3SOHB

Architecture of the flagellar rotor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFSRTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flagellar motor switch protein FliM
publication title Architecture of the flagellar rotor.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Motor protein
total genus 21
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.30 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 3sohB00
3SOHB 4FQ0C 3HJLA 4FHRB 3USWA 1LKVX 1QC7A 3USYA 3AJCA
chains in the Genus database with same CATH superfamily
2K6XA 3TW5A 3ANYA 2IE7A 1A8BA 1N00A 1BO9A 4KMUX 1AIIA 1SAVA 1MCXA 3L8NA 3SOHB 1HVEA 1XJLA 2XO2A 4JMIA 1A8AA 4Q2SA 4C7PA 1DM5A 1AOWA 1ANNA 1YJ0A 1I4AA 1W45A 1YCNA 1AEIA 3BRXA 1R8SE 1ANXA 1ALAA 2HYWA 2HSNA 1BCZA 1R8QE 4FHRB 1R8ME 1RE0B 1W3WA 3ABOA 4L5MA 1BC1A 2OY9A 4OIYA 4EVFA 1C1KA 1M9IA 3AO0A 3LTLA 4A4PA 1HAKA 1G5NA 1S9DE 1ANWA 1PBVA 2ZHJA 1N41A 3ABSA 3USYA 2RANA 4HREA 1N42A 2II2A 4D7QA 1AVCA 2ZOCA 2VXGA 2IICA 2HYVA 1W7BA 1UPTB 3ABQA 1YIIA 1AXNA 1AVHA 1HVDA 4JMOA 3USWA 1R4AE 1BCYA 4X9PA 2R09A 2Q4CA 4MDVA 1BC3A 1HVFA 1YGMA 4KN4X 1LKVX 1HM6A 4KN7X 2XO3A 3HJLA 1HVGA 1BC0A 2H0KA 1KU1A 4JXHA 3AJCA 2H0MA 1Q8DA 3ABRA 4C0AA 1N44A 1QC7A 4JWLA 4MDUA 4FQ0C 1BC9A 1BCWA 2H0LA 2ZHIA 2IE6A 2HYUA 1AVRA 2QEZA 1XSZA 4Z21A 4JK1X 1XT0B 1DK5A 2R0DA 3SWVA 4EVHA 4D7RA
chains in the Genus database with same CATH topology
4C0AA 2HSNA 2K6XA 3TW5A 1R8QE 4FHRB 1R8ME 1QC7A 1RE0B 4JWLA 4L5MA 4KMUX 3L8NA 3SOHB 4FQ0C 4OIYA 4JMOA 3USWA 1BC9A 4JMIA 3LTLA 4C7PA 2R09A 4A4PA 1S9DE 1PBVA 4KN4X 1LKVX 3USYA 1XSZA 4Z21A 4JK1X 1R8SE 1XT0B 4KN7X 3HJLA 4D7RA 2R0DA 4D7QA 3SWVA 1KU1A 4JXHA 3AJCA 1Q8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOH B;  4FQ0 C;  3HJL A;  4FHR B;  3USW A;  1LKV X;  1QC7 A;  3USY A;  3AJC A; 
#chains in the Genus database with same CATH topology
 2K6X A;  3TW5 A;  3ANY A;  2IE7 A;  1A8B A;  1N00 A;  1BO9 A;  4KMU X;  1AII A;  1SAV A;  1MCX A;  3L8N A;  3SOH B;  1HVE A;  1XJL A;  2XO2 A;  4JMI A;  1A8A A;  4Q2S A;  4C7P A;  1DM5 A;  1AOW A;  1ANN A;  1YJ0 A;  1I4A A;  1W45 A;  1YCN A;  1AEI A;  3BRX A;  1R8S E;  1ANX A;  1ALA A;  2HYW A;  2HSN A;  1BCZ A;  1R8Q E;  4FHR B;  1R8M E;  1RE0 B;  1W3W A;  3ABO A;  4L5M A;  1BC1 A;  2OY9 A;  4OIY A;  4EVF A;  1C1K A;  1M9I A;  3AO0 A;  3LTL A;  4A4P A;  1HAK A;  1G5N A;  1S9D E;  1ANW A;  1PBV A;  2ZHJ A;  1N41 A;  3ABS A;  3USY A;  2RAN A;  4HRE A;  1N42 A;  2II2 A;  4D7Q A;  1AVC A;  2ZOC A;  2VXG A;  2IIC A;  2HYV A;  1W7B A;  1UPT B;  3ABQ A;  1YII A;  1AXN A;  1AVH A;  1HVD A;  4JMO A;  3USW A;  1R4A E;  1BCY A;  4X9P A;  2R09 A;  2Q4C A;  4MDV A;  1BC3 A;  1HVF A;  1YGM A;  4KN4 X;  1LKV X;  1HM6 A;  4KN7 X;  2XO3 A;  3HJL A;  1HVG A;  1BC0 A;  2H0K A;  1KU1 A;  4JXH A;  3AJC A;  2H0M A;  1Q8D A;  3ABR A;  4C0A A;  1N44 A;  1QC7 A;  4JWL A;  4MDU A;  4FQ0 C;  1BC9 A;  1BCW A;  2H0L A;  2ZHI A;  2IE6 A;  2HYU A;  1AVR A;  2QEZ A;  1XSZ A;  4Z21 A;  4JK1 X;  1XT0 B;  1DK5 A;  2R0D A;  3SWV A;  4EVH A;  4D7R A; 
#chains in the Genus database with same CATH homology
 4C0A A;  2HSN A;  2K6X A;  3TW5 A;  1R8Q E;  4FHR B;  1R8M E;  1QC7 A;  1RE0 B;  4JWL A;  4L5M A;  4KMU X;  3L8N A;  3SOH B;  4FQ0 C;  4OIY A;  4JMO A;  3USW A;  1BC9 A;  4JMI A;  3LTL A;  4C7P A;  2R09 A;  4A4P A;  1S9D E;  1PBV A;  4KN4 X;  1LKV X;  3USY A;  1XSZ A;  4Z21 A;  4JK1 X;  1R8S E;  1XT0 B;  4KN7 X;  3HJL A;  4D7R A;  2R0D A;  4D7Q A;  3SWV A;  1KU1 A;  4JXH A;  3AJC A;  1Q8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...