1YJ0A

Crystal structures of chicken annexin v in complex with zn2+
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
317
structure length
317
Chain Sequence
KYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQANRDPDGRVDEALVEKDAQVLFRAGELKWGTDEETFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGDLEKLLLAVVKCIRSVPAYFAETLYYSMKGAGTDDDTLIRVMVSRSEIDLLDIRHEFRKNFAKSLYQMIQKDTSGDYRKALLLLCGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Annexin A5
publication title Crystal Structures of Chicken Annexin A5 in Complex with Functional Modifiers Ca2+ and Zn2+ Reveal Zn2+ Induced Formation of Non-Planar Assemblies
pubmed rcsb
molecule tags Protein and metal binding protein
total genus 118
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yj0A02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yj0A04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yj0A01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yj0A03
1ALAA 2HYWA 1N44A 1BCZA 2HYVA 1W7BA 2IICA 2IE7A 1A8BA 1N00A 1BO9A 1W3WA 1YIIA 4MDVA 1AIIA 1BC1A 1SAVA 1MCXA 4MDUA 1AXNA 1HVEA 1AVHA 1HVDA 4EVFA 1XJLA 2XO2A 1BCYA 1M9IA 1A8AA 1BCWA 4X9PA 1DM5A 2H0LA 2ZHIA 1AOWA 1ANNA 1HAKA 1G5NA 1YJ0A 2HYUA 1AVRA 1ANWA 1BC3A 1I4AA 1HVFA 1N41A 1AEIA 1W45A 1YCNA 2Q4CA 2ZHJA 3BRXA 1HM6A 2RANA 4HREA 1N42A 1DK5A 2XO3A 2II2A 1HVGA 1BC0A 1AVCA 2H0KA 2IE6A 2ZOCA 1ANXA 4EVHA 2H0MA
chains in the Genus database with same CATH superfamily
2K6XA 3TW5A 3ANYA 2IE7A 1A8BA 1N00A 1BO9A 4KMUX 1AIIA 1SAVA 1MCXA 3L8NA 3SOHB 1HVEA 1XJLA 2XO2A 4JMIA 1A8AA 4Q2SA 4C7PA 1DM5A 1AOWA 1ANNA 1YJ0A 1I4AA 1W45A 1YCNA 1AEIA 3BRXA 1R8SE 1ANXA 1ALAA 2HYWA 2HSNA 1BCZA 1R8QE 4FHRB 1R8ME 1RE0B 1W3WA 3ABOA 4L5MA 1BC1A 2OY9A 4OIYA 4EVFA 1C1KA 1M9IA 3AO0A 3LTLA 4A4PA 1HAKA 1G5NA 1S9DE 1ANWA 1PBVA 2ZHJA 1N41A 3ABSA 3USYA 2RANA 4HREA 1N42A 2II2A 4D7QA 1AVCA 2ZOCA 2VXGA 2IICA 2HYVA 1W7BA 1UPTB 3ABQA 1YIIA 1AXNA 1AVHA 1HVDA 4JMOA 3USWA 1R4AE 1BCYA 4X9PA 2R09A 2Q4CA 4MDVA 1BC3A 1HVFA 1YGMA 4KN4X 1LKVX 1HM6A 4KN7X 2XO3A 3HJLA 1HVGA 1BC0A 2H0KA 1KU1A 4JXHA 3AJCA 2H0MA 1Q8DA 3ABRA 4C0AA 1N44A 1QC7A 4JWLA 4MDUA 4FQ0C 1BC9A 1BCWA 2H0LA 2ZHIA 2IE6A 2HYUA 1AVRA 2QEZA 1XSZA 4Z21A 4JK1X 1XT0B 1DK5A 2R0DA 3SWVA 4EVHA 4D7RA
chains in the Genus database with same CATH topology
1ALAA 2HYWA 1N44A 1BCZA 2HYVA 1W7BA 2IICA 2IE7A 1A8BA 1N00A 1BO9A 1W3WA 1YIIA 4MDVA 1AIIA 1BC1A 1SAVA 1MCXA 4MDUA 1AXNA 1HVEA 1AVHA 1HVDA 4EVFA 1XJLA 2XO2A 1BCYA 1M9IA 1A8AA 1BCWA 4X9PA 1DM5A 2H0LA 2ZHIA 1AOWA 1ANNA 1HAKA 1G5NA 1YJ0A 2HYUA 1AVRA 1ANWA 1BC3A 1I4AA 1HVFA 1N41A 1AEIA 1W45A 1YCNA 2Q4CA 2ZHJA 3BRXA 1HM6A 2RANA 4HREA 1N42A 1DK5A 2XO3A 2II2A 1HVGA 1BC0A 1AVCA 2H0KA 2IE6A 2ZOCA 1ANXA 4EVHA 2H0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALA A;  2HYW A;  1N44 A;  1BCZ A;  2HYV A;  1W7B A;  2IIC A;  2IE7 A;  1A8B A;  1N00 A;  1BO9 A;  1W3W A;  1YII A;  4MDV A;  1AII A;  1BC1 A;  1SAV A;  1MCX A;  4MDU A;  1AXN A;  1HVE A;  1AVH A;  1HVD A;  4EVF A;  1XJL A;  2XO2 A;  1BCY A;  1M9I A;  1A8A A;  1BCW A;  4X9P A;  1DM5 A;  2H0L A;  2ZHI A;  1AOW A;  1ANN A;  1HAK A;  1G5N A;  1YJ0 A;  2HYU A;  1AVR A;  1ANW A;  1BC3 A;  1I4A A;  1HVF A;  1N41 A;  1AEI A;  1W45 A;  1YCN A;  2Q4C A;  2ZHJ A;  3BRX A;  1HM6 A;  2RAN A;  4HRE A;  1N42 A;  1DK5 A;  2XO3 A;  2II2 A;  1HVG A;  1BC0 A;  1AVC A;  2H0K A;  2IE6 A;  2ZOC A;  1ANX A;  4EVH A;  2H0M A; 
#chains in the Genus database with same CATH topology
 2K6X A;  3TW5 A;  3ANY A;  2IE7 A;  1A8B A;  1N00 A;  1BO9 A;  4KMU X;  1AII A;  1SAV A;  1MCX A;  3L8N A;  3SOH B;  1HVE A;  1XJL A;  2XO2 A;  4JMI A;  1A8A A;  4Q2S A;  4C7P A;  1DM5 A;  1AOW A;  1ANN A;  1YJ0 A;  1I4A A;  1W45 A;  1YCN A;  1AEI A;  3BRX A;  1R8S E;  1ANX A;  1ALA A;  2HYW A;  2HSN A;  1BCZ A;  1R8Q E;  4FHR B;  1R8M E;  1RE0 B;  1W3W A;  3ABO A;  4L5M A;  1BC1 A;  2OY9 A;  4OIY A;  4EVF A;  1C1K A;  1M9I A;  3AO0 A;  3LTL A;  4A4P A;  1HAK A;  1G5N A;  1S9D E;  1ANW A;  1PBV A;  2ZHJ A;  1N41 A;  3ABS A;  3USY A;  2RAN A;  4HRE A;  1N42 A;  2II2 A;  4D7Q A;  1AVC A;  2ZOC A;  2VXG A;  2IIC A;  2HYV A;  1W7B A;  1UPT B;  3ABQ A;  1YII A;  1AXN A;  1AVH A;  1HVD A;  4JMO A;  3USW A;  1R4A E;  1BCY A;  4X9P A;  2R09 A;  2Q4C A;  4MDV A;  1BC3 A;  1HVF A;  1YGM A;  4KN4 X;  1LKV X;  1HM6 A;  4KN7 X;  2XO3 A;  3HJL A;  1HVG A;  1BC0 A;  2H0K A;  1KU1 A;  4JXH A;  3AJC A;  2H0M A;  1Q8D A;  3ABR A;  4C0A A;  1N44 A;  1QC7 A;  4JWL A;  4MDU A;  4FQ0 C;  1BC9 A;  1BCW A;  2H0L A;  2ZHI A;  2IE6 A;  2HYU A;  1AVR A;  2QEZ A;  1XSZ A;  4Z21 A;  4JK1 X;  1XT0 B;  1DK5 A;  2R0D A;  3SWV A;  4EVH A;  4D7R A; 
#chains in the Genus database with same CATH homology
 1ALA A;  2HYW A;  1N44 A;  1BCZ A;  2HYV A;  1W7B A;  2IIC A;  2IE7 A;  1A8B A;  1N00 A;  1BO9 A;  1W3W A;  1YII A;  4MDV A;  1AII A;  1BC1 A;  1SAV A;  1MCX A;  4MDU A;  1AXN A;  1HVE A;  1AVH A;  1HVD A;  4EVF A;  1XJL A;  2XO2 A;  1BCY A;  1M9I A;  1A8A A;  1BCW A;  4X9P A;  1DM5 A;  2H0L A;  2ZHI A;  1AOW A;  1ANN A;  1HAK A;  1G5N A;  1YJ0 A;  2HYU A;  1AVR A;  1ANW A;  1BC3 A;  1I4A A;  1HVF A;  1N41 A;  1AEI A;  1W45 A;  1YCN A;  2Q4C A;  2ZHJ A;  3BRX A;  1HM6 A;  2RAN A;  4HRE A;  1N42 A;  1DK5 A;  2XO3 A;  2II2 A;  1HVG A;  1BC0 A;  1AVC A;  2H0K A;  2IE6 A;  2ZOC A;  1ANX A;  4EVH A;  2H0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...