A6H A;  3KRX A;  4D0N B;  3FSS A;  3GYO A;  2K00 A;  3WA0 A;  4L5M A;  1FHO A;  3N7C A;  2LKO A;  3TCA A;  1FGY A;  4KAX B;  1UEF A;  1FHX A;  1XX0 A;  3QIJ A;  2P0D A;  1XSZ A;  4NY0 A;  1X1G A;  3AJ4 A;  1X86 A;  1KI1 B;  1OY2 A;  1OMW A;  1W1H A;  1SGH A;  2DA0 A;  2Z0Q A;  1GC6 A;  1FHW A;  2OTX A;  4HAX B;  2ELB A;  2RLO A;  2D9Y A;  2KUP A;  4GXB A;  3TO1 A;  4WSF A;  3DXE A;  1BTK A;  5CLL B;  1H10 A;  1LW3 A;  5C16 A;  2IFS A;  4MY6 A;  3KY9 A;  1X1F A;  2J0M A;  1ZC3 B;  3TFM A;  3VOQ A;  1K5D B;  1PFJ A;  4GMX B;  1RJ2 A;  4EKU A;  1Y19 B;  1XD4 A;  5HE1 A;  2MKR A;  4YL8 A;  4EJN A;  3PVW A;  3GYP A;  3SYX A;  1MK9 B;  1U5E A;  3KZ1 A;  5C5B A;  3PSC A;  2MFQ A;  3BIN A;  1EVH A;  1U2B A;  1DDV A;  1MPH A;  4DX9 0;  5CLQ B;  1LB1 A;  5D3W A;  2QKM A;  2Q13 A;  2N0Y A;  4HAV B;  2VKI A;  5C6R A;  2KGX B;  3D8D A;  1XKE A;  4GZU A;  4H8S A;  2E2X A;  4GPT B;  3HK0 A;  2COC A;  1X05 A;  2CRF A;  1RE0 B;  2H7E A;  2N23 A;  1DDW A;  1I2H A;  5HE0 A;  2DKP A;  4HAW B;  1J0W A;  4F7U P;  2GCL A;  5DH9 B;  2COF A;  4HB3 B;  3SWV A;  2DX5 A;  1R8Q E;  3ODW A;  4HB2 B;  5JHH A;  3P6A A;  2DLW A;  2NZ8 B;  5J3Y A;  2ROZ B;  1AWE A;  1V5U A;  2HTH B;  2W2X D;  1U5F A;  4DXA B;  4GN1 A;  1K5G B;  1X11 A;  1TQZ A;  2KCJ A;  1IRS A;  2J59 M;  3F5R A;  4KHB B;  2RNR B;  2D9X A;  4HDO A;  3SUZ A;  1BAK A;  4WVF B;  1FB8 A;  2AEH A;  2DFK A;  3MPX A;  2YS3 A;  2K2U A;  2DX1 A;  1XOD A;  1XCG A;  4F7G A;  2EJ8 A;  2RSG A;  2HE7 A;  4JMI A;  1MIZ B;  3QWM A;  5D27 A;  1TJ6 A;  1AQC A;  2I1J A;  5HE2 A;  1MK7 B;  4HB0 B;  4KHO A;  1MKE A;  4HAZ B;  2I5C A;  3BJI A;  5J3T A;  1P3R A;  3T06 A;  2DHK A;  1U5D A;  2X18 A;  5C5B B;  2IYB A;  1WGQ A;  3SV1 A;  1UPR A;  1E5W A;  2DHJ A;  2YS5 A;  1EAZ A;  1DDM A;  1RRP B;  5FI1 A;  2DTC A;  3A8P A;  4TKN A;  1B55 A;  2YS1 A;  4B6H A;  4K2P A;  1UNQ A;  3U7D A;  2D4Q A;  1NI2 A;  2D11 A;  1EF1 A;  1UNR A;  2Z0O A;  3LJU X;  2LOZ A;  3PVL A;  1Q67 A;  4EMO A;  2ZPY A;  1WI1 A;  4XWX A;  4DX8 A;  4C0A A;  2UVM A;  2YVC A;  1V88 A;  1NTV A;  1U29 A;  4MT7 A;  5HE3 A;  5KQ4 A;  3U8Z A;  1P6S A;  1S9D E;  1KZ7 A;  3X23 A;  3AU4 A;  1QQG A;  4P7I A;  2J0K A;  3HW2 B;  3FM8 C;  3ODO A;  1J19 A;  1GG3 A;  1WGU A;  4PQ0 A;  3CIK A;  4PNK A;  2MDX A;  4KHA A;  1MAI A;  2Y8G A;  5EFX A;  1ZVR A;  1DBH A;  3KSY A;  2D9Z A;  1PLS A;  2AL6 A;  4HAT B;  2RUK B;  1W1D A;  1BWN A;  1UPQ A;  3CXB B;  1V61 A;  1KZG A;  2COD A;  2Z0P A;  3PVU A;  3SNH A;  4HHV A;  2V76 A;  1UNP A;  4Z2M B;  1XT0 B;  4DBB A;  4HAU B;  2D9V A;  2Y7B A;  1R8S E;  5JP4 A;  4CYE A;  1TXD A;  1M7E A;  3SO6 A;  3QBV B;  5D3Y A;  2CAY A;  5D3V A;  1V89 A;  3PEG A;  1FOE A;  2EMT A;  3RCP A;  2CY4 A;  5DI9 B;  3VIA A;  4A5K A;  2VSZ A;  2DYQ A;  5L81 A;  2H7D A;  3FEH A;  1NU2 A;  3KRW A;  1SHC A;  2L2I A;  1ZM0 A;  5FI0 A;  4MK0 A;  3F0W A;  4JMO A;  4IOY X;  5KQ1 A;  4JWL A;  4CHM A;  1DYN A;  1KU1 A;  2YRY A;  5JLJ B;  4A6F A;  4Y94 A;  1ZSQ A;  3ULC A;  1BC9 A;  3O96 A;  2D10 A;  1XR0 B;  4GMV A;  2Y8F A;  4IAP A;  2DYN A;  3WYF B;  2NMB A;  3D8F A;  2DN6 A;  4OIY A;  4L6E A;  2L1C A;  1P5T A;  4JXH A;  2CY5 A;  3ZVR A;  2DHI A;  4ZRK A;  4HB4 B;  2G35 A;  1V5P A;  2P8V A;  5J3Q A;  1PBV A;  5DIF B;  1NTY A;  2ADZ A;  2YT1 A;  2J0J A;  4HAY B;  3DXC A;  4A4P A;  1DRO A;  2R0D A;  3TVV A;  1GC7 A;  1EGX A;  4Z2N A;  2GJY A;  3P7Z A;  1OQN A;  2I1K A;  3ODX A;  1Z87 A;  4K2O A;  4YON A;  5C79 A;  2EC1 A;  3A8Q A;  4ZRJ A;  3A98 B;  4HDQ A;  2P0H A;  3PP2 A;  1V5M A;  2LG1 A;  2UZR A;  3V5W A;  2YT0 A;  2R09 A;  4KVG B;  2I5F A;  4WJ7 A;  2ROV A;  3NSU A;  3PG7 A;  1QC6 A;  1WJM A;  2M38 A;  3PZD A;  1H4R A;  4CHJ A;  2QKL A;  1U27 A;  2RVB B;  2XQN M;  1W1G A;  3L8N A;  4D7Q A;  4K81 A;  1U5G A;  1PMS A;  2FJL A;  2GCJ A;  2W2X C;  4F7H A;  4K17 A;  4Z21 A;  5JHG A;  5LOP B;  2PZ1 A;  1WVH A;  1I7A A;  2JP2 A;  3D8E A;  2DKQ A;  1FGZ A;  2D9W A;  2D2Q A;  3HQC A;  1BTN A;  1Y5O A;  1FAO A;  3AU5 A;  3G9W A;  1WJ1 A;  3OAN A;  5GOW B;  2LYD A;  1N3H A;  3IVF A;  4A6F B;  2M14 A;  2COA A;  4NSW A;  2W2W A;  1ZC4 B;  4TYZ A;  2RGN B;  5DHA B;  2EMS A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 2UZS A;  4D7R A;  3UZT A;  1ISN A;  3ULB A;  5D3X A;  1AXN A;  1WG7 A;  2YF0 A;  5DHF B;  3HJL A;  2GS0 A;  3TW1 A;  3LTL A;  2LOX A;  2ZOC A;  1BC1 A;  3DXD A;  4IFS A;  5KCV A;  2QEZ A;  2K2J A;  2P0F A;  1MIX A;  1R8M E;  2MWN B;  3ZDT A;  2OQB A;  3ML4 A;  2ZHJ A;  4FHR B;  2ELA A;  2YSZ A;  4A6K A;  4BBK A;  3MDB C;  1M7R A;  4C7P A;  2LUL A;  2VRW B;  2BCJ A;  5LON B;  3M1I B;  4A6H A;  3KRX A;  4D0N B;  3FSS A;  3GYO A;  1ALA A;  2K00 A;  4JK1 X;  3WA0 A;  4L5M A;  4MDU A;  1FHO A;  2H0L A;  2LKO A;  3N7C A;  3TCA A;  1FGY A;  4KAX B;  1UEF A;  1FHX A;  1XX0 A;  3QIJ A;  2P0D A;  1XSZ A;  2II2 A;  4NY0 A;  1X1G A;  1A8B A;  3AJ4 A;  2ZHI A;  1X86 A;  1KI1 B;  1OY2 A;  1OMW A;  1W1H A;  1SGH A;  2DA0 A;  1SAV A;  2Q4C A;  2Z0Q A;  1GC6 A;  1FHW A;  4Q2S A;  2OTX A;  4HAX B;  2ELB A;  2RLO A;  4HSI A;  2RAN A;  2D9Y A;  1W45 A;  4KHB A;  2KUP A;  4GXB A;  3TO1 A;  4WSF A;  1YCN A;  3DXE A;  1BTK A;  5CLL B;  1YJ0 A;  1YII A;  1Q8D A;  1H10 A;  1LW3 A;  5C16 A;  2IFS A;  3OHM B;  1AII A;  4MY6 A;  3KY9 A;  1X1F A;  2J0M A;  1ZC3 B;  4QXA B;  3TFM A;  3VOQ A;  1K5D B;  1PFJ A;  4GMX B;  1RJ2 A;  4EKU A;  1Y19 B;  1BC0 A;  3USW A;  1XD4 A;  5HE1 A;  2Z13 A;  2MKR A;  4YL8 A;  4EJN A;  3PVW A;  3NWD A;  3GYP A;  1N00 A;  3SYX A;  1HVD A;  1MK9 B;  4KMU X;  1U5E A;  4GOU A;  3KZ1 A;  2KUQ A;  5C5B A;  3PSC A;  2MFQ A;  4QJ5 B;  3BIN A;  4KN4 X;  1EVH A;  1U2B A;  1DDV A;  1MPH A;  2K49 A;  4DX9 0;  5I2M A;  5CLQ B;  1LB1 A;  2Z59 A;  5D3W A;  2QKM A;  2Q13 A;  2N0Y A;  4HAV B;  2VKI A;  5C6R A;  2KGX B;  3D8D A;  3ABR A;  1XKE A;  2H0K A;  4X9P A;  4GZU A;  4H8S A;  2IIC A;  1ZYI A;  2GUM A;  2E2X A;  4GPT B;  3HK0 A;  3ANY A;  2COC A;  1X05 A;  2CRF A;  1HVE A;  1AVC A;  1RE0 B;  2H7E A;  2N23 A;  1DDW A;  1R4A E;  1I2H A;  5HE0 A;  2DKP A;  1AOW A;  4HAW B;  1J0W A;  4F7U P;  1AVH A;  3AJC A;  2GCL A;  3HSA A;  5DH9 B;  1C1K A;  2COF A;  4HB3 B;  3SWV A;  1BO9 A;  2DX5 A;  2Z14 A;  1R8Q E;  1QC7 A;  3ODW A;  4HB2 B;  5JHH A;  2K6X A;  3P6A A;  2DLW A;  1LKV X;  2RRF A;  2NZ8 B;  5J3Y A;  2HYW A;  2ROZ B;  1AWE A;  1V5U A;  2HTH B;  2W2X D;  4D6W A;  1U5F A;  4DXA B;  4GN1 A;  1K5G B;  1X11 A;  1TQZ A;  2KCJ A;  3FVC A;  1IRS A;  2J59 M;  3F5R A;  4KHB B;  4QJ4 B;  2RNR B;  2D9X A;  4EVF A;  3BRX A;  4HDO A;  2IE6 A;  1MI1 A;  3SUZ A;  1BAK A;  5I2S A;  4WVF B;  1FB8 A;  2AEH A;  2DFK A;  3MPX A;  2YS3 A;  2K2U A;  2DX1 A;  1N42 A;  1XOD A;  1N44 A;  1XCG A;  4F7G A;  2EJ8 A;  2RSG A;  2HE7 A;  4L1R A;  4JMI A;  1MIZ B;  3QWM A;  5D27 A;  1TJ6 A;  4QJ3 B;  1AQC A;  2I1J A;  5HE2 A;  1AEI A;  3B77 A;  1MK7 B;  4HB0 B;  4KHO A;  3NWA A;  1MKE A;  2OY9 A;  3A58 A;  4HAZ B;  2I5C A;  3BJI A;  5J3T A;  1P3R A;  3T06 A;  2DHK A;  1U5D A;  2X18 A;  5C5B B;  2IYB A;  1WGQ A;  3SV1 A;  1UPR A;  1E5W A;  2DHJ A;  2YS5 A;  1EAZ A;  1DDM A;  1RRP B;  5FI1 A;  2DTC A;  3A8P A;  4TKN A;  1B55 A;  2YS1 A;  4B6H A;  4K2P A;  1UNQ A;  3U7D A;  2D4Q A;  1NI2 A;  2D11 A;  1EF1 A;  1UNR A;  2Z0O A;  3LJU X;  2LOZ A;  3U12 A;  3PVL A;  1Q67 A;  4EMO A;  1HVF A;  2ZPY A;  1WI1 A;  4XWX A;  4DX8 A;  4C0A A;  2UVM A;  2YVC A;  1V88 A;  1NTV A;  1XJL A;  1YGM A;  1U29 A;  4MT7 A;  5HE3 A;  5KQ4 A;  3U8Z A;  1P6S A;  1S9D E;  1BCW A;  1KZ7 A;  3X23 A;  3AU4 A;  1QQG A;  5IRS A;  3SOH B;  4P7I A;  2J0K A;  2HYU A;  3HW2 B;  3FM8 C;  2FJU B;  3ODO A;  1J19 A;  1W7B A;  1GG3 A;  1WGU A;  4PQ0 A;  3CIK A;  4PNK A;  2MDX A;  1BC3 A;  4KHA A;  1MAI A;  2NBV A;  2Y8G A;  1HAK A;  5EFX A;  1ZVR A;  1UPT B;  1DBH A;  3KSY A;  2VXG A;  2D9Z A;  1PLS A;  2AL6 A;  4HAT B;  2RUK B;  1M9I A;  1DK5 A;  1W1D A;  1AVR A;  1BWN A;  1UPQ A;  3NW8 A;  3CXB B;  2Z4D A;  1V61 A;  1KZG A;  2COD A;  2Z0P A;  3PVU A;  3SNH A;  4HHV A;  2V76 A;  1UNP A;  4Z2M B;  1XT0 B;  4GNK B;  4DBB A;  4HAU B;  2D9V A;  2Y7B A;  1R8S E;  5JP4 A;  4CYE A;  1TXD A;  1M7E A;  3SO6 A;  3QBV B;  5D3Y A;  2CAY A;  5D3V A;  3ABO A;  1V89 A;  3PEG A;  1FOE A;  2EMT A;  3RCP A;  2IE7 A;  1ANX A;  1G5N A;  2CY4 A;  5DI9 B;  3VIA A;  4A5K A;  2VSZ A;  2DYQ A;  2XO2 A;  5L81 A;  2H7D A;  3FEH A;  1NU2 A;  3KRW A;  1SHC A;  2KIG A;  2L2I A;  4KN7 X;  1HVG A;  3ABQ A;  1ZM0 A;  5FI0 A;  4MK0 A;  3F0W A;  4EVH A;  4JMO A;  4OSN A;  4IOY X;  5KQ1 A;  4JWL A;  2HSN A;  4CHM A;  1DYN A;  1KU1 A;  2YRY A;  3ABS A;  4A6F A;  1N41 A;  5JLJ B;  4Y94 A;  1ZSQ A;  3ULC A;  1BC9 A;  3O96 A;  2D10 A;  1XR0 B;  4GMV A;  2Y8F A;  4IAP A;  2DYN A;  3WYF B;  2NMB A;  3D8F A;  2DN6 A;  1A8A A;  2KR0 A;  4OIY A;  4L6E A;  2L1C A;  4HRE A;  1P5T A;  4JXH A;  2CY5 A;  3ZVR A;  2DHI A;  3AO0 A;  4ZRK A;  4HB4 B;  2XO3 A;  2G35 A;  1V5P A;  2P8V A;  5J3Q A;  1PBV A;  5DIF B;  1NTY A;  2ADZ A;  2YT1 A;  2J0J A;  4HAY B;  3DXC A;  4A4P A;  1DRO A;  2R0D A;  3TVV A;  1GC7 A;  1EGX A;  4Z2N A;  5M4Y B;  2GJY A;  3P7Z A;  1OQN A;  2I1K A;  3ODX A;  1Z87 A;  4MDV A;  4K2O A;  4YON A;  5C79 A;  2EC1 A;  1HM6 A;  3A8Q A;  1ANW A;  4ZRJ A;  3A98 B;  4HDQ A;  2P0H A;  3PP2 A;  1V5M A;  2KIE A;  2LG1 A;  3NWF A;  2UZR A;  3V5W A;  2YT0 A;  2R09 A;  4KVG B;  2I5F A;  1I4A A;  4WJ7 A;  2ROV A;  3NSU A;  3PG7 A;  1W3W A;  1QC6 A;  1WJM A;  2M38 A;  3PZD A;  3USY A;  1H4R A;  2QKL A;  1U27 A;  2RVB B;  4CHJ A;  2XQN M;  1W1G A;  3L8N A;  4D7Q A;  3DCX A;  4K81 A;  1BCZ A;  1U5G A;  1PMS A;  2FJL A;  2GCJ A;  2R2Y A;  2YT2 A;  2W2X C;  3HIE A;  4F7H A;  4K17 A;  1BCY A;  1MCX A;  4Z21 A;  5JHG A;  5LOP B;  2PZ1 A;  1ANN A;  4OT1 A;  4CSQ A;  1T77 A;  5LG4 B;  1WVH A;  1I7A A;  2JP2 A;  3D8E A;  2H0M A;  2HYV A;  4DIX A;  3TW5 A;  2DKQ A;  1FGZ A;  2D9W A;  2D2Q A;  4FQ0 C;  3HQC A;  1BTN A;  1Y5O A;  1FAO A;  3AU5 A;  3G9W A;  1WJ1 A;  3OAN A;  5GOW B;  2K8E A;  2LYD A;  1N3H A;  3IVF A;  4A6F B;  2M14 A;  1DM5 A;  2COA A;  4NSW A;  2W2W A;  2ZKM X;  1ZC4 B;  4TYZ A;  2RGN B;  5DHA B;  2EMS A;  4ZRI A; 
#chains in the Genus database with same CATH homology
 2UZS A;  4D7R A;  3UZT A;  1ISN A;  3ULB A;  5D3X A;  1WG7 A;  5DHF B;  2YF0 A;  3TW1 A;  3HJL A;  2GS0 A;  3LTL A;  2LOX A;  3DXD A;  4IFS A;  5KCV A;  2K2J A;  2P0F A;  1MIX A;  1R8M E;  2MWN B;  3ZDT A;  2OQB A;  3ML4 A;  4FHR B;  2ELA A;  2YSZ A;  4A6K A;  4BBK A;  3MDB C;  1M7R A;  4C7P A;  2LUL A;  2VRW B;  2BCJ A;  5LON B;  3M1I B;  4A6H A;  3KRX A;  4D0N B;  3FSS A;  3GYO A;  2K00 A;  4JK1 X;  3WA0 A;  4L5M A;  1FHO A;  3N7C A;  2LKO A;  3TCA A;  1FGY A;  4KAX B;  1UEF A;  1FHX A;  1XX0 A;  3QIJ A;  2P0D A;  1XSZ A;  4NY0 A;  1X1G A;  3AJ4 A;  1X86 A;  1KI1 B;  1OY2 A;  1OMW A;  1W1H A;  1SGH A;  2DA0 A;  2Z0Q A;  1GC6 A;  1FHW A;  2OTX A;  4HAX B;  2ELB A;  2RLO A;  2D9Y A;  2KUP A;  4GXB A;  3TO1 A;  4WSF A;  3DXE A;  1BTK A;  5CLL B;  1Q8D A;  1H10 A;  1LW3 A;  5C16 A;  2IFS A;  4MY6 A;  3KY9 A;  1X1F A;  2J0M A;  1ZC3 B;  3TFM A;  3VOQ A;  1K5D B;  1PFJ A;  4GMX B;  1RJ2 A;  4EKU A;  1Y19 B;  3USW A;  1XD4 A;  5HE1 A;  2MKR A;  4YL8 A;  4EJN A;  3PVW A;  3GYP A;  3SYX A;  1MK9 B;  1U5E A;  4KMU X;  3KZ1 A;  5C5B A;  3PSC A;  2MFQ A;  3BIN A;  4KN4 X;  1EVH A;  1U2B A;  1DDV A;  1MPH A;  4DX9 0;  5CLQ B;  1LB1 A;  5D3W A;  2QKM A;  2Q13 A;  2N0Y A;  4HAV B;  2VKI A;  5C6R A;  2KGX B;  3D8D A;  1XKE A;  4GZU A;  4H8S A;  2E2X A;  4GPT B;  3HK0 A;  2COC A;  1X05 A;  2CRF A;  1RE0 B;  2H7E A;  2N23 A;  1DDW A;  1I2H A;  5HE0 A;  2DKP A;  4HAW B;  1J0W A;  4F7U P;  3AJC A;  2GCL A;  5DH9 B;  2COF A;  4HB3 B;  3SWV A;  2DX5 A;  1R8Q E;  1QC7 A;  3ODW A;  4HB2 B;  5JHH A;  2K6X A;  3P6A A;  2DLW A;  1LKV X;  2NZ8 B;  5J3Y A;  2ROZ B;  1AWE A;  1V5U A;  2HTH B;  2W2X D;  1U5F A;  4DXA B;  4GN1 A;  1K5G B;  1X11 A;  1TQZ A;  2KCJ A;  1IRS A;  2J59 M;  3F5R A;  4KHB B;  2RNR B;  2D9X A;  4HDO A;  3SUZ A;  1BAK A;  4WVF B;  1FB8 A;  2AEH A;  2DFK A;  3MPX A;  2YS3 A;  2K2U A;  2DX1 A;  1XOD A;  1XCG A;  4F7G A;  2EJ8 A;  2RSG A;  2HE7 A;  4JMI A;  1MIZ B;  3QWM A;  5D27 A;  1TJ6 A;  1AQC A;  2I1J A;  5HE2 A;  1MK7 B;  4HB0 B;  4KHO A;  1MKE A;  4HAZ B;  2I5C A;  3BJI A;  5J3T A;  1P3R A;  3T06 A;  2DHK A;  1U5D A;  2X18 A;  5C5B B;  2IYB A;  1WGQ A;  3SV1 A;  1UPR A;  1E5W A;  2DHJ A;  2YS5 A;  1EAZ A;  1DDM A;  1RRP B;  5FI1 A;  2DTC A;  3A8P A;  4TKN A;  1B55 A;  2YS1 A;  4B6H A;  4K2P A;  1UNQ A;  3U7D A;  2D4Q A;  1NI2 A;  2D11 A;  1EF1 A;  1UNR A;  2Z0O A;  3LJU X;  2LOZ A;  3PVL A;  1Q67 A;  4EMO A;  2ZPY A;  1WI1 A;  4XWX A;  4DX8 A;  4C0A A;  2UVM A;  2YVC A;  1V88 A;  1NTV A;  1U29 A;  4MT7 A;  5HE3 A;  5KQ4 A;  3U8Z A;  1P6S A;  1S9D E;  1KZ7 A;  3X23 A;  3AU4 A;  1QQG A;  3SOH B;  4P7I A;  2J0K A;  3HW2 B;  3FM8 C;  3ODO A;  1J19 A;  1GG3 A;  1WGU A;  4PQ0 A;  3CIK A;  4PNK A;  2MDX A;  4KHA A;  1MAI A;  2Y8G A;  5EFX A;  1ZVR A;  1DBH A;  3KSY A;  2D9Z A;  1PLS A;  2AL6 A;  4HAT B;  2RUK B;  1W1D A;  1BWN A;  1UPQ A;  3CXB B;  1V61 A;  1KZG A;  2COD A;  2Z0P A;  3PVU A;  3SNH A;  4HHV A;  2V76 A;  1UNP A;  4Z2M B;  1XT0 B;  4DBB A;  4HAU B;  2D9V A;  2Y7B A;  1R8S E;  5JP4 A;  4CYE A;  1TXD A;  1M7E A;  3SO6 A;  3QBV B;  5D3Y A;  2CAY A;  5D3V A;  1V89 A;  3PEG A;  1FOE A;  2EMT A;  3RCP A;  2CY4 A;  5DI9 B;  3VIA A;  4A5K A;  2VSZ A;  2DYQ A;  5L81 A;  2H7D A;  3FEH A;  1NU2 A;  3KRW A;  1SHC A;  2L2I A;  4KN7 X;  1ZM0 A;  5FI0 A;  4MK0 A;  3F0W A;  4JMO A;  4IOY X;  5KQ1 A;  4JWL A;  2HSN A;  4CHM A;  1KU1 A;  1DYN A;  2YRY A;  5JLJ B;  4A6F A;  4Y94 A;  1ZSQ A;  3ULC A;  1BC9 A;  3O96 A;  2D10 A;  1XR0 B;  4GMV A;  2Y8F A;  4IAP A;  2DYN A;  3WYF B;  2NMB A;  3D8F A;  2DN6 A;  4OIY A;  4L6E A;  2L1C A;  1P5T A;  4JXH A;  2CY5 A;  3ZVR A;  2DHI A;  4ZRK A;  4HB4 B;  2G35 A;  1V5P A;  2P8V A;  5J3Q A;  1PBV A;  5DIF B;  1NTY A;  2ADZ A;  2YT1 A;  2J0J A;  4HAY B;  3DXC A;  4A4P A;  1DRO A;  2R0D A;  3TVV A;  1GC7 A;  1EGX A;  4Z2N A;  2GJY A;  3P7Z A;  1OQN A;  2I1K A;  3ODX A;  1Z87 A;  4K2O A;  4YON A;  5C79 A;  2EC1 A;  3A8Q A;  4ZRJ A;  3A98 B;  4HDQ A;  2P0H A;  3PP2 A;  1V5M A;  2LG1 A;  2UZR A;  3V5W A;  2YT0 A;  2R09 A;  4KVG B;  2I5F A;  4WJ7 A;  2ROV A;  3NSU A;  3PG7 A;  1QC6 A;  1WJM A;  2M38 A;  3PZD A;  3USY A;  1H4R A;  2QKL A;  1U27 A;  2RVB B;  4CHJ A;  2XQN M;  1W1G A;  3L8N A;  4D7Q A;  4K81 A;  1U5G A;  1PMS A;  2FJL A;  2GCJ A;  2W2X C;  4F7H A;  4K17 A;  4Z21 A;  5JHG A;  5LOP B;  2PZ1 A;  1WVH A;  1I7A A;  2JP2 A;  3D8E A;  3TW5 A;  2DKQ A;  1FGZ A;  2D9W A;  2D2Q A;  4FQ0 C;  3HQC A;  1BTN A;  1Y5O A;  1FAO A;  3AU5 A;  3G9W A;  1WJ1 A;  3OAN A;  5GOW B;  2LYD A;  1N3H A;  3IVF A;  4A6F B;  2M14 A;  2COA A;  4NSW A;  2W2W A;  1ZC4 B;  4TYZ A;  2RGN B;  5DHA B;  2EMS A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...