2R0DA

Crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
343
structure length
343
Chain Sequence
GHHHHHHGSTTQRNAQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytohesin-3
publication title Structural Basis and Mechanism of Autoregulation in 3-Phosphoinositide-Dependent Grp1 Family Arf GTPase Exchange Factors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 114
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2r0dA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 2r0dA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2r0dA03
4JWLA 5HE0A 4F7HA 3FEHA 3KZ1A 3TW1A 2HE7A 4Z2MB 3MDBC 2DX5A 2P8VA 1Y19B 2I1JA 3PVWA 4HAZB 3TVVA 1UNPA 3ODOA 4A6FA 3BINA 4ZRIA 1RRPB 1U5GA 5DH9B 1U5EA 4HATB 3HQCA 2KGXB 1ZM0A 1XT0B 2COFA 2YRYA 2J0KA 1PLSA 4H8SA 1U5FA 1R8SE 3QBVB 1N3HA 3RCPA 2R09A 3DXEA 4DX90 2DTCA 1TJ6A 1NTYA 4WSFA 2CY4A 2UZRA 3WA0A 3GYPA 5J3QA 1FHOA 3T06A 2OTXA 5KQ4A 2YS3A 5FI0A 1WJ1A 4HB4B 4D7RA 1P6SA 4K2PA 3D8FA 3DXCA 3PVLA 1MIZB 1U29A 5C5BA 2DHKA 3VIAA 2PZ1A 1PMSA 2ELBA 2H7DA 3ODWA 2LOXA 1EVHA 1KI1B 2ZPYA 2EJ8A 1NU2A 4MT7A 1FOEA 2L2IA 5HE3A 1S9DE 2MDXA 3MPXA 5LONB 1IRSA 3L8NA 2KCJA 2DYNA 1Z87A 4WJ7A 1LW3A 1X1FA 4HAWB 1TXDA 2D9WA 5C6RA 1XSZA 2W2XC 4YONA 1XODA 4D0NB 1AQCA 2W2WA 2LG1A 2H7EA 1DBHA 1V5PA 3PSCA 4CYEA 1TQZA 5GOWB 2DHJA 4WVFB 2FJLA 2MWNB 3M1IB 3D8EA 3SO6A 1X11A 5D3WA 1M7RA 2ROZB 2AL6A 4TKNA 3U7DA 1KZ7A 1WJMA 4L6EA 4HHVA 1I2HA 3D8DA 3SWVA 1X1GA 2R0DA 2VRWB 1H10A 4P7IA 2M14A 1WVHA 2GS0A 1E5WA 1ZC3B 3HW2B 2W2XD 2CY5A 4K2OA 3ML4A 2DKQA 1DDVA 1MPHA 4D7QA 1BTKA 2OQBA 4HAVB 1MAIA 3UZTA 1V5MA 2YT0A 1BC9A 1Y5OA 4C0AA 1Q67A 1P5TA 2LULA 2ROVA 3FM8C 1DDMA 1XX0A 4OIYA 2P0DA 3QIJA 2UVMA 1FGYA 2YF0A 1V61A 2COCA 1SHCA 1SGHA 4HAYB 3TCAA 1K5DB 2N23A 2K2JA 2P0HA 4Y94A 4EMOA 2LKOA 3F0WA 2HTHB 2KUPA 4MK0A 2Y7BA 1FAOA 4A6HA 2RUKB 3KRWA 5FI1A 1PBVA 4C7PA 1GC7A 1RJ2A 4K81A 5LOPB 2DA0A 2YS1A 1ZVRA 2J0JA 2EMTA 5CLQB 1MIXA 1OY2A 5D3YA 1P3RA 2K2UA 3PVUA 3ZDTA 5CLLB 1QC6A 1UNQA 2ADZA 3V5WA 2DFKA 1AWEA 1XR0B 4KHAA 4L5MA 5DIFB 2GCLA 3DXDA 3ODXA 1ZSQA 4KVGB 4KHOA 5EFXA 1UNRA 1ZC4B 2M38A 1DROA 4HB3B 4HAUB 4GPTB 4KHBB 2D4QA 4F7UP 4KAXB 3BJIA 1BAKA 2Z0PA 2DN6A 3NSUA 2RNRB 2CAYA 3OANA 4IAPA 2YVCA 3HK0A 2IFSA 5D3XA 2NZ8B 3PZDA 4HDQA 2Y8FA 4DX8A 1KU1A 4MY6A 4NSWA 2IYBA 1XKEA 3P6AA 2RVBB 3O96A 3IVFA 4GXBA 1U5DA 3A8QA 5KQ1A 3SV1A 3LJUX 4B6HA 1UPQA 4ZRJA 4HB0B 2D10A 1RE0B 1KZGA 1U27A 4JMIA 4PQ0A 2I5FA 2VSZA 3CXBB 3AU4A 3N7CA 1I7AA 4JXHA 3TFMA 1B55A 4A6KA 4Z21A 1WI1A 4JMOA 5D3VA 4GZUA 2D9VA 1OMWA 1EF1A 2J59M 4K17A 2V76A 4CHJA 5C79A 1WGQA 2COAA 1V89A 1EGXA 2CRFA 2DYQA 2Z0OA 2D11A 3P7ZA 2I1KA 1GC6A 1U2BA 1J19A 2K00A 4Z2NA 1FGZA 1DYNA 2DLWA 3PG7A 2P0FA 5HE2A 5C16A 5KCVA 3KRXA 1W1GA 2QKMA 2ELAA 4GMVA 3A8PA 2AEHA 3WYFB 3SUZA 3TO1A 1V88A 2EC1A 3PEGA 1BWNA 3VOQA 3SYXA 5L81A 2JP2A 2EMSA 1DDWA 1EAZA 1QQGA 5HE1A 1FHWA 1M7EA 3FSSA 2RLOA 4EKUA 4PNKA 2MKRA 4A4PA 2N0YA 4TYZA 1LB1A 1UPRA 4A5KA 1WG7A 3A98B 3ULCA 2DX1A 1WGUA 2D9YA 2RSGA 4F7GA 5JHHA 4XWXA 3G9WA 2BCJA 4EJNA 1X05A 2Q13A 1ISNA 3AU5A 3F5RA 2GCJA 1X86A 2L1CA 2MFQA 2LYDA 5JHGA 2VKIA 4ZRKA 2GJYA 4DXAB 2G35A 4YL8A 1XD4A 3LTLA 2DHIA 2YS5A 4DBBA 3X23A 2I5CA 1BTNA 4GN1A 1R8QE 3GYOA 4CHMA 4GMXB 3SNHA 2DKPA 1K5GB 3QWMA 2QKLA 3KY9A 2YT1A 1H4RA 5J3TA 5DI9B 3KSYA 4A6FB 1XCGA 2Z0QA 1MK9B 2LOZA 3AJ4A 2J0MA 2XQNM 1V5UA 2X18A 1W1HA 1PFJA 3PP2A 2D9XA 2UZSA 5JLJB 3CIKA 1MK7B 2Y8GA 4IOYX 5D27A 5DHAB 5JP4A 1W1DA 4NY0A 5J3YA 4HB2B 2CODA 2D9ZA 1GG3A 1FB8A 1J0WA 1MKEA 2NMBA 4HAXB 3U8ZA 1FHXA 4BBKA 1OQNA 2YSZA 1UEFA 2E2XA 1NTVA 3ZVRA 2D2QA 1R8ME 3ULBA 1NI2A 5DHFB 5C5BB 4IFSA 4HDOA 2RGNB
chains in the Genus database with same CATH superfamily
4JWLA 5HE0A 4F7HA 3FEHA 3KZ1A 3TW1A 1W7BA 2HE7A 2IICA 4Z2MB 2ZKMX 3MDBC 4QJ5B 2Z14A 2DX5A 2P8VA 1Y19B 2I1JA 3PVWA 4HAZB 3TVVA 1UNPA 3ODOA 4A6FA 3BINA 5I2MA 4ZRIA 1RRPB 1U5GA 5DH9B 1BCWA 1U5EA 4HATB 3HQCA 2R2YA 2KIEA 2KGXB 1ZM0A 2ZHIA 1XT0B 2COFA 2YRYA 2J0KA 1PLSA 4H8SA 1U5FA 1R8SE 3QBVB 1N3HA 3RCPA 2R09A 3DXEA 4DX90 2DTCA 1TJ6A 1NTYA 4WSFA 2CY4A 4MDVA 2UZRA 3WA0A 3GYPA 5J3QA 1FHOA 3T06A 1Q8DA 2OTXA 5KQ4A 1AVHA 2YS3A 5FI0A 2ZHJA 1WJ1A 4HB4B 4D7RA 4KN7X 1P6SA 4K2PA 3D8FA 3DXCA 3PVLA 1MIZB 1U29A 5C5BA 2DHKA 2FJUB 1PMSA 2PZ1A 2ELBA 3VIAA 2H7DA 3ODWA 2LOXA 3ABSA 4QJ4B 1EVHA 1M9IA 1KI1B 2ZPYA 2EJ8A 4QJ3B 1NU2A 4MT7A 1FOEA 2L2IA 5HE3A 1S9DE 2MDXA 3MPXA 5LONB 1IRSA 3L8NA 2KCJA 2DYNA 1Z87A 4WJ7A 1ANWA 1LW3A 1X1FA 4HAWB 1TXDA 2HYVA 2D9WA 5C6RA 1XSZA 4KN4X 2W2XC 4YONA 1XODA 4D0NB 1AQCA 2W2WA 2LG1A 2H7EA 1DBHA 2QEZA 1V5PA 3PSCA 1BO9A 4CYEA 1TQZA 4QXAB 3ANYA 3TW5A 5GOWB 2DHJA 4WVFB 4CSQA 2NBVA 2FJLA 1N41A 2MWNB 3M1IB 3D8EA 3SO6A 2VXGA 1X11A 2HSNA 1M7RA 5D3WA 2ROZB 2AL6A 1DM5A 4TKNA 3U7DA 1KZ7A 3ABQA 1WJMA 4L6EA 4HHVA 1I2HA 3D8DA 3SWVA 1X1GA 2R0DA 2VRWB 1H10A 3ABRA 4HREA 2M14A 3NW8A 4P7IA 2XO3A 1WVHA 2GS0A 2ZOCA 1E5WA 1ZC3B 3HW2B 2W2XD 1SAVA 2CY5A 4K2OA 3ML4A 2DKQA 1DDVA 1MPHA 4D7QA 1BTKA 1HVDA 2OQBA 3HSAA 4HAVB 1HVFA 2II2A 1MAIA 3UZTA 1V5MA 2YT0A 1C1KA 1BC9A 1ANNA 1Y5OA 2K49A 4C0AA 1Q67A 3NWFA 1BCZA 2YT2A 1P5TA 2LULA 2ROVA 3FM8C 1DDMA 1XX0A 4OIYA 2P0DA 4EVHA 3QIJA 2UVMA 3B77A 1MCXA 1FGYA 2YF0A 1HM6A 1V61A 2COCA 1SHCA 1SGHA 4HAYB 3TCAA 1K5DB 2N23A 2K2JA 1AEIA 2P0HA 4Y94A 4EMOA 2LKOA 3F0WA 2HTHB 2KUPA 4MK0A 2Y7BA 1FAOA 4A6HA 2RUKB 1G5NA 3KRWA 1W3WA 5FI1A 1PBVA 4C7PA 1GC7A 1RJ2A 4K81A 5LOPB 2OY9A 2DA0A 2YS1A 1ZVRA 2J0JA 2EMTA 5CLQB 1MIXA 1OY2A 5D3YA 1P3RA 2K2UA 3PVUA 3ZDTA 1AOWA 5CLLB 1QC6A 1UNQA 2ADZA 3V5WA 1ZYIA 2DFKA 1AWEA 1XR0B 4KHAA 4DIXA 4L5MA 5DIFB 2GCLA 1AIIA 3DXDA 3ODXA 1ZSQA 4KVGB 4KHOA 5EFXA 1UNRA 1ZC4B 2H0LA 2IE6A 2M38A 1DROA 4HB3B 4HAUB 4GPTB 4KHBB 3USYA 2H0KA 2D4QA 1DK5A 3BJIA 4KAXB 1YJ0A 4F7UP 1BAKA 2Z0PA 2DN6A 3NSUA 1ALAA 2RNRB 1AVCA 2CAYA 3OANA 4IAPA 3A58A 2YVCA 3HK0A 2IFSA 5D3XA 2NZ8B 4L1RA 1LKVX 2RANA 4EVFA 3PZDA 4HDQA 2Y8FA 1YGMA 2HYWA 4DX8A 1KU1A 1N42A 4MY6A 4NSWA 2IYBA 1XKEA 3P6AA 2RVBB 3DCXA 3O96A 3IVFA 4GXBA 1U5DA 3A8QA 5KQ1A 3SV1A 3LJUX 4B6HA 1UPQA 4ZRJA 4HB0B 1ANXA 2D10A 1RE0B 1KZGA 1U27A 4JMIA 4PQ0A 2I5FA 2VSZA 3CXBB 3AU4A 2K8EA 3N7CA 1I7AA 4JXHA 3TFMA 1B55A 1AVRA 4A6KA 4Z21A 1UPTB 4KMUX 4Q2SA 1HVEA 1WI1A 3FVCA 4JMOA 5D3VA 4GZUA 2D9VA 3AJCA 1EF1A 1OMWA 2J59M 2V76A 4K17A 4CHJA 5C79A 1WGQA 2COAA 1V89A 1EGXA 2GUMA 2CRFA 2DYQA 2Z0OA 2D11A 3P7ZA 2I1KA 1GC6A 1U2BA 1J19A 1QC7A 2K00A 4Z2NA 1FGZA 1DYNA 2DLWA 3PG7A 2H0MA 2P0FA 5HE2A 1R4AE 4HSIA 5C16A 5KCVA 1N44A 3KRXA 3SOHB 1W1GA 2QKMA 2ELAA 4GMVA 3A8PA 2AEHA 3NWAA 3WYFB 3SUZA 3TO1A 1V88A 2EC1A 3PEGA 1BWNA 2KR0A 3SYXA 3VOQA 5L81A 3HIEA 3USWA 2JP2A 2EMSA 2Z13A 1DDWA 1EAZA 1QQGA 5HE1A 1A8BA 1FHWA 1M7EA 3FSSA 2RLOA 4EKUA 4PNKA 2MKRA 1YCNA 4A4PA 2N0YA 1I4AA 2Z59A 4TYZA 1LB1A 1UPRA 4A5KA 2RGNB 1HAKA 1WG7A 5LG4B 3A98B 4MDUA 3ULCA 5I2SA 2DX1A 1WGUA 4FHRB 2D9YA 4D6WA 2RSGA 4F7GA 5JHHA 1BC0A 4XWXA 3G9WA 2BCJA 2XO2A 4EJNA 1X05A 2Q13A 1ISNA 3AU5A 3F5RA 2GCJA 1X86A 2L1CA 2MFQA 3NWDA 2LYDA 5JHGA 1YIIA 2VKIA 4JK1X 4ZRKA 2Z4DA 2K6XA 2GJYA 4DXAB 2G35A 4YL8A 1XD4A 3LTLA 2DHIA 2RRFA 2YS5A 4DBBA 1N00A 3X23A 2I5CA 1BTNA 5IRSA 4GN1A 1R8QE 1BC3A 3GYOA 4GNKB 1BC1A 4GMXB 3SNHA 4CHMA 4OT1A 2DKPA 1K5GB 3QWMA 2QKLA 3KY9A 2YT1A 1XJLA 1H4RA 3HJLA 4GOUA 5J3TA 2HYUA 5DI9B 3AO0A 1W45A 3KSYA 4A6FB 1XCGA 1BCYA 2Z0QA 1MK9B 1T77A 2LOZA 1AXNA 3AJ4A 2J0MA 2XQNM 1V5UA 2X18A 1A8AA 1W1HA 1PFJA 3PP2A 2D9XA 2IE7A 2UZSA 5JLJB 3CIKA 1MK7B 2Y8GA 4IOYX 5D27A 5DHAB 5JP4A 1W1DA 2KIGA 1HVGA 2KUQA 4NY0A 5J3YA 4HB2B 2CODA 1MI1A 2D9ZA 1GG3A 1FB8A 1J0WA 1MKEA 2NMBA 4HAXB 3U8ZA 1FHXA 4OSNA 4BBKA 1OQNA 2YSZA 1UEFA 2E2XA 4KHBA 1NTVA 3ZVRA 2D2QA 1R8ME 3ABOA 3U12A 3ULBA 1NI2A 3BRXA 4X9PA 5DHFB 5C5BB 4IFSA 4HDOA 3OHMB 5M4YB 4FQ0C 2Q4CA
chains in the Genus database with same CATH topology
4JWLA 5HE0A 4F7HA 3FEHA 3KZ1A 3TW1A 2HE7A 4Z2MB 3MDBC 2DX5A 2P8VA 1Y19B 2I1JA 3PVWA 4HAZB 3TVVA 1UNPA 3ODOA 4A6FA 3BINA 4ZRIA 1RRPB 1U5GA 5DH9B 1U5EA 4HATB 3HQCA 2KGXB 1ZM0A 1XT0B 2COFA 2YRYA 2J0KA 1PLSA 4H8SA 1U5FA 1R8SE 3QBVB 1N3HA 3RCPA 2R09A 3DXEA 4DX90 2DTCA 1TJ6A 1NTYA 4WSFA 2CY4A 2UZRA 3WA0A 3GYPA 5J3QA 1FHOA 3T06A 1Q8DA 2OTXA 5KQ4A 2YS3A 5FI0A 1WJ1A 4HB4B 4D7RA 4KN7X 1P6SA 4K2PA 3D8FA 3DXCA 3PVLA 1MIZB 1U29A 5C5BA 2DHKA 3VIAA 2PZ1A 1PMSA 2ELBA 2H7DA 3ODWA 2LOXA 1EVHA 1KI1B 2ZPYA 2EJ8A 1NU2A 4MT7A 1FOEA 2L2IA 5HE3A 1S9DE 2MDXA 3MPXA 5LONB 1IRSA 3L8NA 2KCJA 2DYNA 1Z87A 4WJ7A 1LW3A 1X1FA 4HAWB 1TXDA 2D9WA 5C6RA 1XSZA 4KN4X 2W2XC 4YONA 1XODA 4D0NB 1AQCA 2W2WA 2LG1A 2H7EA 1DBHA 1V5PA 3PSCA 4CYEA 1TQZA 3TW5A 5GOWB 2DHJA 4WVFB 2FJLA 2MWNB 3M1IB 3D8EA 3SO6A 1X11A 2HSNA 1M7RA 5D3WA 2ROZB 2AL6A 4TKNA 3U7DA 1KZ7A 1WJMA 4L6EA 4HHVA 1I2HA 3D8DA 3SWVA 1X1GA 2R0DA 2VRWB 1H10A 4P7IA 2M14A 1WVHA 2GS0A 1E5WA 1ZC3B 3HW2B 2W2XD 2CY5A 4K2OA 3ML4A 2DKQA 1DDVA 1MPHA 4D7QA 1BTKA 2OQBA 4HAVB 1MAIA 3UZTA 1V5MA 2YT0A 1BC9A 1Y5OA 4C0AA 1Q67A 1P5TA 2LULA 2ROVA 3FM8C 1DDMA 1XX0A 4OIYA 2P0DA 3QIJA 2UVMA 1FGYA 2YF0A 1V61A 2COCA 1SHCA 1SGHA 4HAYB 3TCAA 1K5DB 2N23A 2K2JA 2P0HA 4Y94A 4EMOA 2LKOA 3F0WA 2HTHB 2KUPA 4MK0A 2Y7BA 1FAOA 4A6HA 2RUKB 3KRWA 5FI1A 1PBVA 4C7PA 1GC7A 1RJ2A 4K81A 5LOPB 2DA0A 2YS1A 1ZVRA 2J0JA 2EMTA 5CLQB 1MIXA 1OY2A 5D3YA 1P3RA 2K2UA 3PVUA 3ZDTA 5CLLB 1QC6A 1UNQA 2ADZA 3V5WA 2DFKA 1AWEA 1XR0B 4KHAA 4L5MA 5DIFB 2GCLA 3DXDA 3ODXA 1ZSQA 4KVGB 4KHOA 5EFXA 1UNRA 1ZC4B 2M38A 1DROA 4HB3B 4HAUB 4GPTB 4KHBB 3USYA 2D4QA 4F7UP 4KAXB 3BJIA 1BAKA 2Z0PA 2DN6A 3NSUA 2RNRB 2CAYA 3OANA 4IAPA 2YVCA 3HK0A 2IFSA 5D3XA 2NZ8B 1LKVX 3PZDA 4HDQA 2Y8FA 4DX8A 1KU1A 4MY6A 4NSWA 2IYBA 1XKEA 3P6AA 2RVBB 3O96A 3IVFA 4GXBA 1U5DA 3A8QA 5KQ1A 3SV1A 3LJUX 4B6HA 1UPQA 4ZRJA 4HB0B 2D10A 1RE0B 1KZGA 1U27A 4JMIA 4PQ0A 2I5FA 2VSZA 3CXBB 3AU4A 3N7CA 1I7AA 4JXHA 3TFMA 1B55A 4A6KA 4Z21A 4KMUX 1WI1A 4JMOA 5D3VA 4GZUA 2D9VA 3AJCA 1EF1A 1OMWA 2J59M 2V76A 4K17A 4CHJA 5C79A 1WGQA 2COAA 1V89A 1EGXA 2CRFA 2DYQA 2Z0OA 2D11A 3P7ZA 2I1KA 1GC6A 1U2BA 1J19A 1QC7A 2K00A 4Z2NA 1FGZA 1DYNA 2DLWA 3PG7A 2P0FA 5HE2A 5C16A 5KCVA 3KRXA 3SOHB 1W1GA 2QKMA 2ELAA 4GMVA 3A8PA 2AEHA 3WYFB 3SUZA 3TO1A 1V88A 2EC1A 3PEGA 1BWNA 3VOQA 3SYXA 5L81A 3USWA 2JP2A 2EMSA 1DDWA 1EAZA 1QQGA 5HE1A 1FHWA 1M7EA 3FSSA 2RLOA 4EKUA 4PNKA 2MKRA 4A4PA 2N0YA 4TYZA 1LB1A 1UPRA 4A5KA 1WG7A 3A98B 3ULCA 2DX1A 1WGUA 4FHRB 2D9YA 2RSGA 4F7GA 5JHHA 4XWXA 3G9WA 2BCJA 4EJNA 1X05A 2Q13A 1ISNA 3AU5A 3F5RA 2GCJA 1X86A 2L1CA 2MFQA 2LYDA 5JHGA 2VKIA 4JK1X 4ZRKA 2K6XA 2GJYA 4DXAB 2G35A 4YL8A 1XD4A 3LTLA 2DHIA 2YS5A 4DBBA 3X23A 2I5CA 1BTNA 4GN1A 1R8QE 3GYOA 4CHMA 4GMXB 3SNHA 2DKPA 1K5GB 3QWMA 2QKLA 3KY9A 2YT1A 1H4RA 3HJLA 5J3TA 5DI9B 3KSYA 4A6FB 1XCGA 2Z0QA 1MK9B 2LOZA 3AJ4A 2J0MA 2XQNM 1V5UA 2X18A 1W1HA 1PFJA 3PP2A 2D9XA 2UZSA 5JLJB 3CIKA 1MK7B 2Y8GA 4IOYX 5D27A 5DHAB 5JP4A 1W1DA 4NY0A 5J3YA 4HB2B 2CODA 2D9ZA 1GG3A 1FB8A 1J0WA 1MKEA 2NMBA 4HAXB 3U8ZA 1FHXA 4BBKA 1OQNA 2YSZA 1UEFA 2E2XA 1NTVA 3ZVRA 2D2QA 1R8ME 3ULBA 1NI2A 5DHFB 5C5BB 4IFSA 4HDOA 4FQ0C 2RGNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWL A;  5HE0 A;  4F7H A;  3FEH A;  3KZ1 A;  3TW1 A;  2HE7 A;  4Z2M B;  3MDB C;  2DX5 A;  2P8V A;  1Y19 B;  2I1J A;  3PVW A;  4HAZ B;  3TVV A;  1UNP A;  3ODO A;  4A6F A;  3BIN A;  4ZRI A;  1RRP B;  1U5G A;  5DH9 B;  1U5E A;  4HAT B;  3HQC A;  2KGX B;  1ZM0 A;  1XT0 B;  2COF A;  2YRY A;  2J0K A;  1PLS A;  4H8S A;  1U5F A;  1R8S E;  3QBV B;  1N3H A;  3RCP A;  2R09 A;  3DXE A;  4DX9 0;  2DTC A;  1TJ6 A;  1NTY A;  4WSF A;  2CY4 A;  2UZR A;  3WA0 A;  3GYP A;  5J3Q A;  1FHO A;  3T06 A;  2OTX A;  5KQ4 A;  2YS3 A;  5FI0 A;  1WJ1 A;  4HB4 B;  4D7R A;  1P6S A;  4K2P A;  3D8F A;  3DXC A;  3PVL A;  1MIZ B;  1U29 A;  5C5B A;  2DHK A;  3VIA A;  2PZ1 A;  1PMS A;  2ELB A;  2H7D A;  3ODW A;  2LOX A;  1EVH A;  1KI1 B;  2ZPY A;  2EJ8 A;  1NU2 A;  4MT7 A;  1FOE A;  2L2I A;  5HE3 A;  1S9D E;  2MDX A;  3MPX A;  5LON B;  1IRS A;  3L8N A;  2KCJ A;  2DYN A;  1Z87 A;  4WJ7 A;  1LW3 A;  1X1F A;  4HAW B;  1TXD A;  2D9W A;  5C6R A;  1XSZ A;  2W2X C;  4YON A;  1XOD A;  4D0N B;  1AQC A;  2W2W A;  2LG1 A;  2H7E A;  1DBH A;  1V5P A;  3PSC A;  4CYE A;  1TQZ A;  5GOW B;  2DHJ A;  4WVF B;  2FJL A;  2MWN B;  3M1I B;  3D8E A;  3SO6 A;  1X11 A;  5D3W A;  1M7R A;  2ROZ B;  2AL6 A;  4TKN A;  3U7D A;  1KZ7 A;  1WJM A;  4L6E A;  4HHV A;  1I2H A;  3D8D A;  3SWV A;  1X1G A;  2R0D A;  2VRW B;  1H10 A;  4P7I A;  2M14 A;  1WVH A;  2GS0 A;  1E5W A;  1ZC3 B;  3HW2 B;  2W2X D;  2CY5 A;  4K2O A;  3ML4 A;  2DKQ A;  1DDV A;  1MPH A;  4D7Q A;  1BTK A;  2OQB A;  4HAV B;  1MAI A;  3UZT A;  1V5M A;  2YT0 A;  1BC9 A;  1Y5O A;  4C0A A;  1Q67 A;  1P5T A;  2LUL A;  2ROV A;  3FM8 C;  1DDM A;  1XX0 A;  4OIY A;  2P0D A;  3QIJ A;  2UVM A;  1FGY A;  2YF0 A;  1V61 A;  2COC A;  1SHC A;  1SGH A;  4HAY B;  3TCA A;  1K5D B;  2N23 A;  2K2J A;  2P0H A;  4Y94 A;  4EMO A;  2LKO A;  3F0W A;  2HTH B;  2KUP A;  4MK0 A;  2Y7B A;  1FAO A;  4A6H A;  2RUK B;  3KRW A;  5FI1 A;  1PBV A;  4C7P A;  1GC7 A;  1RJ2 A;  4K81 A;  5LOP B;  2DA0 A;  2YS1 A;  1ZVR A;  2J0J A;  2EMT A;  5CLQ B;  1MIX A;  1OY2 A;  5D3Y A;  1P3R A;  2K2U A;  3PVU A;  3ZDT A;  5CLL B;  1QC6 A;  1UNQ A;  2ADZ A;  3V5W A;  2DFK A;  1AWE A;  1XR0 B;  4KHA A;  4L5M A;  5DIF B;  2GCL A;  3DXD A;  3ODX A;  1ZSQ A;  4KVG B;  4KHO A;  5EFX A;  1UNR A;  1ZC4 B;  2M38 A;  1DRO A;  4HB3 B;  4HAU B;  4GPT B;  4KHB B;  2D4Q A;  4F7U P;  4KAX B;  3BJI A;  1BAK A;  2Z0P A;  2DN6 A;  3NSU A;  2RNR B;  2CAY A;  3OAN A;  4IAP A;  2YVC A;  3HK0 A;  2IFS A;  5D3X A;  2NZ8 B;  3PZD A;  4HDQ A;  2Y8F A;  4DX8 A;  1KU1 A;  4MY6 A;  4NSW A;  2IYB A;  1XKE A;  3P6A A;  2RVB B;  3O96 A;  3IVF A;  4GXB A;  1U5D A;  3A8Q A;  5KQ1 A;  3SV1 A;  3LJU X;  4B6H A;  1UPQ A;  4ZRJ A;  4HB0 B;  2D10 A;  1RE0 B;  1KZG A;  1U27 A;  4JMI A;  4PQ0 A;  2I5F A;  2VSZ A;  3CXB B;  3AU4 A;  3N7C A;  1I7A A;  4JXH A;  3TFM A;  1B55 A;  4A6K A;  4Z21 A;  1WI1 A;  4JMO A;  5D3V A;  4GZU A;  2D9V A;  1OMW A;  1EF1 A;  2J59 M;  4K17 A;  2V76 A;  4CHJ A;  5C79 A;  1WGQ A;  2COA A;  1V89 A;  1EGX A;  2CRF A;  2DYQ A;  2Z0O A;  2D11 A;  3P7Z A;  2I1K A;  1GC6 A;  1U2B A;  1J19 A;  2K00 A;  4Z2N A;  1FGZ A;  1DYN A;  2DLW A;  3PG7 A;  2P0F A;  5HE2 A;  5C16 A;  5KCV A;  3KRX A;  1W1G A;  2QKM A;  2ELA A;  4GMV A;  3A8P A;  2AEH A;  3WYF B;  3SUZ A;  3TO1 A;  1V88 A;  2EC1 A;  3PEG A;  1BWN A;  3VOQ A;  3SYX A;  5L81 A;  2JP2 A;  2EMS A;  1DDW A;  1EAZ A;  1QQG A;  5HE1 A;  1FHW A;  1M7E A;  3FSS A;  2RLO A;  4EKU A;  4PNK A;  2MKR A;  4A4P A;  2N0Y A;  4TYZ A;  1LB1 A;  1UPR A;  4A5K A;  1WG7 A;  3A98 B;  3ULC A;  2DX1 A;  1WGU A;  2D9Y A;  2RSG A;  4F7G A;  5JHH A;  4XWX A;  3G9W A;  2BCJ A;  4EJN A;  1X05 A;  2Q13 A;  1ISN A;  3AU5 A;  3F5R A;  2GCJ A;  1X86 A;  2L1C A;  2MFQ A;  2LYD A;  5JHG A;  2VKI A;  4ZRK A;  2GJY A;  4DXA B;  2G35 A;  4YL8 A;  1XD4 A;  3LTL A;  2DHI A;  2YS5 A;  4DBB A;  3X23 A;  2I5C A;  1BTN A;  4GN1 A;  1R8Q E;  3GYO A;  4CHM A;  4GMX B;  3SNH A;  2DKP A;  1K5G B;  3QWM A;  2QKL A;  3KY9 A;  2YT1 A;  1H4R A;  5J3T A;  5DI9 B;  3KSY A;  4A6F B;  1XCG A;  2Z0Q A;  1MK9 B;  2LOZ A;  3AJ4 A;  2J0M A;  2XQN M;  1V5U A;  2X18 A;  1W1H A;  1PFJ A;  3PP2 A;  2D9X A;  2UZS A;  5JLJ B;  3CIK A;  1MK7 B;  2Y8G A;  4IOY X;  5D27 A;  5DHA B;  5JP4 A;  1W1D A;  4NY0 A;  5J3Y A;  4HB2 B;  2COD A;  2D9Z A;  1GG3 A;  1FB8 A;  1J0W A;  1MKE A;  2NMB A;  4HAX B;  3U8Z A;  1FHX A;  4BBK A;  1OQN A;  2YSZ A;  1UEF A;  2E2X A;  1NTV A;  3ZVR A;  2D2Q A;  1R8M E;  3ULB A;  1NI2 A;  5DHF B;  5C5B B;  4IFS A;  4HDO A;  2RGN B; 
#chains in the Genus database with same CATH topology
 4JWL A;  5HE0 A;  4F7H A;  3FEH A;  3KZ1 A;  3TW1 A;  1W7B A;  2HE7 A;  2IIC A;  4Z2M B;  2ZKM X;  3MDB C;  4QJ5 B;  2Z14 A;  2DX5 A;  2P8V A;  1Y19 B;  2I1J A;  3PVW A;  4HAZ B;  3TVV A;  1UNP A;  3ODO A;  4A6F A;  3BIN A;  5I2M A;  4ZRI A;  1RRP B;  1U5G A;  5DH9 B;  1BCW A;  1U5E A;  4HAT B;  3HQC A;  2R2Y A;  2KIE A;  2KGX B;  1ZM0 A;  2ZHI A;  1XT0 B;  2COF A;  2YRY A;  2J0K A;  1PLS A;  4H8S A;  1U5F A;  1R8S E;  3QBV B;  1N3H A;  3RCP A;  2R09 A;  3DXE A;  4DX9 0;  2DTC A;  1TJ6 A;  1NTY A;  4WSF A;  2CY4 A;  4MDV A;  2UZR A;  3WA0 A;  3GYP A;  5J3Q A;  1FHO A;  3T06 A;  1Q8D A;  2OTX A;  5KQ4 A;  1AVH A;  2YS3 A;  5FI0 A;  2ZHJ A;  1WJ1 A;  4HB4 B;  4D7R A;  4KN7 X;  1P6S A;  4K2P A;  3D8F A;  3DXC A;  3PVL A;  1MIZ B;  1U29 A;  5C5B A;  2DHK A;  2FJU B;  1PMS A;  2PZ1 A;  2ELB A;  3VIA A;  2H7D A;  3ODW A;  2LOX A;  3ABS A;  4QJ4 B;  1EVH A;  1M9I A;  1KI1 B;  2ZPY A;  2EJ8 A;  4QJ3 B;  1NU2 A;  4MT7 A;  1FOE A;  2L2I A;  5HE3 A;  1S9D E;  2MDX A;  3MPX A;  5LON B;  1IRS A;  3L8N A;  2KCJ A;  2DYN A;  1Z87 A;  4WJ7 A;  1ANW A;  1LW3 A;  1X1F A;  4HAW B;  1TXD A;  2HYV A;  2D9W A;  5C6R A;  1XSZ A;  4KN4 X;  2W2X C;  4YON A;  1XOD A;  4D0N B;  1AQC A;  2W2W A;  2LG1 A;  2H7E A;  1DBH A;  2QEZ A;  1V5P A;  3PSC A;  1BO9 A;  4CYE A;  1TQZ A;  4QXA B;  3ANY A;  3TW5 A;  5GOW B;  2DHJ A;  4WVF B;  4CSQ A;  2NBV A;  2FJL A;  1N41 A;  2MWN B;  3M1I B;  3D8E A;  3SO6 A;  2VXG A;  1X11 A;  2HSN A;  1M7R A;  5D3W A;  2ROZ B;  2AL6 A;  1DM5 A;  4TKN A;  3U7D A;  1KZ7 A;  3ABQ A;  1WJM A;  4L6E A;  4HHV A;  1I2H A;  3D8D A;  3SWV A;  1X1G A;  2R0D A;  2VRW B;  1H10 A;  3ABR A;  4HRE A;  2M14 A;  3NW8 A;  4P7I A;  2XO3 A;  1WVH A;  2GS0 A;  2ZOC A;  1E5W A;  1ZC3 B;  3HW2 B;  2W2X D;  1SAV A;  2CY5 A;  4K2O A;  3ML4 A;  2DKQ A;  1DDV A;  1MPH A;  4D7Q A;  1BTK A;  1HVD A;  2OQB A;  3HSA A;  4HAV B;  1HVF A;  2II2 A;  1MAI A;  3UZT A;  1V5M A;  2YT0 A;  1C1K A;  1BC9 A;  1ANN A;  1Y5O A;  2K49 A;  4C0A A;  1Q67 A;  3NWF A;  1BCZ A;  2YT2 A;  1P5T A;  2LUL A;  2ROV A;  3FM8 C;  1DDM A;  1XX0 A;  4OIY A;  2P0D A;  4EVH A;  3QIJ A;  2UVM A;  3B77 A;  1MCX A;  1FGY A;  2YF0 A;  1HM6 A;  1V61 A;  2COC A;  1SHC A;  1SGH A;  4HAY B;  3TCA A;  1K5D B;  2N23 A;  2K2J A;  1AEI A;  2P0H A;  4Y94 A;  4EMO A;  2LKO A;  3F0W A;  2HTH B;  2KUP A;  4MK0 A;  2Y7B A;  1FAO A;  4A6H A;  2RUK B;  1G5N A;  3KRW A;  1W3W A;  5FI1 A;  1PBV A;  4C7P A;  1GC7 A;  1RJ2 A;  4K81 A;  5LOP B;  2OY9 A;  2DA0 A;  2YS1 A;  1ZVR A;  2J0J A;  2EMT A;  5CLQ B;  1MIX A;  1OY2 A;  5D3Y A;  1P3R A;  2K2U A;  3PVU A;  3ZDT A;  1AOW A;  5CLL B;  1QC6 A;  1UNQ A;  2ADZ A;  3V5W A;  1ZYI A;  2DFK A;  1AWE A;  1XR0 B;  4KHA A;  4DIX A;  4L5M A;  5DIF B;  2GCL A;  1AII A;  3DXD A;  3ODX A;  1ZSQ A;  4KVG B;  4KHO A;  5EFX A;  1UNR A;  1ZC4 B;  2H0L A;  2IE6 A;  2M38 A;  1DRO A;  4HB3 B;  4HAU B;  4GPT B;  4KHB B;  3USY A;  2H0K A;  2D4Q A;  1DK5 A;  3BJI A;  4KAX B;  1YJ0 A;  4F7U P;  1BAK A;  2Z0P A;  2DN6 A;  3NSU A;  1ALA A;  2RNR B;  1AVC A;  2CAY A;  3OAN A;  4IAP A;  3A58 A;  2YVC A;  3HK0 A;  2IFS A;  5D3X A;  2NZ8 B;  4L1R A;  1LKV X;  2RAN A;  4EVF A;  3PZD A;  4HDQ A;  2Y8F A;  1YGM A;  2HYW A;  4DX8 A;  1KU1 A;  1N42 A;  4MY6 A;  4NSW A;  2IYB A;  1XKE A;  3P6A A;  2RVB B;  3DCX A;  3O96 A;  3IVF A;  4GXB A;  1U5D A;  3A8Q A;  5KQ1 A;  3SV1 A;  3LJU X;  4B6H A;  1UPQ A;  4ZRJ A;  4HB0 B;  1ANX A;  2D10 A;  1RE0 B;  1KZG A;  1U27 A;  4JMI A;  4PQ0 A;  2I5F A;  2VSZ A;  3CXB B;  3AU4 A;  2K8E A;  3N7C A;  1I7A A;  4JXH A;  3TFM A;  1B55 A;  1AVR A;  4A6K A;  4Z21 A;  1UPT B;  4KMU X;  4Q2S A;  1HVE A;  1WI1 A;  3FVC A;  4JMO A;  5D3V A;  4GZU A;  2D9V A;  3AJC A;  1EF1 A;  1OMW A;  2J59 M;  2V76 A;  4K17 A;  4CHJ A;  5C79 A;  1WGQ A;  2COA A;  1V89 A;  1EGX A;  2GUM A;  2CRF A;  2DYQ A;  2Z0O A;  2D11 A;  3P7Z A;  2I1K A;  1GC6 A;  1U2B A;  1J19 A;  1QC7 A;  2K00 A;  4Z2N A;  1FGZ A;  1DYN A;  2DLW A;  3PG7 A;  2H0M A;  2P0F A;  5HE2 A;  1R4A E;  4HSI A;  5C16 A;  5KCV A;  1N44 A;  3KRX A;  3SOH B;  1W1G A;  2QKM A;  2ELA A;  4GMV A;  3A8P A;  2AEH A;  3NWA A;  3WYF B;  3SUZ A;  3TO1 A;  1V88 A;  2EC1 A;  3PEG A;  1BWN A;  2KR0 A;  3SYX A;  3VOQ A;  5L81 A;  3HIE A;  3USW A;  2JP2 A;  2EMS A;  2Z13 A;  1DDW A;  1EAZ A;  1QQG A;  5HE1 A;  1A8B A;  1FHW A;  1M7E A;  3FSS A;  2RLO A;  4EKU A;  4PNK A;  2MKR A;  1YCN A;  4A4P A;  2N0Y A;  1I4A A;  2Z59 A;  4TYZ A;  1LB1 A;  1UPR A;  4A5K A;  2RGN B;  1HAK A;  1WG7 A;  5LG4 B;  3A98 B;  4MDU A;  3ULC A;  5I2S A;  2DX1 A;  1WGU A;  4FHR B;  2D9Y A;  4D6W A;  2RSG A;  4F7G A;  5JHH A;  1BC0 A;  4XWX A;  3G9W A;  2BCJ A;  2XO2 A;  4EJN A;  1X05 A;  2Q13 A;  1ISN A;  3AU5 A;  3F5R A;  2GCJ A;  1X86 A;  2L1C A;  2MFQ A;  3NWD A;  2LYD A;  5JHG A;  1YII A;  2VKI A;  4JK1 X;  4ZRK A;  2Z4D A;  2K6X A;  2GJY A;  4DXA B;  2G35 A;  4YL8 A;  1XD4 A;  3LTL A;  2DHI A;  2RRF A;  2YS5 A;  4DBB A;  1N00 A;  3X23 A;  2I5C A;  1BTN A;  5IRS A;  4GN1 A;  1R8Q E;  1BC3 A;  3GYO A;  4GNK B;  1BC1 A;  4GMX B;  3SNH A;  4CHM A;  4OT1 A;  2DKP A;  1K5G B;  3QWM A;  2QKL A;  3KY9 A;  2YT1 A;  1XJL A;  1H4R A;  3HJL A;  4GOU A;  5J3T A;  2HYU A;  5DI9 B;  3AO0 A;  1W45 A;  3KSY A;  4A6F B;  1XCG A;  1BCY A;  2Z0Q A;  1MK9 B;  1T77 A;  2LOZ A;  1AXN A;  3AJ4 A;  2J0M A;  2XQN M;  1V5U A;  2X18 A;  1A8A A;  1W1H A;  1PFJ A;  3PP2 A;  2D9X A;  2IE7 A;  2UZS A;  5JLJ B;  3CIK A;  1MK7 B;  2Y8G A;  4IOY X;  5D27 A;  5DHA B;  5JP4 A;  1W1D A;  2KIG A;  1HVG A;  2KUQ A;  4NY0 A;  5J3Y A;  4HB2 B;  2COD A;  1MI1 A;  2D9Z A;  1GG3 A;  1FB8 A;  1J0W A;  1MKE A;  2NMB A;  4HAX B;  3U8Z A;  1FHX A;  4OSN A;  4BBK A;  1OQN A;  2YSZ A;  1UEF A;  2E2X A;  4KHB A;  1NTV A;  3ZVR A;  2D2Q A;  1R8M E;  3ABO A;  3U12 A;  3ULB A;  1NI2 A;  3BRX A;  4X9P A;  5DHF B;  5C5B B;  4IFS A;  4HDO A;  3OHM B;  5M4Y B;  4FQ0 C;  2Q4C A; 
#chains in the Genus database with same CATH homology
 4JWL A;  5HE0 A;  4F7H A;  3FEH A;  3KZ1 A;  3TW1 A;  2HE7 A;  4Z2M B;  3MDB C;  2DX5 A;  2P8V A;  1Y19 B;  2I1J A;  3PVW A;  4HAZ B;  3TVV A;  1UNP A;  3ODO A;  4A6F A;  3BIN A;  4ZRI A;  1RRP B;  1U5G A;  5DH9 B;  1U5E A;  4HAT B;  3HQC A;  2KGX B;  1ZM0 A;  1XT0 B;  2COF A;  2YRY A;  2J0K A;  1PLS A;  4H8S A;  1U5F A;  1R8S E;  3QBV B;  1N3H A;  3RCP A;  2R09 A;  3DXE A;  4DX9 0;  2DTC A;  1TJ6 A;  1NTY A;  4WSF A;  2CY4 A;  2UZR A;  3WA0 A;  3GYP A;  5J3Q A;  1FHO A;  3T06 A;  1Q8D A;  2OTX A;  5KQ4 A;  2YS3 A;  5FI0 A;  1WJ1 A;  4HB4 B;  4D7R A;  4KN7 X;  1P6S A;  4K2P A;  3D8F A;  3DXC A;  3PVL A;  1MIZ B;  1U29 A;  5C5B A;  2DHK A;  3VIA A;  2PZ1 A;  1PMS A;  2ELB A;  2H7D A;  3ODW A;  2LOX A;  1EVH A;  1KI1 B;  2ZPY A;  2EJ8 A;  1NU2 A;  4MT7 A;  1FOE A;  2L2I A;  5HE3 A;  1S9D E;  2MDX A;  3MPX A;  5LON B;  1IRS A;  3L8N A;  2KCJ A;  2DYN A;  1Z87 A;  4WJ7 A;  1LW3 A;  1X1F A;  4HAW B;  1TXD A;  2D9W A;  5C6R A;  1XSZ A;  4KN4 X;  2W2X C;  4YON A;  1XOD A;  4D0N B;  1AQC A;  2W2W A;  2LG1 A;  2H7E A;  1DBH A;  1V5P A;  3PSC A;  4CYE A;  1TQZ A;  3TW5 A;  5GOW B;  2DHJ A;  4WVF B;  2FJL A;  2MWN B;  3M1I B;  3D8E A;  3SO6 A;  1X11 A;  2HSN A;  1M7R A;  5D3W A;  2ROZ B;  2AL6 A;  4TKN A;  3U7D A;  1KZ7 A;  1WJM A;  4L6E A;  4HHV A;  1I2H A;  3D8D A;  3SWV A;  1X1G A;  2R0D A;  2VRW B;  1H10 A;  4P7I A;  2M14 A;  1WVH A;  2GS0 A;  1E5W A;  1ZC3 B;  3HW2 B;  2W2X D;  2CY5 A;  4K2O A;  3ML4 A;  2DKQ A;  1DDV A;  1MPH A;  4D7Q A;  1BTK A;  2OQB A;  4HAV B;  1MAI A;  3UZT A;  1V5M A;  2YT0 A;  1BC9 A;  1Y5O A;  4C0A A;  1Q67 A;  1P5T A;  2LUL A;  2ROV A;  3FM8 C;  1DDM A;  1XX0 A;  4OIY A;  2P0D A;  3QIJ A;  2UVM A;  1FGY A;  2YF0 A;  1V61 A;  2COC A;  1SHC A;  1SGH A;  4HAY B;  3TCA A;  1K5D B;  2N23 A;  2K2J A;  2P0H A;  4Y94 A;  4EMO A;  2LKO A;  3F0W A;  2HTH B;  2KUP A;  4MK0 A;  2Y7B A;  1FAO A;  4A6H A;  2RUK B;  3KRW A;  5FI1 A;  1PBV A;  4C7P A;  1GC7 A;  1RJ2 A;  4K81 A;  5LOP B;  2DA0 A;  2YS1 A;  1ZVR A;  2J0J A;  2EMT A;  5CLQ B;  1MIX A;  1OY2 A;  5D3Y A;  1P3R A;  2K2U A;  3PVU A;  3ZDT A;  5CLL B;  1QC6 A;  1UNQ A;  2ADZ A;  3V5W A;  2DFK A;  1AWE A;  1XR0 B;  4KHA A;  4L5M A;  5DIF B;  2GCL A;  3DXD A;  3ODX A;  1ZSQ A;  4KVG B;  4KHO A;  5EFX A;  1UNR A;  1ZC4 B;  2M38 A;  1DRO A;  4HB3 B;  4HAU B;  4GPT B;  4KHB B;  3USY A;  2D4Q A;  4F7U P;  4KAX B;  3BJI A;  1BAK A;  2Z0P A;  2DN6 A;  3NSU A;  2RNR B;  2CAY A;  3OAN A;  4IAP A;  2YVC A;  3HK0 A;  2IFS A;  5D3X A;  2NZ8 B;  1LKV X;  3PZD A;  4HDQ A;  2Y8F A;  4DX8 A;  1KU1 A;  4MY6 A;  4NSW A;  2IYB A;  1XKE A;  3P6A A;  2RVB B;  3O96 A;  3IVF A;  4GXB A;  1U5D A;  3A8Q A;  5KQ1 A;  3SV1 A;  3LJU X;  4B6H A;  1UPQ A;  4ZRJ A;  4HB0 B;  2D10 A;  1RE0 B;  1KZG A;  1U27 A;  4JMI A;  4PQ0 A;  2I5F A;  2VSZ A;  3CXB B;  3AU4 A;  3N7C A;  1I7A A;  4JXH A;  3TFM A;  1B55 A;  4A6K A;  4Z21 A;  4KMU X;  1WI1 A;  4JMO A;  5D3V A;  4GZU A;  2D9V A;  3AJC A;  1EF1 A;  1OMW A;  2J59 M;  2V76 A;  4K17 A;  4CHJ A;  5C79 A;  1WGQ A;  2COA A;  1V89 A;  1EGX A;  2CRF A;  2DYQ A;  2Z0O A;  2D11 A;  3P7Z A;  2I1K A;  1GC6 A;  1U2B A;  1J19 A;  1QC7 A;  2K00 A;  4Z2N A;  1FGZ A;  1DYN A;  2DLW A;  3PG7 A;  2P0F A;  5HE2 A;  5C16 A;  5KCV A;  3KRX A;  3SOH B;  1W1G A;  2QKM A;  2ELA A;  4GMV A;  3A8P A;  2AEH A;  3WYF B;  3SUZ A;  3TO1 A;  1V88 A;  2EC1 A;  3PEG A;  1BWN A;  3VOQ A;  3SYX A;  5L81 A;  3USW A;  2JP2 A;  2EMS A;  1DDW A;  1EAZ A;  1QQG A;  5HE1 A;  1FHW A;  1M7E A;  3FSS A;  2RLO A;  4EKU A;  4PNK A;  2MKR A;  4A4P A;  2N0Y A;  4TYZ A;  1LB1 A;  1UPR A;  4A5K A;  1WG7 A;  3A98 B;  3ULC A;  2DX1 A;  1WGU A;  4FHR B;  2D9Y A;  2RSG A;  4F7G A;  5JHH A;  4XWX A;  3G9W A;  2BCJ A;  4EJN A;  1X05 A;  2Q13 A;  1ISN A;  3AU5 A;  3F5R A;  2GCJ A;  1X86 A;  2L1C A;  2MFQ A;  2LYD A;  5JHG A;  2VKI A;  4JK1 X;  4ZRK A;  2K6X A;  2GJY A;  4DXA B;  2G35 A;  4YL8 A;  1XD4 A;  3LTL A;  2DHI A;  2YS5 A;  4DBB A;  3X23 A;  2I5C A;  1BTN A;  4GN1 A;  1R8Q E;  3GYO A;  4CHM A;  4GMX B;  3SNH A;  2DKP A;  1K5G B;  3QWM A;  2QKL A;  3KY9 A;  2YT1 A;  1H4R A;  3HJL A;  5J3T A;  5DI9 B;  3KSY A;  4A6F B;  1XCG A;  2Z0Q A;  1MK9 B;  2LOZ A;  3AJ4 A;  2J0M A;  2XQN M;  1V5U A;  2X18 A;  1W1H A;  1PFJ A;  3PP2 A;  2D9X A;  2UZS A;  5JLJ B;  3CIK A;  1MK7 B;  2Y8G A;  4IOY X;  5D27 A;  5DHA B;  5JP4 A;  1W1D A;  4NY0 A;  5J3Y A;  4HB2 B;  2COD A;  2D9Z A;  1GG3 A;  1FB8 A;  1J0W A;  1MKE A;  2NMB A;  4HAX B;  3U8Z A;  1FHX A;  4BBK A;  1OQN A;  2YSZ A;  1UEF A;  2E2X A;  1NTV A;  3ZVR A;  2D2Q A;  1R8M E;  3ULB A;  1NI2 A;  5DHF B;  5C5B B;  4IFS A;  4HDO A;  4FQ0 C;  2RGN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...