1XSZA

The structure of ralf
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
356
structure length
356
Chain Sequence
GASHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDNVKTTVDQPKSWLSFFTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQTKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIERNLALKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords guanine nucleotide exchange protein
publication title The structure of RalF, an ADP-ribosylation factor guanine nucleotide exchange factor from Legionella pneumophila, reveals the presence of a cap over the active site
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Signaling protein
total genus 129
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
A PF18248 RalF_SCD RalF C-terminal Sec-7 capping domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 1xszA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 1xszA02
3.30.310.140 Alpha Beta 2-Layer Sandwich TATA-Binding Protein sec7 domains 1xszA03
1KU1A 1XSZA 4JMIA 4Z21A 4JWLA 1R8QE 1PBVA 4OIYA 3LTLA 2R0DA 1RE0B 3SWVA 1R8SE 4D7QA 4L5MA 1R8ME 4JXHA 1BC9A 1S9DE 4D7RA 4A4PA 2R09A 4C0AA 4JMOA 1XT0B 4C7PA 3L8NA
chains in the Genus database with same CATH superfamily
4JMIA 1EBMA 2EHBD 2FKFA 3OH9A 1QN8A 1I4AA 4MDVA 1N3AA 1BCYA 1W3WA 1AVRA 1Q8DA 2V92A 3TE5A 5AN4A 2DKDA 3OLPA 3OSMA 3F10A 1BC1A 1QNAA 3I0XA 1QTSA 1KO9A 2Y8QA 1R8ME 1HVFA 3VN5A 1JDYA 4FQ0C 4RODB 2O3OA 1YJ0A 3H1ZA 1YTBA 1VOLB 4PY5A 1K35A 1WQAA 1ANNA 3EIKA 1KU1A 3CVSA 1AVHA 1QN7A 4DULA 4MRQA 1TGHA 2IV9A 2HKPA 1VKLA 3EAYA 2QLVA 5IYDP 2JHNA 1S9DE 1NVPA 3KTUA 2HYWA 4EVHA 1QN6A 4C0AA 4JMOA 1MCXA 1AIIA 2H5AX 1KYFA 3BKQX 1N39A 3N89A 2I5WA 3OC3C 2HYUA 5HSHA 2Y8LA 3DPUA 3NA5A 4FHRB 2JHJA 5IYCP 2MZ8A 2R0DA 1VTOA 2V9JA 3ASMA 3OH6A 3ABQA 2H0KA 1AISA 1EUVA 1DK5A 1PCJX 1LWYA 3USWA 1N44A 1N42A 2JOIA 5JMVD 1C47A 4OIYA 3HS9A 2F7LA 3UW2A 5BMNA 4A4PA 1CDWA 1M5Q1 2H0MA 4EJYA 3ENCA 2FGTA 1QNCA 3ABOA 1SAVA 1XSZA 3OSEA 1VTLE 2OOYA 1V5SA 3ABRA 1BCZA 2NOFA 2JPIA 1AVCA 3HJLA 3RSMA 3IH7A 4WZSD 1LWVA 1ANWA 1UL7A 1LWWA 3CW7A 1W7BA 1YQRA 4B0AA 4JK1X 4WX8A 3DPTA 2QREA 5F9CA 1PZDA 1A8BA 1R4AE 1PCZA 3USYA 4Q11A 2D0BA 4EVFA 2OY9A 2QRDA 3BRXA 1XT0B 1QC7A 2FKMX 1NH2A 2HL8A 1C4GA 4MDUA 1N3CA 1KY6A 1T6AA 3PMGA 1ANXA 1BC3A 2VXGA 4KN4X 1B9KA 1YGMA 3ABSA 3CWUA 4Q2SA 1QN5A 1C1KA 4EALA 4EAKA 2IE7A 1QNBA 4C7PA 4HREA 4ROEB 3C04A 2QRCA 1K2YX 4ROCB 1KY7A 1DM5A 1PCMX 1LXTA 2NWVA 1N41A 1XJLA 4CFFA 1UT7A 2NOZA 2NOLA 1HM6A 1TUOA 2HZSA 3L8NA 1QN9A 2ZHIA 2IV8A 1MPGA 1PBVA 2IICA 1UPTB 2G30A 2ZFDB 2D0AA 1PVSA 1BC9A 3F0ZA 4EAGA 1BCWA 1DIZA 2K6XA 2OOXA 4BJUA 3TDHA 1Q9UA 1QN4A 3OSTA 1C9BB 3PDKA 1W80A 2MJ7A 1A8AA 3CWTA 3LTLA 1RE0B 1YQMA 3T4NA 1J3MA 2XO3A 1FN7A 2Q4CA 2RANA 1P5GX 2IE6A 1KYDA 1P5DX 1YCNA 2NLVA 5JN5A 1YQKA 2Z0FA 4Z21A 4EJZA 3TW5A 1R8SE 1RM1A 1AXNA 1N00A 4IL8A 2ZOCA 2LAEA 3CWSA 1MP9A 4WXAA 2NOBA 1HVEA 1KFIA 1AEIA 3SWVA 4TPSA 3HS8A 1WJWA 1KFQA 2DKCA 4D7RA 4X9PA 1YIIA 3CVTA 1QTPA 3D7QA 4KN7X 1W45A 2NOHA 3D4VA 2NOEA 2VJ0A 3OGDA 1AOWA 2HSNA 2PWWA 3SOHB 1E42A 2H4LX 2XO2A 3CWAA 4EAJA 2DKAA 1M3QA 2NVMA 1YTFA 4HJHA 2R09A 1HAKA 3ULXA 2D0CA 2R5XA 5IYBP 2HYVA 2YA3A 3KRMA 4EAIA 2NOIA 1YQLA 2V8QA 1BO9A 3SNSA 2Z8UA 1HVDA 4D7QA 1KYUA 3RPJA 4JXHA 2HZMA 2ZHJA 4I8OA 1BC0A 3AJCA 3I0WA 2FUVA 1M3HA 2QR1A 3I3WA 5BMPA 1QN3A 1HU0A 1HVGA 1ALAA 3ANYA 1JFIC 5KL0A 4JWLA 1LKVX 1R8QE 2YH5A 1UT4A 1D3UA 1TBAB 1G5NA 4L5MA 2QEZA 2XHIA 1TBPA 1R4XA 5EPCA 3ENOC 1VOKA 1NGMA 2HL9A 3OCIA 2H0LA 4QG5A 1M9IA 2II2A 1QNEA 4KMUX 3AO0A
chains in the Genus database with same CATH topology
1KU1A 1XSZA 4JMIA 3USWA 4Z21A 4JWLA 1LKVX 1R8QE 4FHRB 1PBVA 4JK1X 2HSNA 3TW5A 4OIYA 3LTLA 2R0DA 1RE0B 3SOHB 1R8SE 3SWVA 4D7QA 4L5MA 1R8ME 4JXHA 1BC9A 1S9DE 4KN4X 4FQ0C 3HJLA 4D7RA 3USYA 4A4PA 2R09A 3AJCA 4C0AA 4JMOA 1Q8DA 1XT0B 2K6XA 4KN7X 1QC7A 4C7PA 4KMUX 3L8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU1 A;  1XSZ A;  4JMI A;  4Z21 A;  4JWL A;  1R8Q E;  1PBV A;  4OIY A;  3LTL A;  2R0D A;  1RE0 B;  3SWV A;  1R8S E;  4D7Q A;  4L5M A;  1R8M E;  4JXH A;  1BC9 A;  1S9D E;  4D7R A;  4A4P A;  2R09 A;  4C0A A;  4JMO A;  1XT0 B;  4C7P A;  3L8N A; 
#chains in the Genus database with same CATH topology
 4JMI A;  1EBM A;  2EHB D;  2FKF A;  3OH9 A;  1QN8 A;  1I4A A;  4MDV A;  1N3A A;  1BCY A;  1W3W A;  1AVR A;  1Q8D A;  2V92 A;  3TE5 A;  5AN4 A;  2DKD A;  3OLP A;  3OSM A;  3F10 A;  1BC1 A;  1QNA A;  3I0X A;  1QTS A;  1KO9 A;  2Y8Q A;  1R8M E;  1HVF A;  3VN5 A;  1JDY A;  4FQ0 C;  4ROD B;  2O3O A;  1YJ0 A;  3H1Z A;  1YTB A;  1VOL B;  4PY5 A;  1K35 A;  1WQA A;  1ANN A;  3EIK A;  1KU1 A;  3CVS A;  1AVH A;  1QN7 A;  4DUL A;  4MRQ A;  1TGH A;  2IV9 A;  2HKP A;  1VKL A;  3EAY A;  2QLV A;  5IYD P;  2JHN A;  1S9D E;  1NVP A;  3KTU A;  2HYW A;  4EVH A;  1QN6 A;  4C0A A;  4JMO A;  1MCX A;  1AII A;  2H5A X;  1KYF A;  3BKQ X;  1N39 A;  3N89 A;  2I5W A;  3OC3 C;  2HYU A;  5HSH A;  2Y8L A;  3DPU A;  3NA5 A;  4FHR B;  2JHJ A;  5IYC P;  2MZ8 A;  2R0D A;  1VTO A;  2V9J A;  3ASM A;  3OH6 A;  3ABQ A;  2H0K A;  1AIS A;  1EUV A;  1DK5 A;  1PCJ X;  1LWY A;  3USW A;  1N44 A;  1N42 A;  2JOI A;  5JMV D;  1C47 A;  4OIY A;  3HS9 A;  2F7L A;  3UW2 A;  5BMN A;  4A4P A;  1CDW A;  1M5Q 1;  2H0M A;  4EJY A;  3ENC A;  2FGT A;  1QNC A;  3ABO A;  1SAV A;  1XSZ A;  3OSE A;  1VTL E;  2OOY A;  1V5S A;  3ABR A;  1BCZ A;  2NOF A;  2JPI A;  1AVC A;  3HJL A;  3RSM A;  3IH7 A;  4WZS D;  1LWV A;  1ANW A;  1UL7 A;  1LWW A;  3CW7 A;  1W7B A;  1YQR A;  4B0A A;  4JK1 X;  4WX8 A;  3DPT A;  2QRE A;  5F9C A;  1PZD A;  1A8B A;  1R4A E;  1PCZ A;  3USY A;  4Q11 A;  2D0B A;  4EVF A;  2OY9 A;  2QRD A;  3BRX A;  1XT0 B;  1QC7 A;  2FKM X;  1NH2 A;  2HL8 A;  1C4G A;  4MDU A;  1N3C A;  1KY6 A;  1T6A A;  3PMG A;  1ANX A;  1BC3 A;  2VXG A;  4KN4 X;  1B9K A;  1YGM A;  3ABS A;  3CWU A;  4Q2S A;  1QN5 A;  1C1K A;  4EAL A;  4EAK A;  2IE7 A;  1QNB A;  4C7P A;  4HRE A;  4ROE B;  3C04 A;  2QRC A;  1K2Y X;  4ROC B;  1KY7 A;  1DM5 A;  1PCM X;  1LXT A;  2NWV A;  1N41 A;  1XJL A;  4CFF A;  1UT7 A;  2NOZ A;  2NOL A;  1HM6 A;  1TUO A;  2HZS A;  3L8N A;  1QN9 A;  2ZHI A;  2IV8 A;  1MPG A;  1PBV A;  2IIC A;  1UPT B;  2G30 A;  2ZFD B;  2D0A A;  1PVS A;  1BC9 A;  3F0Z A;  4EAG A;  1BCW A;  1DIZ A;  2K6X A;  2OOX A;  4BJU A;  3TDH A;  1Q9U A;  1QN4 A;  3OST A;  1C9B B;  3PDK A;  1W80 A;  2MJ7 A;  1A8A A;  3CWT A;  3LTL A;  1RE0 B;  1YQM A;  3T4N A;  1J3M A;  2XO3 A;  1FN7 A;  2Q4C A;  2RAN A;  1P5G X;  2IE6 A;  1KYD A;  1P5D X;  1YCN A;  2NLV A;  5JN5 A;  1YQK A;  2Z0F A;  4Z21 A;  4EJZ A;  3TW5 A;  1R8S E;  1RM1 A;  1AXN A;  1N00 A;  4IL8 A;  2ZOC A;  2LAE A;  3CWS A;  1MP9 A;  4WXA A;  2NOB A;  1HVE A;  1KFI A;  1AEI A;  3SWV A;  4TPS A;  3HS8 A;  1WJW A;  1KFQ A;  2DKC A;  4D7R A;  4X9P A;  1YII A;  3CVT A;  1QTP A;  3D7Q A;  4KN7 X;  1W45 A;  2NOH A;  3D4V A;  2NOE A;  2VJ0 A;  3OGD A;  1AOW A;  2HSN A;  2PWW A;  3SOH B;  1E42 A;  2H4L X;  2XO2 A;  3CWA A;  4EAJ A;  2DKA A;  1M3Q A;  2NVM A;  1YTF A;  4HJH A;  2R09 A;  1HAK A;  3ULX A;  2D0C A;  2R5X A;  5IYB P;  2HYV A;  2YA3 A;  3KRM A;  4EAI A;  2NOI A;  1YQL A;  2V8Q A;  1BO9 A;  3SNS A;  2Z8U A;  1HVD A;  4D7Q A;  1KYU A;  3RPJ A;  4JXH A;  2HZM A;  2ZHJ A;  4I8O A;  1BC0 A;  3AJC A;  3I0W A;  2FUV A;  1M3H A;  2QR1 A;  3I3W A;  5BMP A;  1QN3 A;  1HU0 A;  1HVG A;  1ALA A;  3ANY A;  1JFI C;  5KL0 A;  4JWL A;  1LKV X;  1R8Q E;  2YH5 A;  1UT4 A;  1D3U A;  1TBA B;  1G5N A;  4L5M A;  2QEZ A;  2XHI A;  1TBP A;  1R4X A;  5EPC A;  3ENO C;  1VOK A;  1NGM A;  2HL9 A;  3OCI A;  2H0L A;  4QG5 A;  1M9I A;  2II2 A;  1QNE A;  4KMU X;  3AO0 A; 
#chains in the Genus database with same CATH homology
 1KU1 A;  1XSZ A;  4JMI A;  3USW A;  4Z21 A;  4JWL A;  1LKV X;  1R8Q E;  4FHR B;  1PBV A;  4JK1 X;  2HSN A;  3TW5 A;  4OIY A;  3LTL A;  2R0D A;  1RE0 B;  3SOH B;  1R8S E;  3SWV A;  4D7Q A;  4L5M A;  1R8M E;  4JXH A;  1BC9 A;  1S9D E;  4KN4 X;  4FQ0 C;  3HJL A;  4D7R A;  3USY A;  4A4P A;  2R09 A;  3AJC A;  4C0A A;  4JMO A;  1Q8D A;  1XT0 B;  2K6X A;  4KN7 X;  1QC7 A;  4C7P A;  4KMU X;  3L8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...