2XO2A

Human annexin v with incorporated methionine analogue azidohomoalanine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
310
Chain Sequence
QVLRGTVTDFPGFDERADAETLRKAKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAKGAGTDDHTLIRVVSRSEIDLFNIRKEFRKNFATSLYSIKGDTSGDYKKALLLLCGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN A5
publication title Non-Canonical Amino Acids for Click Chemistry Reactions Incorporated in Human Annexin V
rcsb
source organism Homo sapiens
molecule tags Membrane binding protein
total genus 91
structure length 310
sequence length 317
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 2xo2A02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 2xo2A04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 2xo2A01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 2xo2A03
2IICA 1A8AA 2IE6A 1BCZA 1YCNA 1XJLA 1ANWA 1N41A 1AEIA 2HYUA 1ANXA 2XO2A 2H0MA 4HREA 2II2A 2ZOCA 1ANNA 1AIIA 1W7BA 2HYWA 1ALAA 1N44A 2H0KA 1AVCA 4EVFA 1G5NA 1BC0A 2ZHIA 3BRXA 1AVHA 1N42A 1DM5A 4EVHA 1BCYA 2ZHJA 4X9PA 4MDVA 1AVRA 1YIIA 2RANA 1HAKA 1I4AA 1M9IA 1MCXA 1N00A 1W45A 1A8BA 1HVDA 1HVGA 1DK5A 4MDUA 1AOWA 1BCWA 2HYVA 1BO9A 2XO3A 1YJ0A 1BC1A 1HVEA 1W3WA 1SAVA 2H0LA 2IE7A 2Q4CA 1HM6A 1AXNA 1HVFA 1BC3A
chains in the Genus database with same CATH superfamily
2IE6A 1AXNA 4JMOA 1C1KA 3SWVA 1R8QE 1AEIA 2XO2A 1UPTB 4HREA 4JWLA 4KMUX 4L5MA 1XSZA 1YGMA 3USWA 1XT0B 2ZHIA 1N42A 4EVHA 4OIYA 1AVRA 1YIIA 1I4AA 4MDUA 1MCXA 4KN4X 1HVGA 1DK5A 4JMIA 2HYVA 1BC1A 2Q4CA 1SAVA 2IE7A 2IICA 1BCZA 2QEZA 4KN7X 3AO0A 4FHRB 2II2A 2ZOCA 1ALAA 1S9DE 4C7PA 1N44A 2R0DA 4MDVA 3HJLA 1HAKA 1M9IA 1W45A 1A8BA 1BC9A 1AOWA 1BO9A 1Q8DA 3ABOA 1BC3A 1R8ME 3SOHB 3L8NA 4JXHA 1ANWA 4JK1X 1N41A 2HYUA 1ANXA 2H0MA 3ABQA 2HYWA 1W7BA 4Q2SA 2H0KA 1RE0B 2R09A 1G5NA 1BC0A 1QC7A 3LTLA 1BCYA 2ZHJA 4A4PA 1LKVX 2RANA 3USYA 1N00A 1PBVA 4C0AA 1BCWA 4D7RA 3ANYA 2XO3A 2H0LA 4Z21A 2HSNA 3AJCA 1A8AA 1KU1A 1YCNA 1XJLA 4D7QA 2OY9A 3TW5A 2K6XA 1ANNA 1R8SE 1AVCA 4EVFA 3BRXA 1AVHA 1DM5A 1R4AE 4X9PA 1HVDA 3ABRA 1YJ0A 1HVEA 1W3WA 4FQ0C 1HM6A 3ABSA 1AIIA 1HVFA 2VXGA
chains in the Genus database with same CATH topology
2IICA 1A8AA 2IE6A 1BCZA 1YCNA 1XJLA 1ANWA 1N41A 1AEIA 2HYUA 1ANXA 2XO2A 2H0MA 4HREA 2II2A 2ZOCA 1ANNA 1AIIA 1W7BA 2HYWA 1ALAA 1N44A 2H0KA 1AVCA 4EVFA 1G5NA 1BC0A 2ZHIA 3BRXA 1AVHA 1N42A 1DM5A 4EVHA 1BCYA 2ZHJA 4X9PA 4MDVA 1AVRA 1YIIA 2RANA 1HAKA 1I4AA 1M9IA 1MCXA 1N00A 1W45A 1A8BA 1HVDA 1HVGA 1DK5A 4MDUA 1AOWA 1BCWA 2HYVA 1BO9A 2XO3A 1YJ0A 1BC1A 1HVEA 1W3WA 1SAVA 2H0LA 2IE7A 2Q4CA 1HM6A 1AXNA 1HVFA 1BC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IIC A;  1A8A A;  2IE6 A;  1BCZ A;  1YCN A;  1XJL A;  1ANW A;  1N41 A;  1AEI A;  2HYU A;  1ANX A;  2XO2 A;  2H0M A;  4HRE A;  2II2 A;  2ZOC A;  1ANN A;  1AII A;  1W7B A;  2HYW A;  1ALA A;  1N44 A;  2H0K A;  1AVC A;  4EVF A;  1G5N A;  1BC0 A;  2ZHI A;  3BRX A;  1AVH A;  1N42 A;  1DM5 A;  4EVH A;  1BCY A;  2ZHJ A;  4X9P A;  4MDV A;  1AVR A;  1YII A;  2RAN A;  1HAK A;  1I4A A;  1M9I A;  1MCX A;  1N00 A;  1W45 A;  1A8B A;  1HVD A;  1HVG A;  1DK5 A;  4MDU A;  1AOW A;  1BCW A;  2HYV A;  1BO9 A;  2XO3 A;  1YJ0 A;  1BC1 A;  1HVE A;  1W3W A;  1SAV A;  2H0L A;  2IE7 A;  2Q4C A;  1HM6 A;  1AXN A;  1HVF A;  1BC3 A; 
#chains in the Genus database with same CATH topology
 2IE6 A;  1AXN A;  4JMO A;  1C1K A;  3SWV A;  1R8Q E;  1AEI A;  2XO2 A;  1UPT B;  4HRE A;  4JWL A;  4KMU X;  4L5M A;  1XSZ A;  1YGM A;  3USW A;  1XT0 B;  2ZHI A;  1N42 A;  4EVH A;  4OIY A;  1AVR A;  1YII A;  1I4A A;  4MDU A;  1MCX A;  4KN4 X;  1HVG A;  1DK5 A;  4JMI A;  2HYV A;  1BC1 A;  2Q4C A;  1SAV A;  2IE7 A;  2IIC A;  1BCZ A;  2QEZ A;  4KN7 X;  3AO0 A;  4FHR B;  2II2 A;  2ZOC A;  1ALA A;  1S9D E;  4C7P A;  1N44 A;  2R0D A;  4MDV A;  3HJL A;  1HAK A;  1M9I A;  1W45 A;  1A8B A;  1BC9 A;  1AOW A;  1BO9 A;  1Q8D A;  3ABO A;  1BC3 A;  1R8M E;  3SOH B;  3L8N A;  4JXH A;  1ANW A;  4JK1 X;  1N41 A;  2HYU A;  1ANX A;  2H0M A;  3ABQ A;  2HYW A;  1W7B A;  4Q2S A;  2H0K A;  1RE0 B;  2R09 A;  1G5N A;  1BC0 A;  1QC7 A;  3LTL A;  1BCY A;  2ZHJ A;  4A4P A;  1LKV X;  2RAN A;  3USY A;  1N00 A;  1PBV A;  4C0A A;  1BCW A;  4D7R A;  3ANY A;  2XO3 A;  2H0L A;  4Z21 A;  2HSN A;  3AJC A;  1A8A A;  1KU1 A;  1YCN A;  1XJL A;  4D7Q A;  2OY9 A;  3TW5 A;  2K6X A;  1ANN A;  1R8S E;  1AVC A;  4EVF A;  3BRX A;  1AVH A;  1DM5 A;  1R4A E;  4X9P A;  1HVD A;  3ABR A;  1YJ0 A;  1HVE A;  1W3W A;  4FQ0 C;  1HM6 A;  3ABS A;  1AII A;  1HVF A;  2VXG A; 
#chains in the Genus database with same CATH homology
 2IIC A;  1A8A A;  2IE6 A;  1BCZ A;  1YCN A;  1XJL A;  1ANW A;  1N41 A;  1AEI A;  2HYU A;  1ANX A;  2XO2 A;  2H0M A;  4HRE A;  2II2 A;  2ZOC A;  1ANN A;  1AII A;  1W7B A;  2HYW A;  1ALA A;  1N44 A;  2H0K A;  1AVC A;  4EVF A;  1G5N A;  1BC0 A;  2ZHI A;  3BRX A;  1AVH A;  1N42 A;  1DM5 A;  4EVH A;  1BCY A;  2ZHJ A;  4X9P A;  4MDV A;  1AVR A;  1YII A;  2RAN A;  1HAK A;  1I4A A;  1M9I A;  1MCX A;  1N00 A;  1W45 A;  1A8B A;  1HVD A;  1HVG A;  1DK5 A;  4MDU A;  1AOW A;  1BCW A;  2HYV A;  1BO9 A;  2XO3 A;  1YJ0 A;  1BC1 A;  1HVE A;  1W3W A;  1SAV A;  2H0L A;  2IE7 A;  2Q4C A;  1HM6 A;  1AXN A;  1HVF A;  1BC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...