1C1KA

Bacteriophage t4 gene 59 helicase assembly protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
MIKLRMPAGGERYIDGKSVYKLYLMIKQHMNGKYDVIKYNWCMRVSDAAYQKRRDKYFFQKLSEKYKLKELALIFISNLVANQDAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIFEYNPKVQSSYIFKLLQSNIISFETFILLDSFLNIIDKHDEQTDNLVWNNYSIKLKAYRKILNIDSQKAKNVFIETVKSCKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords BPT4 GENE 59 HELICASE ASSEMBLY PROTEIN
publication title Bacteriophage T4 gene 59 helicase assembly protein binds replication fork DNA. The 1.45 A resolution crystal structure reveals a novel alpha-helical two-domain fold.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08993 T4_Gp59_N T4 gene Gp59 loader of gp41 DNA helicase
A PF08994 T4_Gp59_C T4 gene Gp59 loader of gp41 DNA helicase C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1c1kA01
1.10.220.50 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Bacteriophage T4, Gp59, helicase assembly protein, C-terminal domain 1c1kA02
1IN4A 2Z4RA 1IN5A 5EP2A 2QPAA 4ZPXA 2V6ZM 3VLFB 1DO2A 1XXHB 1D2NA 4FCTA 2R62A 1R6BX 1NY5A 4GITA 4FD2A 3K1JA 2DZNB 4QNRA 1G41A 1SXJA 4KODA 2DWZB 5FTLA 2DZOB 2DVWB 3H4MA 3KDSE 4EIWA 5DYIA 5JI3E 3GLFB 4A3VB 4Z8XA 4LJ5A 1KSFX 3HU1A 5FTMA 3GLGB 3GLIA 4L16A 3PFIA 1X37A 4I4LA 1G3IA 1W5TA 2HCBA 1C1KA 4L4UA 1SXJC 1IN8A 1NVMA 4LJAA 1G4AE 1OFHA 4I81A 1SXJD 3U61B 2C96A 3CF2A 4QHTA 2RKOA 2QBYA 3WHLA 1HT2E 4FW9A 3MHVC 5FTJA 2CEAA 5FTNA 1JR3A 1IY1A 4LJ7A 4LRSA 4QNMA 3CF0A 3R8FA 4FWGA 1SXJB 4LGMA 1QZMA 4LJ8A 3ZH9B 1OFIA 5C18A 2R65A 1IY2A 3GLHA 3D8BA 4LJ4A 3UK6A 5EP3A 1IXZA 1IXSB 1XWIA 3PXGA 4QHSA 3GLIB 5EXSA 2VIIA 2ZAOA 3SC3A 1NJFA 3WHKA 2C9OA 1KYIA 2C9CA 3SYKA 1OJLA 2C99A 1JR3D 1NY6A 3M0EA 4LJ9A 2V1UA 2XSZA 1HQCA 5FTKA 2ZANA 1IN6A 2QBYB 2Z4SA 1J7KA 2X8AA 5EQTA 2QP9X 1S3SA 2CHVA 4D80A 5EP1A 1IM2A 3HU3A 2BJWA 4LCBA 2KRKA 1HT1E 4L15A 3PVSA 5EP4A 1QVRA 3BOSA 2CHGA 4FWHA 3GLHB 4LZZA 3U5ZB 4FCWA 4FCVA 1UM8A 1SXJE 2XSZD 4D81A 2QZ4A 1IQPA 4LJ6A 3EIEA 5C1BA 1XXHA 1R7RA 3HU2A 4D82A 2BJVA 3AJIB 4WW0A 4QOSA 1DO0A 1FNNA 2C98A 1E32A 5JI2E 2CHQA 2DHRA 4KO8A 1E94E 5EXTA 1W5SA 3VFDA 5EXXA 1NSFA 1IN7A 4LY6A 3KW6A 4JN6A 3GLFA 3M6AA 3DZDA 1L8QA 2QENA 1JQJC 2ZAMA 3HWSA 2FNAA 3SYLA 1NJGA 3EIHA 3GLGA 3U60B 1IY0A 4LRTA 5DYGA 1LV7A 1IXRC 1HQYE 3B9PA 2CE7A 4FWDA 5EXPA 4KLNA
chains in the Genus database with same CATH superfamily
1Z5CA 2Z4RA 1IN5A 3U61A 2M60A 4Q2SA 1GKIA 2QPAA 3LCVB 4JI8M 4ZPXA 2V6ZM 4IJEA 1HVDA 1DO2A 1HVGA 4OW0A 1VEKA 1N00A 2R18A 4FCTA 2QHOB 2HWJA 3B74A 4OVZA 3FYDA 4AG5A 4R7GA 2II2A 1XC8A 5FTLA 1W45A 3GQ3A 3KSXA 1QQWA 2DVWB 3CF6E 4Y28F 3KDSE 4AQYM 4W5WA 3SMSA 2UXCM 2H0MA 4B7FA 1MU5A 1P3QQ 2R4EA 3L28A 3GLFB 1KU1A 1BO9A 4HEOA 5FTMA 4JK1X 2MROB 3PFIA 2K0BX 4I4LA 3IHPA 3GO8A 1VG5A 1BCZA 1XJLA 1OAOC 2XO3A 3KXEC 1NNJA 2RGOA 4BB9A 1W5TA 2GNOA 3RGSA 2IICA 4X62M 1G4AE 1OFHA 2MH8A 3IG5A 4I81A 5E6JA 2HSNA 3ABRA 2C96A 2L7HA 2K6BA 2VF8A 2XH9A 3WHLA 3SOHB 1WHCA 4CIZA 3MHVC 4XGIA 3DOAA 2G8LA 1PM5A 4JXHA 1MX0A 1IY1A 4HREA 1YLAA 4LRSA 1WGLA 4C0AA 5KQDA 2CUZA 2D7HA 4FWGA 4LGMA 1F4IA 1QZMA 3C3DA 5IZ7D 4JMIA 2LVOC 3KVWA 2R65A 3KOYE 2JY7A 3U6OA 1GO5A 3GLHA 3A46A 4JI6M 1HVEA 1TDHA 5ITTA 4LJ4A 2R45A 1Q3CA 3D8LA 2R4JA 4RKUF 2F5PA 1PJSA 1M9IA 4L8RC 2DAIA 3GLIB 4QOZC 1RE0B 1AUAA 5LMNM 2JUJA 4G4OA 3FUTA 3K92A 2C9OA 1KYIA 2C9CA 3FE3A 1DK5A 2KA6B 3AV0A 3CGWA 1XHBA 3F92A 5KPZA 3M0EA 1KFVA 3UJNA 2V1UA 4DR2M 3Q8XA 1DGFA 1ANWA 3VKHA 4JI4M 3JR4A 5DFLA 2YR0A 4PDIA 3MK6A 2ZOCA 4NRVA 2X8AA 2H1RA 3HHYA 2Z7JA 4R71A 2CHVA 4B7GA 1WXQA 1Z5BA 4NL4H 4D80A 3AOEA 2XO2A 1DGBA 4L6V6 1NV9A 4LCBA 2F5SA 1BC9A 1AOWA 2KRKA 4LG2A 1N42A 1HT1E 2YQZA 5EP4A 3VK7A 4GIPA 1VDLA 1SG9A 4Q7JA 2CHGA 3AL0C 4EVHA 4LZZA 2CV2A 4L78A 3T15A 4FCVA 3TWLA 4C7PA 2G5GX 2M5ZA 2KZSA 2XSZD 3B7NA 4AKGA 3HZJA 2HL7A 4IJFA 4NC6A 3I4VA 2UXDM 3ABSA 4OIYA 4JWLA 3FTFA 3J81S 2XGNA 1XXHA 3HU2A 2DWNA 3AOEC 4CJ6A 3K9OA 4IBEA 2ZM6M 3AJIB 3UMMA 1TH3A 4G6ZA 3HJ8A 4REZA 4K0KM 2GQFA 3GQ5A 2BWEA 1E32A 4KT0F 2ZHIA 1RU3A 3KOWE 4MGZE 4XK8F 4OX9M 3VFDA 2CRUA 2XFSA 5EXXA 4ITQA 2EKFA 4BLCA 1DGGA 4M0DA 2KNAA 5BPVA 3VK8A 4AKHA 2LTUA 3DZDA 1L8QA 3M6AA 1WIVA 3GP1A 3M7GA 3GLGA 1NJGA 3EIHA 3A45A 3U60B 1IBKM 3QAUA 1W7BA 2XF3A 3I4YA 4LF4M 1TF0B 4LRTA 3JAMS 4G4QA 2DXIA 1N34M 3B9PA 2DWMA 2CE7A 2K6XA 4FWDA 5A2QS 4OU7A 4KLNA 4DUZM 1GLNA 1TH4A 2L09A 5EP2A 3SHGB 1S9DE 3L25A 2H0KA 3GPYA 4Z6YA 1W3WA 3GLHE 2HYVA 4MGYE 2L4FA 4GHLA 1SAVA 4GITA 1OAIA 3K1JA 3HY5A 1ZAEA 4B3TM 4QNRA 1G41A 3HJLA 2Q2EB 4KODA 5DNYA 4MB7A 4P17A 2DZOB 1BCWA 1N44A 1PJTA 4JI2M 4GEWA 3H4MA 3QWLA 5EJCA 4EIWA 2FOIC 2P5TA 2KXEA 3HJSA 1OKSA 1DGHB 2LWXA 4GH9A 1GL7A 4M9ZA 5JI3E 3KP0E 4MDUA 4LJ5A 5IWAM 2L6OA 3T1YM 1QYRA 2FS1A 2I7NA 1MN3A 2LH0A 4DV6M 4G4RA 1I94M 3SWVA 1QDTA 3IG8A 4GC9A 2HCBA 7CATA 1C1KA 4L4UA 3AOGA 1MJGM 3HHXA 3ANYA 3KS8A 4DBGB 3U61B 3SATA 5KQ8A 4GHAA 1PJJA 4QHTA 2NQ8C 2RKOA 4G4NA 2QBYA 1HT2E 2H5XA 3PNYA 3GPPA 3R9XB 3U6LA 1N78A 1K82A 3J80S 4YY3M 4L5MA 2CEAA 4X64M 1JR3A 3VKGA 3USWA 4OVZB 5FLXS 4NXNM 1BCYA 1NO1A 3CF0A 2O5RA 2JXNA 1XXHE 3U6DA 4DV0M 3Q8GA 3ZC7B 1IY2A 4CGYB 4MM3B 2DAKA 1I4WA 3SAWA 2EO2A 3BBZA 1J5EM 2X49A 2RANA 1OIPA 3C58A 3H4JA 1BC1A 1BVSA 1IXZA 3HGIA 1XWIA 4GRIA 3HX3A 4HLQA 2FH0A 1VEGA 2QSFX 4LFAM 3C9PA 4TUWA 2JA2A 2JWSA 3L29A 1L1ZA 2R0DA 2CFOA 4DV1M 2EKKA 1OJLA 3JR5A 2C99A 2KNZA 1N36M 1NY6A 4II7A 4LJ9A 3GLGE 3J7BA 1QAOA 1HNXM 2R09A 3HKPA 4X9PA 3I01M 2UUAM 5FTKA 1QDRA 3NBXX 2Z4SA 1J7KA 1MCXA 1S3SA 5ITXA 2MGWA 3E4RA 4DR4M 1L2DA 2UU9M 3SBJA 4IBJA 1G8PA 2HYWA 1G59A 3A98B 3GRYA 1YGMA 2R44A 1XT0B 1T3TA 1ANXA 2KDLA 2BWBA 2OO9A 3PVSA 1HJPA 1QVRA 3T38A 4EVFA 1OTRA 2JY6B 3GLHB 2HAKA 4F2LA 2L4EA 4AKIA 2QZ4A 1D0MA 2DI0A 4JMOA 1L2BA 1YCNA 3L2AA 4M9XA 1E9RA 2E5LM 3QYEA 3EIEA 3SHFA 4LZJA 3DA1A 1R4AE 1V34A 1R7RA 4D82A 1G71A 2K47A 2CP8A 2R46A 2D7GA 1FNNA 3DFZA 5JI2E 2CHQA 2DHRA 2WZJA 2DWLA 1WJ7A 1ORYB 1YE9A 4B3SM 1N77A 4KN7X 2BNKA 1K3XA 2KRUA 2J5YA 4LY6A 3KW6A 1Y8GA 4JN6A 4BBAA 2AHMA 3J27B 1TDZA 3FUUA 3L27A 2ZHJA 1JQJC 2ZAMA 3SYLA 1IY0A 1Z59A 1JR3E 1QC7A 5DYGA 1HQYE 3AJCA 3HJQA 2F5QA 3FYCA 1IN4A 3LMMA 3SAVA 4LGYA 2VF7A 3SFZA 3K8ZA 1R4GA 1WGNA 1XXHB 2LVAA 2OOBA 2RRUA 2ZTCA 2XZUA 4ANRA 1XMOM 4MDVA 1D2NA 2JP7A 4AZFA 2R62A 5L8RF 2CV0A 4FD2A 2UUBM 5KPTA 1SXJA 2DHYA 2DWZB 5LMUM 4KN4X 1LKVX 3LQQA 2KNVA 5ITQA 8CATA 3J2PB 1XMQM 3KOZE 4DV2M 4DV5M 1DM5A 4GKJM 4JI7M 1NV8A 2Y20A 3W68A 4A3VB 1L2CA 1R8SE 1UFZA 3TQSA 3GLGB 1HNWM 4L16A 1N33M 1Q8DA 2A5YB 1PRBA 3KP1E 3FTCA 4G3OA 2KEBA 5ITXE 2ZBKB 1E9SA 1DV0A 4CHTB 3U6PA 2KW0A 1SXJC 2LVQD 4LJAA 4D7QA 1XNRM 3ILKA 3LQRA 5ITRA 3CF2A 1GJTA 3C3EA 2R0IA 1ALAA 3FUWA 4M0WA 3LVWA 2B3TA 1ZV1A 3UZUA 4FW9A 3L8NA 5FTJA 3LTLA 5FTNA 1BC3A 4LF6M 4GMQA 2YNMD 1XSZA 2J7OA 3FTDA 4QNMA 2O01F 2UXBM 1NHWC 4RNAA 2CWBA 5ITUA 4LJ8A 3L26A 1ZMVA 3ZH9B 2OY9A 3U6EA 4I8OA 4IIWA 3U5ZA 1TGUA 3D8BA 2CV1A 3KFUG 3UK6A 3ZQJA 2XFTA 1AVHA 2J7NA 4MGKE 2W82A 4GC5A 4F1IA 4X65M 3AKZA 1A8AA 1IXSB 3U6MA 2LXEA 4QHSA 2VXGA 3TWKA 4PD2A 1NHGC 3AFHA 3GPXA 2VIIA 2ZAOA 3WHKA 4AW4A 4DV4M 3SYKA 4DR5M 2APLA 1JR3D 1GL6A 2DENA 3K2LA 2YFQA 3GRUA 1R2ZA 4AI6A 2X4AA 1QUSA 1T6OA 1VDDA 2JY8A 4R3DA 5E26A 1QAQA 1IN6A 2ZANA 2QBYB 5ITYA 4D7RA 3RE8A 3GQ4A 4LFCM 4A4PA 3FTEA 1IBLM 1BC0A 1ANNA 1IM2A 1PJQA 4GKKM 3HU3A 4DUYM 4UN2B 1WR1B 3BRXA 2LNHC 1ZMUA 2Y0QA 3W0FA 3BOSA 3TW5A 4FWHA 4AG6A 3CTWB 4WP2A 4P16A 3UGJA 1SXJE 2KHHA 4D81A 2QCUA 1EFUB 4B3MM 1ZMWA 2DAEA 2K9DA 4B08A 2XZFA 1L1TA 4MH0E 2VDBB 1T43A 1D0LA 3E46A 2DNAA 3FD9A 4NXMM 4WW0A 1A5TA 1TH2A 1DO0A 3W67A 1R8QE 2C98A 3KS4A 3QYBA 4JI3M 3V76A 1E94E 5EXTA 3NWLA 2MR9A 3PNVA 1I4AA 1TR8A 3RFWA 4FVMA 3GLFA 1EE8A 1QANA 3LVVA 4NSOB 4I5SA 4MGHA 5GKNA 3SAUA 3TPZA 3HWSA 4B3RM 2ZTDA 2FNAA 3W0LB 4FQ0C 4DR1M 1H6UA 3E21A 3U6QA 1AEIA 1LV7A 4JXJA 1IXRC 2H0LA 2IE6A 4PDGA 4LF5M 1YIIA 2WSCF 5EXPA 2MJ5B 4RF0A 1IBMM 1N32M 3BXWA 3VDUA 4IBBA 3VLFB 2Y21A 1HR0M 1JB0F 4IBIA 3SARA 2DAMA 2EJSA 1R6BX 1NY5A 1PBVA 1VEJA 1HM6A 1GABA 2O25A 2DZNB 4FHRB 4DR6M 1LTMA 1Q3BA 4IBDA 1D0KA 3TL4X 3B89A 4M9SA 1AIIA 1OQYA 2DKLA 1Z6TA 5F3WA 1HNZM 4DR7M 5DYIA 1GVNA 4JV5M 3HHZA 1QUTA 4DV7M 4JYAM 2N35A 2F5OA 4Z8XA 1G5NA 1C7YA 1KSFX 3HU1A 2EA0A 4IBFA 3GLIA 1X37A 2JZ1A 2DZLA 4XBOA 1G3IA 4LF7M 2V1CA 4X66M 1R5LA 4NSRA 3MMPA 3TWMA 1IN8A 1NVMA 3OTOM 1ZQ9A 2JZ0A 1SXJD 4B7HA 2OOAA 1AIPC 1K3WA 4NRWA 1N41A 2R6FA 3ZCBB 1V33A 3FRIA 3K9PA 2LBCA 1EIJA 1NNUC 1J09A 3B7ZA 2LVPC 3MJ5A 3I04M 2Q4CA 3USYA 4DR3M 4LJ7A 3ABOA 2JNHA 2ERCA 1CUKA 5KPRA 3R8FA 1R2YA 1SXJB 4KHPM 1UPTB 5FSWA 1PGYA 5IREB 4JI0M 4IBGA 2HYUA 1OFIA 5C18A 2OPFA 1AVCA 4MGIE 2QQ8A 3IECA 5EP3A 1N75A 1GJSA 3PXGA 3ABQA 1YJ0A 2VQFM 4JI1M 3FUVA 5EXSA 3SMPA 4NOOB 3SC3A 1NJFA 3KOXE 1XB2B 3GLFE 2C5RA 4JI5M 3T1HM 3SASA 1AXNA 2XEPA 2JY5A 5KO3A 2VQEM 2XSZA 1AVRA 3U6SA 1HQCA 3LCUA 2OQ4A 1QAMA 1Q02A 3VDPA 1XNQM 3U6CA 5BR8M 5EQTA 4LF8M 2QP9X 3J7AS 4Z21A 2EUCA 3E9SA 1HVFA 3NBIA 2RGHA 4HL4A 5EP1A 2BJWA 2HKJA 2L7IA 1Z5AA 2LHCA 4IBKA 1PJIA 5H37D 4DV3M 3U60A 4L15A 2XLJA 2F5NA 1FJGM 1TTEA 2D7EA 2UUCM 4KMUX 1V92A 3I51A 3U5ZB 4FCWA 1Q39A 3B7QA 2Z3XA 1UM8A 3FRHA 4WURA 2LHGA 2Y0TA 3THGA 2FE8A 2IE7A 2WSEF 1IQPA 4CISA 1R8ME 4LJ6A 1VQ1A 4RF1A 5C1BA 2F4VM 3T6PA 2I7PA 2QNJA 3GRRA 5IT9S 2L2DA 4PT5A 3RGPA 2BJVA 4QOSA 3TE6A 3GLIE 1QZEA 2KZUA 4LF9M 3FUXA 4KO8A 4PCZA 2HHHM 3FKEA 1W5SA 1NSFA 2LVNC 2QEZA 1IN7A 3AO0A 2Z8YM 3GPUA 1DGHA 2G3QA 3A42A 1YSYA 2QENA 4LFBM 3GRVA 4S12A 3HHWA 1HAKA 1IXSA 1IFYA 3LW5F 1OIZA 2FFJA 3KSJA 1YUBA 2WSFF 4YHHM 2DAGA 1A8BA 4IBCA
chains in the Genus database with same CATH topology
1Z5CA 2Z4RA 1IN5A 3U61A 2M60A 1GKIA 2QPAA 4JI8M 4ZPXA 2V6ZM 4IJEA 1DO2A 4OW0A 2R18A 4FCTA 4OVZA 3FYDA 4AG5A 4R7GA 1XC8A 5FTLA 3GQ3A 3KSXA 1QQWA 2DVWB 3CF6E 4AQYM 3KDSE 4W5WA 3SMSA 2UXCM 4B7FA 1MU5A 2R4EA 3L28A 3GLFB 5FTMA 3PFIA 4I4LA 3GO8A 3KXEC 1NNJA 2RGOA 4BB9A 1W5TA 3RGSA 4X62M 1G4AE 1OFHA 3IG5A 4I81A 5E6JA 2C96A 2L7HA 2XH9A 3WHLA 3MHVC 4XGIA 3DOAA 2G8LA 1PM5A 1MX0A 1IY1A 4LRSA 5KQDA 2CUZA 2D7HA 4FWGA 4LGMA 1QZMA 5IZ7D 3KVWA 2R65A 3KOYE 3U6OA 3GLHA 3A46A 4JI6M 1TDHA 5ITTA 4LJ4A 2R45A 1Q3CA 3D8LA 2R4JA 2F5PA 4L8RC 3GLIB 4QOZC 5LMNM 4G4OA 3FUTA 3K92A 2C9OA 1KYIA 2C9CA 2KA6B 3AV0A 1KFVA 1XHBA 5KPZA 3M0EA 3UJNA 2V1UA 4DR2M 3Q8XA 1DGFA 3VKHA 4JI4M 3JR4A 2YR0A 4PDIA 3MK6A 4NRVA 2X8AA 2H1RA 3HHYA 2Z7JA 2CHVA 4B7GA 1WXQA 1Z5BA 4NL4H 4D80A 3AOEA 1DGBA 4LCBA 2F5SA 2KRKA 4LG2A 1HT1E 2YQZA 5EP4A 3VK7A 4GIPA 3AL0C 2CHGA 4LZZA 2CV2A 4L78A 3T15A 4FCVA 3TWLA 2G5GX 2M5ZA 2KZSA 2XSZD 4AKGA 2HL7A 4IJFA 3I4VA 2UXDM 3FTFA 3J81S 2XGNA 1XXHA 3HU2A 2DWNA 3AOEC 4IBEA 2ZM6M 3AJIB 3UMMA 1TH3A 4G6ZA 3HJ8A 4REZA 4K0KM 3GQ5A 1E32A 3KOWE 4MGZE 4OX9M 3VFDA 2XFSA 5EXXA 4ITQA 4BLCA 1DGGA 4M0DA 5BPVA 3VK8A 4AKHA 3M6AA 3DZDA 1L8QA 3GP1A 3M7GA 3GLGA 1NJGA 3EIHA 3A45A 3U60B 1IBKM 3QAUA 2XF3A 3I4YA 4LF4M 4LRTA 3JAMS 4G4QA 2DXIA 1N34M 3B9PA 2DWMA 2CE7A 4FWDA 5A2QS 4OU7A 4KLNA 4DUZM 1GLNA 1TH4A 2L09A 5EP2A 3SHGB 3L25A 3GPYA 4Z6YA 4MGYE 4GHLA 4GITA 3K1JA 1ZAEA 4B3TM 4QNRA 1G41A 2Q2EB 4KODA 5DNYA 4MB7A 2DZOB 4JI2M 3H4MA 3QWLA 5EJCA 4EIWA 2FOIC 2P5TA 2KXEA 3HJSA 2LWXA 1DGHB 4GH9A 4M9ZA 1GL7A 5JI3E 1XNQM 3KP0E 4LJ5A 5IWAM 2L6OA 3T1YM 1QYRA 2I7NA 2LH0A 4DV6M 4G4RA 1I94M 3IG8A 4GC9A 2HCBA 7CATA 1C1KA 4L4UA 3AOGA 3HHXA 3KS8A 3U61B 4GHAA 3SATA 5KQ8A 1PJJA 4QHTA 2NQ8C 2RKOA 4G4NA 2QBYA 1HT2E 3PNYA 3R9XB 3GPPA 1N78A 3U6LA 1K82A 3J80S 4YY3M 2CEAA 4X64M 1JR3A 3VKGA 4OVZB 5FLXS 4NXNM 3CF0A 2O5RA 3U6DA 4DV0M 3ZC7B 1IY2A 4CGYB 4MM3B 1I4WA 3SAWA 2EO2A 1J5EM 2X49A 3C58A 3HGIA 1IXZA 2UXBM 1XWIA 4GRIA 4HLQA 4LFAM 4TUWA 2JA2A 3L29A 1L1ZA 2CFOA 4DV1M 1N36M 1OJLA 3JR5A 2C99A 1NY6A 4II7A 4LJ9A 3J7BA 1QAOA 1HNXM 3HKPA 2UUAM 5FTKA 2Z4SA 1J7KA 1S3SA 5ITXA 3E4RA 4DR4M 1L2DA 2UU9M 3SBJA 4IBJA 1G8PA 1G59A 3A98B 3GRYA 1T3TA 3PVSA 3T38A 1QVRA 3GLHB 4AKIA 2QZ4A 1L2BA 3L2AA 4M9XA 1E9RA 2E5LM 3EIEA 3SHFA 4LZJA 3DA1A 1R7RA 4D82A 2K47A 2R46A 2D7GA 1FNNA 3DFZA 5JI2E 2CHQA 2DHRA 2DWLA 1ORYB 1YE9A 4B3SM 1N77A 2BNKA 1K3XA 2KRUA 4LY6A 3KW6A 4JN6A 4BBAA 2AHMA 3J27B 1TDZA 3FUUA 3L27A 1JQJC 2ZAMA 3SYLA 1IY0A 1Z59A 5DYGA 1HQYE 3HJQA 2F5QA 3FYCA 1IN4A 3LMMA 3SAVA 4LGYA 3SFZA 3K8ZA 1XXHB 2XZUA 1XMOM 1D2NA 4AZFA 2R62A 2CV0A 4FD2A 2UUBM 5KPTA 1SXJA 5LMUM 2DWZB 3LQQA 5ITQA 8CATA 3J2PB 1XMQM 3KOZE 4DV2M 4DV5M 4GKJM 4JI7M 2Y20A 4A3VB 1L2CA 3TQSA 3GLGB 1HNWM 4L16A 1N33M 2A5YB 3KP1E 3FTCA 5ITXE 2KEBA 2ZBKB 1E9SA 4CHTB 3U6PA 2KW0A 1SXJC 4LJAA 1XNRM 3ILKA 3LQRA 5ITRA 3CF2A 3FUWA 4M0WA 3LVWA 3UZUA 4FW9A 5FTJA 5FTNA 4LF6M 4GMQA 2YNMD 2J7OA 3FTDA 4QNMA 1NHWC 4RNAA 5ITUA 3L26A 4LJ8A 3ZH9B 3U6EA 4I8OA 4IIWA 3U5ZA 1TGUA 3D8BA 2CV1A 3KFUG 3UK6A 2XFTA 2J7NA 4MGKE 2W82A 4GC5A 4X65M 3AKZA 1IXSB 3U6MA 2LXEA 4QHSA 3TWKA 4PD2A 1NHGC 3AFHA 3GPXA 2VIIA 2ZAOA 3WHKA 4AW4A 4DV4M 3SYKA 4DR5M 1JR3D 1GL6A 3K2LA 2YFQA 3GRUA 1R2ZA 4AI6A 2X4AA 1VDDA 4R3DA 5E26A 1QAQA 1IN6A 2ZANA 2QBYB 5ITYA 3RE8A 3GQ4A 4LFCM 3FTEA 1IBLM 1IM2A 4GKKM 3HU3A 4DUYM 2LNHC 2Y0QA 3W0FA 3BOSA 4FWHA 4AG6A 3CTWB 4P16A 3UGJA 1SXJE 4D81A 2QCUA 4B3MM 4B08A 2XZFA 1L1TA 4MH0E 3FD9A 4NXMM 4WW0A 1TH2A 1DO0A 2C98A 3KS4A 4JI3M 1E94E 5EXTA 3NWLA 3PNVA 3RFWA 4FVMA 3GLFA 1EE8A 1QANA 3LVVA 4NSOB 4I5SA 4MGHA 5GKNA 3SAUA 3TPZA 3HWSA 4B3RM 2FNAA 3W0LB 4DR1M 1H6UA 3U6QA 1LV7A 4JXJA 1IXRC 4PDGA 4LF5M 5EXPA 4RF0A 1IBMM 1N32M 3VDUA 4IBBA 3VLFB 2Y21A 1HR0M 4IBIA 3SARA 1R6BX 1NY5A 2DZNB 4DR6M 1Q3BA 4IBDA 3TL4X 4M9SA 1Z6TA 5F3WA 1HNZM 4DR7M 5DYIA 1GVNA 4JV5M 3HHZA 4DV7M 4JYAM 2F5OA 4Z8XA 1KSFX 3HU1A 2EA0A 4IBFA 3GLIA 1X37A 4LF7M 4XBOA 1G3IA 2V1CA 4X66M 4NSRA 3TWMA 1IN8A 1NVMA 3OTOM 1ZQ9A 1SXJD 4B7HA 1K3WA 4NRWA 3ZCBB 1NNUC 1J09A 3MJ5A 4DR3M 4LJ7A 2ERCA 5KPRA 3R8FA 1R2YA 1SXJB 4KHPM 5FSWA 5IREB 4JI0M 4IBGA 1OFIA 5C18A 2OPFA 4MGIE 5EP3A 1N75A 3PXGA 2VQFM 4JI1M 3FUVA 5EXSA 3SMPA 4NOOB 3SC3A 1NJFA 3KOXE 2C5RA 4JI5M 3T1HM 3SASA 2XEPA 5KO3A 2VQEM 2XSZA 3U6SA 1HQCA 2OQ4A 1QAMA 3VDPA 3U6CA 5BR8M 5EQTA 4LF8M 2QP9X 3J7AS 2EUCA 3E9SA 3NBIA 2RGHA 4HL4A 5EP1A 2BJWA 2HKJA 2L7IA 1Z5AA 4IBKA 1PJIA 5H37D 4DV3M 3U60A 4L15A 2XLJA 2F5NA 1FJGM 2D7EA 2UUCM 3I51A 3U5ZB 4FCWA 1Q39A 2Z3XA 1UM8A 4WURA 2Y0TA 3THGA 2FE8A 1IQPA 4CISA 4LJ6A 4RF1A 5C1BA 2F4VM 5IT9S 2I7PA 3GRRA 3RGPA 4PT5A 2BJVA 4QOSA 3TE6A 2KZUA 4LF9M 3FUXA 4KO8A 4PCZA 2HHHM 3FKEA 1W5SA 1NSFA 1IN7A 3GPUA 1DGHA 3A42A 1YSYA 2QENA 4LFBM 3GRVA 4S12A 3HHWA 2FFJA 3KSJA 1YUBA 4YHHM 4IBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IN4 A;  2Z4R A;  1IN5 A;  5EP2 A;  2QPA A;  4ZPX A;  2V6Z M;  3VLF B;  1DO2 A;  1XXH B;  1D2N A;  4FCT A;  2R62 A;  1R6B X;  1NY5 A;  4GIT A;  4FD2 A;  3K1J A;  2DZN B;  4QNR A;  1G41 A;  1SXJ A;  4KOD A;  2DWZ B;  5FTL A;  2DZO B;  2DVW B;  3H4M A;  3KDS E;  4EIW A;  5DYI A;  5JI3 E;  3GLF B;  4A3V B;  4Z8X A;  4LJ5 A;  1KSF X;  3HU1 A;  5FTM A;  3GLG B;  3GLI A;  4L16 A;  3PFI A;  1X37 A;  4I4L A;  1G3I A;  1W5T A;  2HCB A;  1C1K A;  4L4U A;  1SXJ C;  1IN8 A;  1NVM A;  4LJA A;  1G4A E;  1OFH A;  4I81 A;  1SXJ D;  3U61 B;  2C96 A;  3CF2 A;  4QHT A;  2RKO A;  2QBY A;  3WHL A;  1HT2 E;  4FW9 A;  3MHV C;  5FTJ A;  2CEA A;  5FTN A;  1JR3 A;  1IY1 A;  4LJ7 A;  4LRS A;  4QNM A;  3CF0 A;  3R8F A;  4FWG A;  1SXJ B;  4LGM A;  1QZM A;  4LJ8 A;  3ZH9 B;  1OFI A;  5C18 A;  2R65 A;  1IY2 A;  3GLH A;  3D8B A;  4LJ4 A;  3UK6 A;  5EP3 A;  1IXZ A;  1IXS B;  1XWI A;  3PXG A;  4QHS A;  3GLI B;  5EXS A;  2VII A;  2ZAO A;  3SC3 A;  1NJF A;  3WHK A;  2C9O A;  1KYI A;  2C9C A;  3SYK A;  1OJL A;  2C99 A;  1JR3 D;  1NY6 A;  3M0E A;  4LJ9 A;  2V1U A;  2XSZ A;  1HQC A;  5FTK A;  2ZAN A;  1IN6 A;  2QBY B;  2Z4S A;  1J7K A;  2X8A A;  5EQT A;  2QP9 X;  1S3S A;  2CHV A;  4D80 A;  5EP1 A;  1IM2 A;  3HU3 A;  2BJW A;  4LCB A;  2KRK A;  1HT1 E;  4L15 A;  3PVS A;  5EP4 A;  1QVR A;  3BOS A;  2CHG A;  4FWH A;  3GLH B;  4LZZ A;  3U5Z B;  4FCW A;  4FCV A;  1UM8 A;  1SXJ E;  2XSZ D;  4D81 A;  2QZ4 A;  1IQP A;  4LJ6 A;  3EIE A;  5C1B A;  1XXH A;  1R7R A;  3HU2 A;  4D82 A;  2BJV A;  3AJI B;  4WW0 A;  4QOS A;  1DO0 A;  1FNN A;  2C98 A;  1E32 A;  5JI2 E;  2CHQ A;  2DHR A;  4KO8 A;  1E94 E;  5EXT A;  1W5S A;  3VFD A;  5EXX A;  1NSF A;  1IN7 A;  4LY6 A;  3KW6 A;  4JN6 A;  3GLF A;  3M6A A;  3DZD A;  1L8Q A;  2QEN A;  1JQJ C;  2ZAM A;  3HWS A;  2FNA A;  3SYL A;  1NJG A;  3EIH A;  3GLG A;  3U60 B;  1IY0 A;  4LRT A;  5DYG A;  1LV7 A;  1IXR C;  1HQY E;  3B9P A;  2CE7 A;  4FWD A;  5EXP A;  4KLN A; 
#chains in the Genus database with same CATH topology
 1Z5C A;  2Z4R A;  1IN5 A;  3U61 A;  2M60 A;  4Q2S A;  1GKI A;  2QPA A;  3LCV B;  4JI8 M;  4ZPX A;  2V6Z M;  4IJE A;  1HVD A;  1DO2 A;  1HVG A;  4OW0 A;  1VEK A;  1N00 A;  2R18 A;  4FCT A;  2QHO B;  2HWJ A;  3B74 A;  4OVZ A;  3FYD A;  4AG5 A;  4R7G A;  2II2 A;  1XC8 A;  5FTL A;  1W45 A;  3GQ3 A;  3KSX A;  1QQW A;  2DVW B;  3CF6 E;  4Y28 F;  3KDS E;  4AQY M;  4W5W A;  3SMS A;  2UXC M;  2H0M A;  4B7F A;  1MU5 A;  1P3Q Q;  2R4E A;  3L28 A;  3GLF B;  1KU1 A;  1BO9 A;  4HEO A;  5FTM A;  4JK1 X;  2MRO B;  3PFI A;  2K0B X;  4I4L A;  3IHP A;  3GO8 A;  1VG5 A;  1BCZ A;  1XJL A;  1OAO C;  2XO3 A;  3KXE C;  1NNJ A;  2RGO A;  4BB9 A;  1W5T A;  2GNO A;  3RGS A;  2IIC A;  4X62 M;  1G4A E;  1OFH A;  2MH8 A;  3IG5 A;  4I81 A;  5E6J A;  2HSN A;  3ABR A;  2C96 A;  2L7H A;  2K6B A;  2VF8 A;  2XH9 A;  3WHL A;  3SOH B;  1WHC A;  4CIZ A;  3MHV C;  4XGI A;  3DOA A;  2G8L A;  1PM5 A;  4JXH A;  1MX0 A;  1IY1 A;  4HRE A;  1YLA A;  4LRS A;  1WGL A;  4C0A A;  5KQD A;  2CUZ A;  2D7H A;  4FWG A;  4LGM A;  1F4I A;  1QZM A;  3C3D A;  5IZ7 D;  4JMI A;  2LVO C;  3KVW A;  2R65 A;  3KOY E;  2JY7 A;  3U6O A;  1GO5 A;  3GLH A;  3A46 A;  4JI6 M;  1HVE A;  1TDH A;  5ITT A;  4LJ4 A;  2R45 A;  1Q3C A;  3D8L A;  2R4J A;  4RKU F;  2F5P A;  1PJS A;  1M9I A;  4L8R C;  2DAI A;  3GLI B;  4QOZ C;  1RE0 B;  1AUA A;  5LMN M;  2JUJ A;  4G4O A;  3FUT A;  3K92 A;  2C9O A;  1KYI A;  2C9C A;  3FE3 A;  1DK5 A;  2KA6 B;  3AV0 A;  3CGW A;  1XHB A;  3F92 A;  5KPZ A;  3M0E A;  1KFV A;  3UJN A;  2V1U A;  4DR2 M;  3Q8X A;  1DGF A;  1ANW A;  3VKH A;  4JI4 M;  3JR4 A;  5DFL A;  2YR0 A;  4PDI A;  3MK6 A;  2ZOC A;  4NRV A;  2X8A A;  2H1R A;  3HHY A;  2Z7J A;  4R71 A;  2CHV A;  4B7G A;  1WXQ A;  1Z5B A;  4NL4 H;  4D80 A;  3AOE A;  2XO2 A;  1DGB A;  4L6V 6;  1NV9 A;  4LCB A;  2F5S A;  1BC9 A;  1AOW A;  2KRK A;  4LG2 A;  1N42 A;  1HT1 E;  2YQZ A;  5EP4 A;  3VK7 A;  4GIP A;  1VDL A;  1SG9 A;  4Q7J A;  2CHG A;  3AL0 C;  4EVH A;  4LZZ A;  2CV2 A;  4L78 A;  3T15 A;  4FCV A;  3TWL A;  4C7P A;  2G5G X;  2M5Z A;  2KZS A;  2XSZ D;  3B7N A;  4AKG A;  3HZJ A;  2HL7 A;  4IJF A;  4NC6 A;  3I4V A;  2UXD M;  3ABS A;  4OIY A;  4JWL A;  3FTF A;  3J81 S;  2XGN A;  1XXH A;  3HU2 A;  2DWN A;  3AOE C;  4CJ6 A;  3K9O A;  4IBE A;  2ZM6 M;  3AJI B;  3UMM A;  1TH3 A;  4G6Z A;  3HJ8 A;  4REZ A;  4K0K M;  2GQF A;  3GQ5 A;  2BWE A;  1E32 A;  4KT0 F;  2ZHI A;  1RU3 A;  3KOW E;  4MGZ E;  4XK8 F;  4OX9 M;  3VFD A;  2CRU A;  2XFS A;  5EXX A;  4ITQ A;  2EKF A;  4BLC A;  1DGG A;  4M0D A;  2KNA A;  5BPV A;  3VK8 A;  4AKH A;  2LTU A;  3DZD A;  1L8Q A;  3M6A A;  1WIV A;  3GP1 A;  3M7G A;  3GLG A;  1NJG A;  3EIH A;  3A45 A;  3U60 B;  1IBK M;  3QAU A;  1W7B A;  2XF3 A;  3I4Y A;  4LF4 M;  1TF0 B;  4LRT A;  3JAM S;  4G4Q A;  2DXI A;  1N34 M;  3B9P A;  2DWM A;  2CE7 A;  2K6X A;  4FWD A;  5A2Q S;  4OU7 A;  4KLN A;  4DUZ M;  1GLN A;  1TH4 A;  2L09 A;  5EP2 A;  3SHG B;  1S9D E;  3L25 A;  2H0K A;  3GPY A;  4Z6Y A;  1W3W A;  3GLH E;  2HYV A;  4MGY E;  2L4F A;  4GHL A;  1SAV A;  4GIT A;  1OAI A;  3K1J A;  3HY5 A;  1ZAE A;  4B3T M;  4QNR A;  1G41 A;  3HJL A;  2Q2E B;  4KOD A;  5DNY A;  4MB7 A;  4P17 A;  2DZO B;  1BCW A;  1N44 A;  1PJT A;  4JI2 M;  4GEW A;  3H4M A;  3QWL A;  5EJC A;  4EIW A;  2FOI C;  2P5T A;  2KXE A;  3HJS A;  1OKS A;  1DGH B;  2LWX A;  4GH9 A;  1GL7 A;  4M9Z A;  5JI3 E;  3KP0 E;  4MDU A;  4LJ5 A;  5IWA M;  2L6O A;  3T1Y M;  1QYR A;  2FS1 A;  2I7N A;  1MN3 A;  2LH0 A;  4DV6 M;  4G4R A;  1I94 M;  3SWV A;  1QDT A;  3IG8 A;  4GC9 A;  2HCB A;  7CAT A;  1C1K A;  4L4U A;  3AOG A;  1MJG M;  3HHX A;  3ANY A;  3KS8 A;  4DBG B;  3U61 B;  3SAT A;  5KQ8 A;  4GHA A;  1PJJ A;  4QHT A;  2NQ8 C;  2RKO A;  4G4N A;  2QBY A;  1HT2 E;  2H5X A;  3PNY A;  3GPP A;  3R9X B;  3U6L A;  1N78 A;  1K82 A;  3J80 S;  4YY3 M;  4L5M A;  2CEA A;  4X64 M;  1JR3 A;  3VKG A;  3USW A;  4OVZ B;  5FLX S;  4NXN M;  1BCY A;  1NO1 A;  3CF0 A;  2O5R A;  2JXN A;  1XXH E;  3U6D A;  4DV0 M;  3Q8G A;  3ZC7 B;  1IY2 A;  4CGY B;  4MM3 B;  2DAK A;  1I4W A;  3SAW A;  2EO2 A;  3BBZ A;  1J5E M;  2X49 A;  2RAN A;  1OIP A;  3C58 A;  3H4J A;  1BC1 A;  1BVS A;  1IXZ A;  3HGI A;  1XWI A;  4GRI A;  3HX3 A;  4HLQ A;  2FH0 A;  1VEG A;  2QSF X;  4LFA M;  3C9P A;  4TUW A;  2JA2 A;  2JWS A;  3L29 A;  1L1Z A;  2R0D A;  2CFO A;  4DV1 M;  2EKK A;  1OJL A;  3JR5 A;  2C99 A;  2KNZ A;  1N36 M;  1NY6 A;  4II7 A;  4LJ9 A;  3GLG E;  3J7B A;  1QAO A;  1HNX M;  2R09 A;  3HKP A;  4X9P A;  3I01 M;  2UUA M;  5FTK A;  1QDR A;  3NBX X;  2Z4S A;  1J7K A;  1MCX A;  1S3S A;  5ITX A;  2MGW A;  3E4R A;  4DR4 M;  1L2D A;  2UU9 M;  3SBJ A;  4IBJ A;  1G8P A;  2HYW A;  1G59 A;  3A98 B;  3GRY A;  1YGM A;  2R44 A;  1XT0 B;  1T3T A;  1ANX A;  2KDL A;  2BWB A;  2OO9 A;  3PVS A;  1HJP A;  1QVR A;  3T38 A;  4EVF A;  1OTR A;  2JY6 B;  3GLH B;  2HAK A;  4F2L A;  2L4E A;  4AKI A;  2QZ4 A;  1D0M A;  2DI0 A;  4JMO A;  1L2B A;  1YCN A;  3L2A A;  4M9X A;  1E9R A;  2E5L M;  3QYE A;  3EIE A;  3SHF A;  4LZJ A;  3DA1 A;  1R4A E;  1V34 A;  1R7R A;  4D82 A;  1G71 A;  2K47 A;  2CP8 A;  2R46 A;  2D7G A;  1FNN A;  3DFZ A;  5JI2 E;  2CHQ A;  2DHR A;  2WZJ A;  2DWL A;  1WJ7 A;  1ORY B;  1YE9 A;  4B3S M;  1N77 A;  4KN7 X;  2BNK A;  1K3X A;  2KRU A;  2J5Y A;  4LY6 A;  3KW6 A;  1Y8G A;  4JN6 A;  4BBA A;  2AHM A;  3J27 B;  1TDZ A;  3FUU A;  3L27 A;  2ZHJ A;  1JQJ C;  2ZAM A;  3SYL A;  1IY0 A;  1Z59 A;  1JR3 E;  1QC7 A;  5DYG A;  1HQY E;  3AJC A;  3HJQ A;  2F5Q A;  3FYC A;  1IN4 A;  3LMM A;  3SAV A;  4LGY A;  2VF7 A;  3SFZ A;  3K8Z A;  1R4G A;  1WGN A;  1XXH B;  2LVA A;  2OOB A;  2RRU A;  2ZTC A;  2XZU A;  4ANR A;  1XMO M;  4MDV A;  1D2N A;  2JP7 A;  4AZF A;  2R62 A;  5L8R F;  2CV0 A;  4FD2 A;  2UUB M;  5KPT A;  1SXJ A;  2DHY A;  2DWZ B;  5LMU M;  4KN4 X;  1LKV X;  3LQQ A;  2KNV A;  5ITQ A;  8CAT A;  3J2P B;  1XMQ M;  3KOZ E;  4DV2 M;  4DV5 M;  1DM5 A;  4GKJ M;  4JI7 M;  1NV8 A;  2Y20 A;  3W68 A;  4A3V B;  1L2C A;  1R8S E;  1UFZ A;  3TQS A;  3GLG B;  1HNW M;  4L16 A;  1N33 M;  1Q8D A;  2A5Y B;  1PRB A;  3KP1 E;  3FTC A;  4G3O A;  2KEB A;  5ITX E;  2ZBK B;  1E9S A;  1DV0 A;  4CHT B;  3U6P A;  2KW0 A;  1SXJ C;  2LVQ D;  4LJA A;  4D7Q A;  1XNR M;  3ILK A;  3LQR A;  5ITR A;  3CF2 A;  1GJT A;  3C3E A;  2R0I A;  1ALA A;  3FUW A;  4M0W A;  3LVW A;  2B3T A;  1ZV1 A;  3UZU A;  4FW9 A;  3L8N A;  5FTJ A;  3LTL A;  5FTN A;  1BC3 A;  4LF6 M;  4GMQ A;  2YNM D;  1XSZ A;  2J7O A;  3FTD A;  4QNM A;  2O01 F;  2UXB M;  1NHW C;  4RNA A;  2CWB A;  5ITU A;  4LJ8 A;  3L26 A;  1ZMV A;  3ZH9 B;  2OY9 A;  3U6E A;  4I8O A;  4IIW A;  3U5Z A;  1TGU A;  3D8B A;  2CV1 A;  3KFU G;  3UK6 A;  3ZQJ A;  2XFT A;  1AVH A;  2J7N A;  4MGK E;  2W82 A;  4GC5 A;  4F1I A;  4X65 M;  3AKZ A;  1A8A A;  1IXS B;  3U6M A;  2LXE A;  4QHS A;  2VXG A;  3TWK A;  4PD2 A;  1NHG C;  3AFH A;  3GPX A;  2VII A;  2ZAO A;  3WHK A;  4AW4 A;  4DV4 M;  3SYK A;  4DR5 M;  2APL A;  1JR3 D;  1GL6 A;  2DEN A;  3K2L A;  2YFQ A;  3GRU A;  1R2Z A;  4AI6 A;  2X4A A;  1QUS A;  1T6O A;  1VDD A;  2JY8 A;  4R3D A;  5E26 A;  1QAQ A;  1IN6 A;  2ZAN A;  2QBY B;  5ITY A;  4D7R A;  3RE8 A;  3GQ4 A;  4LFC M;  4A4P A;  3FTE A;  1IBL M;  1BC0 A;  1ANN A;  1IM2 A;  1PJQ A;  4GKK M;  3HU3 A;  4DUY M;  4UN2 B;  1WR1 B;  3BRX A;  2LNH C;  1ZMU A;  2Y0Q A;  3W0F A;  3BOS A;  3TW5 A;  4FWH A;  4AG6 A;  3CTW B;  4WP2 A;  4P16 A;  3UGJ A;  1SXJ E;  2KHH A;  4D81 A;  2QCU A;  1EFU B;  4B3M M;  1ZMW A;  2DAE A;  2K9D A;  4B08 A;  2XZF A;  1L1T A;  4MH0 E;  2VDB B;  1T43 A;  1D0L A;  3E46 A;  2DNA A;  3FD9 A;  4NXM M;  4WW0 A;  1A5T A;  1TH2 A;  1DO0 A;  3W67 A;  1R8Q E;  2C98 A;  3KS4 A;  3QYB A;  4JI3 M;  3V76 A;  1E94 E;  5EXT A;  3NWL A;  2MR9 A;  3PNV A;  1I4A A;  1TR8 A;  3RFW A;  4FVM A;  3GLF A;  1EE8 A;  1QAN A;  3LVV A;  4NSO B;  4I5S A;  4MGH A;  5GKN A;  3SAU A;  3TPZ A;  3HWS A;  4B3R M;  2ZTD A;  2FNA A;  3W0L B;  4FQ0 C;  4DR1 M;  1H6U A;  3E21 A;  3U6Q A;  1AEI A;  1LV7 A;  4JXJ A;  1IXR C;  2H0L A;  2IE6 A;  4PDG A;  4LF5 M;  1YII A;  2WSC F;  5EXP A;  2MJ5 B;  4RF0 A;  1IBM M;  1N32 M;  3BXW A;  3VDU A;  4IBB A;  3VLF B;  2Y21 A;  1HR0 M;  1JB0 F;  4IBI A;  3SAR A;  2DAM A;  2EJS A;  1R6B X;  1NY5 A;  1PBV A;  1VEJ A;  1HM6 A;  1GAB A;  2O25 A;  2DZN B;  4FHR B;  4DR6 M;  1LTM A;  1Q3B A;  4IBD A;  1D0K A;  3TL4 X;  3B89 A;  4M9S A;  1AII A;  1OQY A;  2DKL A;  1Z6T A;  5F3W A;  1HNZ M;  4DR7 M;  5DYI A;  1GVN A;  4JV5 M;  3HHZ A;  1QUT A;  4DV7 M;  4JYA M;  2N35 A;  2F5O A;  4Z8X A;  1G5N A;  1C7Y A;  1KSF X;  3HU1 A;  2EA0 A;  4IBF A;  3GLI A;  1X37 A;  2JZ1 A;  2DZL A;  4XBO A;  1G3I A;  4LF7 M;  2V1C A;  4X66 M;  1R5L A;  4NSR A;  3MMP A;  3TWM A;  1IN8 A;  1NVM A;  3OTO M;  1ZQ9 A;  2JZ0 A;  1SXJ D;  4B7H A;  2OOA A;  1AIP C;  1K3W A;  4NRW A;  1N41 A;  2R6F A;  3ZCB B;  1V33 A;  3FRI A;  3K9P A;  2LBC A;  1EIJ A;  1NNU C;  1J09 A;  3B7Z A;  2LVP C;  3MJ5 A;  3I04 M;  2Q4C A;  3USY A;  4DR3 M;  4LJ7 A;  3ABO A;  2JNH A;  2ERC A;  1CUK A;  5KPR A;  3R8F A;  1R2Y A;  1SXJ B;  4KHP M;  1UPT B;  5FSW A;  1PGY A;  5IRE B;  4JI0 M;  4IBG A;  2HYU A;  1OFI A;  5C18 A;  2OPF A;  1AVC A;  4MGI E;  2QQ8 A;  3IEC A;  5EP3 A;  1N75 A;  1GJS A;  3PXG A;  3ABQ A;  1YJ0 A;  2VQF M;  4JI1 M;  3FUV A;  5EXS A;  3SMP A;  4NOO B;  3SC3 A;  1NJF A;  3KOX E;  1XB2 B;  3GLF E;  2C5R A;  4JI5 M;  3T1H M;  3SAS A;  1AXN A;  2XEP A;  2JY5 A;  5KO3 A;  2VQE M;  2XSZ A;  1AVR A;  3U6S A;  1HQC A;  3LCU A;  2OQ4 A;  1QAM A;  1Q02 A;  3VDP A;  1XNQ M;  3U6C A;  5BR8 M;  5EQT A;  4LF8 M;  2QP9 X;  3J7A S;  4Z21 A;  2EUC A;  3E9S A;  1HVF A;  3NBI A;  2RGH A;  4HL4 A;  5EP1 A;  2BJW A;  2HKJ A;  2L7I A;  1Z5A A;  2LHC A;  4IBK A;  1PJI A;  5H37 D;  4DV3 M;  3U60 A;  4L15 A;  2XLJ A;  2F5N A;  1FJG M;  1TTE A;  2D7E A;  2UUC M;  4KMU X;  1V92 A;  3I51 A;  3U5Z B;  4FCW A;  1Q39 A;  3B7Q A;  2Z3X A;  1UM8 A;  3FRH A;  4WUR A;  2LHG A;  2Y0T A;  3THG A;  2FE8 A;  2IE7 A;  2WSE F;  1IQP A;  4CIS A;  1R8M E;  4LJ6 A;  1VQ1 A;  4RF1 A;  5C1B A;  2F4V M;  3T6P A;  2I7P A;  2QNJ A;  3GRR A;  5IT9 S;  2L2D A;  4PT5 A;  3RGP A;  2BJV A;  4QOS A;  3TE6 A;  3GLI E;  1QZE A;  2KZU A;  4LF9 M;  3FUX A;  4KO8 A;  4PCZ A;  2HHH M;  3FKE A;  1W5S A;  1NSF A;  2LVN C;  2QEZ A;  1IN7 A;  3AO0 A;  2Z8Y M;  3GPU A;  1DGH A;  2G3Q A;  3A42 A;  1YSY A;  2QEN A;  4LFB M;  3GRV A;  4S12 A;  3HHW A;  1HAK A;  1IXS A;  1IFY A;  3LW5 F;  1OIZ A;  2FFJ A;  3KSJ A;  1YUB A;  2WSF F;  4YHH M;  2DAG A;  1A8B A;  4IBC A; 
#chains in the Genus database with same CATH homology
 1Z5C A;  2Z4R A;  1IN5 A;  3U61 A;  2M60 A;  1GKI A;  2QPA A;  4JI8 M;  4ZPX A;  2V6Z M;  4IJE A;  1DO2 A;  4OW0 A;  2R18 A;  4FCT A;  4OVZ A;  3FYD A;  4AG5 A;  4R7G A;  1XC8 A;  5FTL A;  3GQ3 A;  3KSX A;  1QQW A;  2DVW B;  3CF6 E;  4AQY M;  3KDS E;  4W5W A;  3SMS A;  2UXC M;  4B7F A;  1MU5 A;  2R4E A;  3L28 A;  3GLF B;  5FTM A;  3PFI A;  4I4L A;  3GO8 A;  3KXE C;  1NNJ A;  2RGO A;  4BB9 A;  1W5T A;  3RGS A;  4X62 M;  1G4A E;  1OFH A;  3IG5 A;  4I81 A;  5E6J A;  2C96 A;  2L7H A;  2XH9 A;  3WHL A;  3MHV C;  4XGI A;  3DOA A;  2G8L A;  1PM5 A;  1MX0 A;  1IY1 A;  4LRS A;  5KQD A;  2CUZ A;  2D7H A;  4FWG A;  4LGM A;  1QZM A;  5IZ7 D;  3KVW A;  2R65 A;  3KOY E;  3U6O A;  3GLH A;  3A46 A;  4JI6 M;  1TDH A;  5ITT A;  4LJ4 A;  2R45 A;  1Q3C A;  3D8L A;  2R4J A;  2F5P A;  4L8R C;  3GLI B;  4QOZ C;  5LMN M;  4G4O A;  3FUT A;  3K92 A;  2C9O A;  1KYI A;  2C9C A;  2KA6 B;  3AV0 A;  1KFV A;  1XHB A;  5KPZ A;  3M0E A;  3UJN A;  2V1U A;  4DR2 M;  3Q8X A;  1DGF A;  3VKH A;  4JI4 M;  3JR4 A;  2YR0 A;  4PDI A;  3MK6 A;  4NRV A;  2X8A A;  2H1R A;  3HHY A;  2Z7J A;  2CHV A;  4B7G A;  1WXQ A;  1Z5B A;  4NL4 H;  4D80 A;  3AOE A;  1DGB A;  4LCB A;  2F5S A;  2KRK A;  4LG2 A;  1HT1 E;  2YQZ A;  5EP4 A;  3VK7 A;  4GIP A;  3AL0 C;  2CHG A;  4LZZ A;  2CV2 A;  4L78 A;  3T15 A;  4FCV A;  3TWL A;  2G5G X;  2M5Z A;  2KZS A;  2XSZ D;  4AKG A;  2HL7 A;  4IJF A;  3I4V A;  2UXD M;  3FTF A;  3J81 S;  2XGN A;  1XXH A;  3HU2 A;  2DWN A;  3AOE C;  4IBE A;  2ZM6 M;  3AJI B;  3UMM A;  1TH3 A;  4G6Z A;  3HJ8 A;  4REZ A;  4K0K M;  3GQ5 A;  1E32 A;  3KOW E;  4MGZ E;  4OX9 M;  3VFD A;  2XFS A;  5EXX A;  4ITQ A;  4BLC A;  1DGG A;  4M0D A;  5BPV A;  3VK8 A;  4AKH A;  3M6A A;  3DZD A;  1L8Q A;  3GP1 A;  3M7G A;  3GLG A;  1NJG A;  3EIH A;  3A45 A;  3U60 B;  1IBK M;  3QAU A;  2XF3 A;  3I4Y A;  4LF4 M;  4LRT A;  3JAM S;  4G4Q A;  2DXI A;  1N34 M;  3B9P A;  2DWM A;  2CE7 A;  4FWD A;  5A2Q S;  4OU7 A;  4KLN A;  4DUZ M;  1GLN A;  1TH4 A;  2L09 A;  5EP2 A;  3SHG B;  3L25 A;  3GPY A;  4Z6Y A;  4MGY E;  4GHL A;  4GIT A;  3K1J A;  1ZAE A;  4B3T M;  4QNR A;  1G41 A;  2Q2E B;  4KOD A;  5DNY A;  4MB7 A;  2DZO B;  4JI2 M;  3H4M A;  3QWL A;  5EJC A;  4EIW A;  2FOI C;  2P5T A;  2KXE A;  3HJS A;  2LWX A;  1DGH B;  4GH9 A;  4M9Z A;  1GL7 A;  5JI3 E;  1XNQ M;  3KP0 E;  4LJ5 A;  5IWA M;  2L6O A;  3T1Y M;  1QYR A;  2I7N A;  2LH0 A;  4DV6 M;  4G4R A;  1I94 M;  3IG8 A;  4GC9 A;  2HCB A;  7CAT A;  1C1K A;  4L4U A;  3AOG A;  3HHX A;  3KS8 A;  3U61 B;  4GHA A;  3SAT A;  5KQ8 A;  1PJJ A;  4QHT A;  2NQ8 C;  2RKO A;  4G4N A;  2QBY A;  1HT2 E;  3PNY A;  3R9X B;  3GPP A;  1N78 A;  3U6L A;  1K82 A;  3J80 S;  4YY3 M;  2CEA A;  4X64 M;  1JR3 A;  3VKG A;  4OVZ B;  5FLX S;  4NXN M;  3CF0 A;  2O5R A;  3U6D A;  4DV0 M;  3ZC7 B;  1IY2 A;  4CGY B;  4MM3 B;  1I4W A;  3SAW A;  2EO2 A;  1J5E M;  2X49 A;  3C58 A;  3HGI A;  1IXZ A;  2UXB M;  1XWI A;  4GRI A;  4HLQ A;  4LFA M;  4TUW A;  2JA2 A;  3L29 A;  1L1Z A;  2CFO A;  4DV1 M;  1N36 M;  1OJL A;  3JR5 A;  2C99 A;  1NY6 A;  4II7 A;  4LJ9 A;  3J7B A;  1QAO A;  1HNX M;  3HKP A;  2UUA M;  5FTK A;  2Z4S A;  1J7K A;  1S3S A;  5ITX A;  3E4R A;  4DR4 M;  1L2D A;  2UU9 M;  3SBJ A;  4IBJ A;  1G8P A;  1G59 A;  3A98 B;  3GRY A;  1T3T A;  3PVS A;  3T38 A;  1QVR A;  3GLH B;  4AKI A;  2QZ4 A;  1L2B A;  3L2A A;  4M9X A;  1E9R A;  2E5L M;  3EIE A;  3SHF A;  4LZJ A;  3DA1 A;  1R7R A;  4D82 A;  2K47 A;  2R46 A;  2D7G A;  1FNN A;  3DFZ A;  5JI2 E;  2CHQ A;  2DHR A;  2DWL A;  1ORY B;  1YE9 A;  4B3S M;  1N77 A;  2BNK A;  1K3X A;  2KRU A;  4LY6 A;  3KW6 A;  4JN6 A;  4BBA A;  2AHM A;  3J27 B;  1TDZ A;  3FUU A;  3L27 A;  1JQJ C;  2ZAM A;  3SYL A;  1IY0 A;  1Z59 A;  5DYG A;  1HQY E;  3HJQ A;  2F5Q A;  3FYC A;  1IN4 A;  3LMM A;  3SAV A;  4LGY A;  3SFZ A;  3K8Z A;  1XXH B;  2XZU A;  1XMO M;  1D2N A;  4AZF A;  2R62 A;  2CV0 A;  4FD2 A;  2UUB M;  5KPT A;  1SXJ A;  5LMU M;  2DWZ B;  3LQQ A;  5ITQ A;  8CAT A;  3J2P B;  1XMQ M;  3KOZ E;  4DV2 M;  4DV5 M;  4GKJ M;  4JI7 M;  2Y20 A;  4A3V B;  1L2C A;  3TQS A;  3GLG B;  1HNW M;  4L16 A;  1N33 M;  2A5Y B;  3KP1 E;  3FTC A;  5ITX E;  2KEB A;  2ZBK B;  1E9S A;  4CHT B;  3U6P A;  2KW0 A;  1SXJ C;  4LJA A;  1XNR M;  3ILK A;  3LQR A;  5ITR A;  3CF2 A;  3FUW A;  4M0W A;  3LVW A;  3UZU A;  4FW9 A;  5FTJ A;  5FTN A;  4LF6 M;  4GMQ A;  2YNM D;  2J7O A;  3FTD A;  4QNM A;  1NHW C;  4RNA A;  5ITU A;  3L26 A;  4LJ8 A;  3ZH9 B;  3U6E A;  4I8O A;  4IIW A;  3U5Z A;  1TGU A;  3D8B A;  2CV1 A;  3KFU G;  3UK6 A;  2XFT A;  2J7N A;  4MGK E;  2W82 A;  4GC5 A;  4X65 M;  3AKZ A;  1IXS B;  3U6M A;  2LXE A;  4QHS A;  3TWK A;  4PD2 A;  1NHG C;  3AFH A;  3GPX A;  2VII A;  2ZAO A;  3WHK A;  4AW4 A;  4DV4 M;  3SYK A;  4DR5 M;  1JR3 D;  1GL6 A;  3K2L A;  2YFQ A;  3GRU A;  1R2Z A;  4AI6 A;  2X4A A;  1VDD A;  4R3D A;  5E26 A;  1QAQ A;  1IN6 A;  2ZAN A;  2QBY B;  5ITY A;  3RE8 A;  3GQ4 A;  4LFC M;  3FTE A;  1IBL M;  1IM2 A;  4GKK M;  3HU3 A;  4DUY M;  2LNH C;  2Y0Q A;  3W0F A;  3BOS A;  4FWH A;  4AG6 A;  3CTW B;  4P16 A;  3UGJ A;  1SXJ E;  4D81 A;  2QCU A;  4B3M M;  4B08 A;  2XZF A;  1L1T A;  4MH0 E;  3FD9 A;  4NXM M;  4WW0 A;  1TH2 A;  1DO0 A;  2C98 A;  3KS4 A;  4JI3 M;  1E94 E;  5EXT A;  3NWL A;  3PNV A;  3RFW A;  4FVM A;  3GLF A;  1EE8 A;  1QAN A;  3LVV A;  4NSO B;  4I5S A;  4MGH A;  5GKN A;  3SAU A;  3TPZ A;  3HWS A;  4B3R M;  2FNA A;  3W0L B;  4DR1 M;  1H6U A;  3U6Q A;  1LV7 A;  4JXJ A;  1IXR C;  4PDG A;  4LF5 M;  5EXP A;  4RF0 A;  1IBM M;  1N32 M;  3VDU A;  4IBB A;  3VLF B;  2Y21 A;  1HR0 M;  4IBI A;  3SAR A;  1R6B X;  1NY5 A;  2DZN B;  4DR6 M;  1Q3B A;  4IBD A;  3TL4 X;  4M9S A;  1Z6T A;  5F3W A;  1HNZ M;  4DR7 M;  5DYI A;  1GVN A;  4JV5 M;  3HHZ A;  4DV7 M;  4JYA M;  2F5O A;  4Z8X A;  1KSF X;  3HU1 A;  2EA0 A;  4IBF A;  3GLI A;  1X37 A;  4LF7 M;  4XBO A;  1G3I A;  2V1C A;  4X66 M;  4NSR A;  3TWM A;  1IN8 A;  1NVM A;  3OTO M;  1ZQ9 A;  1SXJ D;  4B7H A;  1K3W A;  4NRW A;  3ZCB B;  1NNU C;  1J09 A;  3MJ5 A;  4DR3 M;  4LJ7 A;  2ERC A;  5KPR A;  3R8F A;  1R2Y A;  1SXJ B;  4KHP M;  5FSW A;  5IRE B;  4JI0 M;  4IBG A;  1OFI A;  5C18 A;  2OPF A;  4MGI E;  5EP3 A;  1N75 A;  3PXG A;  2VQF M;  4JI1 M;  3FUV A;  5EXS A;  3SMP A;  4NOO B;  3SC3 A;  1NJF A;  3KOX E;  2C5R A;  4JI5 M;  3T1H M;  3SAS A;  2XEP A;  5KO3 A;  2VQE M;  2XSZ A;  3U6S A;  1HQC A;  2OQ4 A;  1QAM A;  3VDP A;  3U6C A;  5BR8 M;  5EQT A;  4LF8 M;  2QP9 X;  3J7A S;  2EUC A;  3E9S A;  3NBI A;  2RGH A;  4HL4 A;  5EP1 A;  2BJW A;  2HKJ A;  2L7I A;  1Z5A A;  4IBK A;  1PJI A;  5H37 D;  4DV3 M;  3U60 A;  4L15 A;  2XLJ A;  2F5N A;  1FJG M;  2D7E A;  2UUC M;  3I51 A;  3U5Z B;  4FCW A;  1Q39 A;  2Z3X A;  1UM8 A;  4WUR A;  2Y0T A;  3THG A;  2FE8 A;  1IQP A;  4CIS A;  4LJ6 A;  4RF1 A;  5C1B A;  2F4V M;  5IT9 S;  2I7P A;  3GRR A;  3RGP A;  4PT5 A;  2BJV A;  4QOS A;  3TE6 A;  2KZU A;  4LF9 M;  3FUX A;  4KO8 A;  4PCZ A;  2HHH M;  3FKE A;  1W5S A;  1NSF A;  1IN7 A;  3GPU A;  1DGH A;  3A42 A;  1YSY A;  2QEN A;  4LFB M;  3GRV A;  4S12 A;  3HHW A;  2FFJ A;  3KSJ A;  1YUB A;  4YHH M;  4IBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...