1XSZA

The structure of ralf
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
356
structure length
356
Chain Sequence
GASHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDNVKTTVDQPKSWLSFFTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQTKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIERNLALKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords guanine nucleotide exchange protein
publication title The structure of RalF, an ADP-ribosylation factor guanine nucleotide exchange factor from Legionella pneumophila, reveals the presence of a cap over the active site
pubmed doi rcsb
source organism Legionella pneumophila
total genus 129
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
A PF18248 RalF_SCD RalF C-terminal Sec-7 capping domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 1xszA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 1xszA02
3.30.310.140 Alpha Beta 2-Layer Sandwich TATA-Binding Protein sec7 domains 1xszA03
1PBVA 4L5MA 4D7RA 4JMOA 3LTLA 4C0AA 4C7PA 1R8QE 1XSZA 4OIYA 4JWLA 3SWVA 1R8ME 1BC9A 1R8SE 4JXHA 1RE0B 1S9DE 4JMIA 4A4PA 4Z21A 1XT0B 2R09A 3L8NA 4D7QA 2R0DA 1KU1A
chains in the Genus database with same CATH superfamily
1VTOA 4JMOA 4ROCB 1QTPA 4WXAA 1BCZA 1HVFA 1PCZA 3D7QA 1BC1A 1KYFA 1A8AA 1N3CA 5IYCP 2NOIA 2IV9A 1W45A 4HJHA 1QNBA 4EAKA 3OSMA 4MDUA 2JOIA 1LWYA 4C0AA 3CVTA 2QEZA 2HZMA 4HREA 5BMNA 3USWA 1TBAB 3F0ZA 2ZFDB 2HKPA 1G5NA 2Y8QA 4JXHA 4EALA 3DPTA 3OSEA 3CWUA 2JHNA 2HZSA 4X9PA 2II2A 1KY6A 2F7LA 1BC0A 1YQLA 5JMVD 2HYVA 1YTFA 1BCWA 1JFIC 1R8ME 1M3QA 1WQAA 1QC7A 3HS9A 3RSMA 3ABOA 1RE0B 2H0LA 4IL8A 3ENCA 1N42A 2NVMA 2R09A 3ABRA 2K6XA 2D0CA 1T6AA 4WX8A 1UT7A 1LWVA 1TGHA 1C9BB 1J3MA 3CW7A 1ANXA 2HYUA 3OH6A 4Q11A 4B0AA 1RM1A 1QNCA 4EJYA 1QTSA 1QN6A 2DKAA 1NH2A 3CWTA 2R0DA 2IE6A 2IE7A 1A8BA 1UT4A 1P5GX 3TW5A 4EAIA 2QRCA 1XSZA 1YGMA 1AOWA 5EPCA 2V8QA 1PCJX 4KN7X 1AXNA 1Q8DA 1PZDA 2H0MA 4PY5A 1E42A 1YQKA 4ROEB 3DPUA 1MCXA 1HAKA 1I4AA 2QREA 1M5Q1 1YJ0A 4EAGA 1VOLB 2NOHA 4EVHA 4JWLA 2XHIA 3AJCA 3D4VA 3BKQX 4KN4X 2OOYA 1VTLE 4TPSA 1MPGA 1JDYA 2LAEA 1M3HA 1KU1A 3OGDA 1Q9UA 1W3WA 4KMUX 1QNEA 1YTBA 4QG5A 1C4GA 3PDKA 1AVRA 1HVGA 3SOHB 3L8NA 1V5SA 1VKLA 4BJUA 2XO2A 3OH9A 1AIIA 1DK5A 5IYDP 2NOBA 2EHBD 2FKMX 1WJWA 3I0XA 3PMGA 1YCNA 1KO9A 1HVDA 2HL9A 1KFIA 3AO0A 4A4PA 1N3AA 1DIZA 1BO9A 3NA5A 1R4AE 2PWWA 4RODB 1D3UA 3BRXA 1PVSA 2JPIA 2R5XA 1UPTB 2H0KA 2Y8LA 1HU0A 1R8QE 1KFQA 2NWVA 2MJ7A 1K35A 2ZHIA 3IH7A 1QN5A 2H4LX 1BC3A 1AVCA 2YA3A 3TDHA 4Z21A 1SAVA 2YH5A 1HVEA 2IICA 4FQ0C 1QN3A 1AEIA 1PBVA 4FHRB 4D7RA 5F9CA 4OIYA 2D0BA 5AN4A 2OOXA 1ANNA 3SNSA 1R8SE 1QNAA 1ALAA 4WZSD 2HSNA 1YQRA 4Q2SA 1LKVX 3CWSA 1YQMA 3ENOC 1LWWA 1LXTA 4MRQA 2DKCA 3HS8A 2H5AX 2JHJA 5BMPA 2QRDA 1PCMX 3SWVA 2NLVA 2HL8A 3ABSA 1C47A 2D0AA 1BCYA 4MDVA 3H1ZA 2NOEA 4I8OA 1EUVA 1QN9A 4D7QA 1TBPA 1NVPA 1P5DX 3F10A 1K2YX 1W80A 1N44A 2I5WA 1W7BA 1N00A 2V92A 1MP9A 1DM5A 3ASMA 2DKDA 2Z8UA 1KY7A 4JMIA 3USYA 1C1KA 1YIIA 2V9JA 4CFFA 1AVHA 2OY9A 1ANWA 1FN7A 3CVSA 3KTUA 2IV8A 3T4NA 3OCIA 1AISA 2RANA 2ZHJA 2G30A 4EAJA 1S9DE 2VJ0A 1KYDA 1VOKA 3I3WA 1R4XA 4EVFA 3TE5A 1EBMA 3EAYA 3C04A 1HM6A 5IYBP 4DULA 3UW2A 3HJLA 3I0WA 2NOZA 3OLPA 4EJZA 5JN5A 1XT0B 2Q4CA 3OSTA 1XJLA 1QN8A 1UL7A 3KRMA 1TUOA 5KL0A 1QN4A 4L5MA 3RPJA 2HYWA 2ZOCA 1B9KA 1N41A 2FGTA 1BC9A 4JK1X 3VN5A 3EIKA 3N89A 1NGMA 3ULXA 2NOLA 2VXGA 5HSHA 2FKFA 1QN7A 1M9IA 2Z0FA 1CDWA 2QLVA 3LTLA 4C7PA 2O3OA 2QR1A 3ABQA 2XO3A 1N39A 2MZ8A 1KYUA 3OC3C 3CWAA 2FUVA 2NOFA 3ANYA
chains in the Genus database with same CATH topology
1PBVA 3TW5A 4FHRB 4L5MA 4D7RA 4JMOA 3LTLA 4C0AA 4C7PA 1R8QE 1XSZA 4OIYA 4KMUX 4JWLA 3SWVA 1R8ME 3AJCA 1BC9A 3USWA 3HJLA 4JK1X 4KN4X 1QC7A 4KN7X 1R8SE 1Q8DA 4JXHA 1RE0B 2HSNA 1S9DE 4JMIA 1LKVX 4A4PA 3USYA 4Z21A 1XT0B 3SOHB 2R09A 3L8NA 2K6XA 4D7QA 2R0DA 4FQ0C 1KU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBV A;  4L5M A;  4D7R A;  4JMO A;  3LTL A;  4C0A A;  4C7P A;  1R8Q E;  1XSZ A;  4OIY A;  4JWL A;  3SWV A;  1R8M E;  1BC9 A;  1R8S E;  4JXH A;  1RE0 B;  1S9D E;  4JMI A;  4A4P A;  4Z21 A;  1XT0 B;  2R09 A;  3L8N A;  4D7Q A;  2R0D A;  1KU1 A; 
#chains in the Genus database with same CATH topology
 1VTO A;  4JMO A;  4ROC B;  1QTP A;  4WXA A;  1BCZ A;  1HVF A;  1PCZ A;  3D7Q A;  1BC1 A;  1KYF A;  1A8A A;  1N3C A;  5IYC P;  2NOI A;  2IV9 A;  1W45 A;  4HJH A;  1QNB A;  4EAK A;  3OSM A;  4MDU A;  2JOI A;  1LWY A;  4C0A A;  3CVT A;  2QEZ A;  2HZM A;  4HRE A;  5BMN A;  3USW A;  1TBA B;  3F0Z A;  2ZFD B;  2HKP A;  1G5N A;  2Y8Q A;  4JXH A;  4EAL A;  3DPT A;  3OSE A;  3CWU A;  2JHN A;  2HZS A;  4X9P A;  2II2 A;  1KY6 A;  2F7L A;  1BC0 A;  1YQL A;  5JMV D;  2HYV A;  1YTF A;  1BCW A;  1JFI C;  1R8M E;  1M3Q A;  1WQA A;  1QC7 A;  3HS9 A;  3RSM A;  3ABO A;  1RE0 B;  2H0L A;  4IL8 A;  3ENC A;  1N42 A;  2NVM A;  2R09 A;  3ABR A;  2K6X A;  2D0C A;  1T6A A;  4WX8 A;  1UT7 A;  1LWV A;  1TGH A;  1C9B B;  1J3M A;  3CW7 A;  1ANX A;  2HYU A;  3OH6 A;  4Q11 A;  4B0A A;  1RM1 A;  1QNC A;  4EJY A;  1QTS A;  1QN6 A;  2DKA A;  1NH2 A;  3CWT A;  2R0D A;  2IE6 A;  2IE7 A;  1A8B A;  1UT4 A;  1P5G X;  3TW5 A;  4EAI A;  2QRC A;  1XSZ A;  1YGM A;  1AOW A;  5EPC A;  2V8Q A;  1PCJ X;  4KN7 X;  1AXN A;  1Q8D A;  1PZD A;  2H0M A;  4PY5 A;  1E42 A;  1YQK A;  4ROE B;  3DPU A;  1MCX A;  1HAK A;  1I4A A;  2QRE A;  1M5Q 1;  1YJ0 A;  4EAG A;  1VOL B;  2NOH A;  4EVH A;  4JWL A;  2XHI A;  3AJC A;  3D4V A;  3BKQ X;  4KN4 X;  2OOY A;  1VTL E;  4TPS A;  1MPG A;  1JDY A;  2LAE A;  1M3H A;  1KU1 A;  3OGD A;  1Q9U A;  1W3W A;  4KMU X;  1QNE A;  1YTB A;  4QG5 A;  1C4G A;  3PDK A;  1AVR A;  1HVG A;  3SOH B;  3L8N A;  1V5S A;  1VKL A;  4BJU A;  2XO2 A;  3OH9 A;  1AII A;  1DK5 A;  5IYD P;  2NOB A;  2EHB D;  2FKM X;  1WJW A;  3I0X A;  3PMG A;  1YCN A;  1KO9 A;  1HVD A;  2HL9 A;  1KFI A;  3AO0 A;  4A4P A;  1N3A A;  1DIZ A;  1BO9 A;  3NA5 A;  1R4A E;  2PWW A;  4ROD B;  1D3U A;  3BRX A;  1PVS A;  2JPI A;  2R5X A;  1UPT B;  2H0K A;  2Y8L A;  1HU0 A;  1R8Q E;  1KFQ A;  2NWV A;  2MJ7 A;  1K35 A;  2ZHI A;  3IH7 A;  1QN5 A;  2H4L X;  1BC3 A;  1AVC A;  2YA3 A;  3TDH A;  4Z21 A;  1SAV A;  2YH5 A;  1HVE A;  2IIC A;  4FQ0 C;  1QN3 A;  1AEI A;  1PBV A;  4FHR B;  4D7R A;  5F9C A;  4OIY A;  2D0B A;  5AN4 A;  2OOX A;  1ANN A;  3SNS A;  1R8S E;  1QNA A;  1ALA A;  4WZS D;  2HSN A;  1YQR A;  4Q2S A;  1LKV X;  3CWS A;  1YQM A;  3ENO C;  1LWW A;  1LXT A;  4MRQ A;  2DKC A;  3HS8 A;  2H5A X;  2JHJ A;  5BMP A;  2QRD A;  1PCM X;  3SWV A;  2NLV A;  2HL8 A;  3ABS A;  1C47 A;  2D0A A;  1BCY A;  4MDV A;  3H1Z A;  2NOE A;  4I8O A;  1EUV A;  1QN9 A;  4D7Q A;  1TBP A;  1NVP A;  1P5D X;  3F10 A;  1K2Y X;  1W80 A;  1N44 A;  2I5W A;  1W7B A;  1N00 A;  2V92 A;  1MP9 A;  1DM5 A;  3ASM A;  2DKD A;  2Z8U A;  1KY7 A;  4JMI A;  3USY A;  1C1K A;  1YII A;  2V9J A;  4CFF A;  1AVH A;  2OY9 A;  1ANW A;  1FN7 A;  3CVS A;  3KTU A;  2IV8 A;  3T4N A;  3OCI A;  1AIS A;  2RAN A;  2ZHJ A;  2G30 A;  4EAJ A;  1S9D E;  2VJ0 A;  1KYD A;  1VOK A;  3I3W A;  1R4X A;  4EVF A;  3TE5 A;  1EBM A;  3EAY A;  3C04 A;  1HM6 A;  5IYB P;  4DUL A;  3UW2 A;  3HJL A;  3I0W A;  2NOZ A;  3OLP A;  4EJZ A;  5JN5 A;  1XT0 B;  2Q4C A;  3OST A;  1XJL A;  1QN8 A;  1UL7 A;  3KRM A;  1TUO A;  5KL0 A;  1QN4 A;  4L5M A;  3RPJ A;  2HYW A;  2ZOC A;  1B9K A;  1N41 A;  2FGT A;  1BC9 A;  4JK1 X;  3VN5 A;  3EIK A;  3N89 A;  1NGM A;  3ULX A;  2NOL A;  2VXG A;  5HSH A;  2FKF A;  1QN7 A;  1M9I A;  2Z0F A;  1CDW A;  2QLV A;  3LTL A;  4C7P A;  2O3O A;  2QR1 A;  3ABQ A;  2XO3 A;  1N39 A;  2MZ8 A;  1KYU A;  3OC3 C;  3CWA A;  2FUV A;  2NOF A;  3ANY A; 
#chains in the Genus database with same CATH homology
 1PBV A;  3TW5 A;  4FHR B;  4L5M A;  4D7R A;  4JMO A;  3LTL A;  4C0A A;  4C7P A;  1R8Q E;  1XSZ A;  4OIY A;  4KMU X;  4JWL A;  3SWV A;  1R8M E;  3AJC A;  1BC9 A;  3USW A;  3HJL A;  4JK1 X;  4KN4 X;  1QC7 A;  4KN7 X;  1R8S E;  1Q8D A;  4JXH A;  1RE0 B;  2HSN A;  1S9D E;  4JMI A;  1LKV X;  4A4P A;  3USY A;  4Z21 A;  1XT0 B;  3SOH B;  2R09 A;  3L8N A;  2K6X A;  4D7Q A;  2R0D A;  4FQ0 C;  1KU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...