1C1KA

Bacteriophage t4 gene 59 helicase assembly protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
b'MIKLRMPAGGERYIDGKSVYKLYLMIKQHMNGKYDVIKYNWCMRVSDAAYQKRRDKYFFQKLSEKYKLKELALIFISNLVANQDAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIFEYNPKVQSSYIFKLLQSNIISFETFILLDSFLNIIDKHDEQTDNLVWNNYSIKLKAYRKILNIDSQKAKNVFIETVKSCKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPT4 GENE 59 HELICASE ASSEMBLY PROTEIN
publication title Bacteriophage T4 gene 59 helicase assembly protein binds replication fork DNA. The 1.45 A resolution crystal structure reveals a novel alpha-helical two-domain fold.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08993 T4_Gp59_N T4 gene Gp59 loader of gp41 DNA helicase
A PF08994 T4_Gp59_C T4 gene Gp59 loader of gp41 DNA helicase C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1c1kA01
1.10.220.50 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Bacteriophage T4, Gp59, helicase assembly protein, C-terminal domain 1c1kA02
1S3SA 1HT1E 2C96A 1D2NA 3GLHB 5FTNA 1SXJD 4LJ9A 4L16A 1KYIA 1J7KA 4FWHA 3DZDA 4D81A 1JR3D 3CF2A 3HWSA 2XSZD 5DYGA 2QBYB 1SXJB 5EXPA 3KDSE 2QPAA 2HCBA 2DHRA 1IM2A 1X37A 1G41A 1W5SA 4D82A 3HU1A 2ZAOA 1JR3A 1HQYE 3MHVC 3GLGA 2DZOB 1HT2E 2C9OA 3D8BA 3HU3A 3U5ZB 3GLIA 5EP3A 1QVRA 4ZPXA 3CF0A 1NJGA 1NY5A 1IN8A 3K1JA 5EXXA 3H4MA 4LRSA 4QHTA 3SYLA 3WHLA 1IXRC 4A3VB 4D80A 2Z4RA 4GITA 4LJ7A 4LGMA 1SXJE 4WW0A 3PXGA 4FD2A 4I81A 5C1BA 2X8AA 5EXSA 1NJFA 2BJWA 4LCBA 1NY6A 2CHGA 2CE7A 3PVSA 1DO2A 2R62A 3R8FA 2BJVA 3HU2A 1OJLA 1IN6A 3M0EA 3ZH9B 3B9PA 3AJIB 1XWIA 2QENA 5FTMA 3GLFA 2CHVA 4QNMA 3GLGB 1R7RA 1IN5A 4LY6A 4FW9A 3GLIB 1OFHA 4FWGA 4LZZA 1G4AE 2R65A 4LJ4A 1FNNA 3UK6A 2DZNB 5EP4A 5C18A 4QHSA 1R6BX 4QOSA 1L8QA 3VFDA 2CHQA 3U61B 5JI2E 5JI3E 2QZ4A 5EXTA 5EQTA 1E94E 1UM8A 4LJ5A 1OFIA 3SC3A 2FNAA 1IN7A 4KO8A 2V6ZM 1XXHA 4QNRA 4LJ8A 1KSFX 1LV7A 4LRTA 4L15A 1NVMA 4EIWA 4LJ6A 5FTLA 3EIEA 3M6AA 3WHKA 1W5TA 3VLFB 4KLNA 3GLFB 3PFIA 5DYIA 1G3IA 2KRKA 2RKOA 5FTKA 1DO0A 4FCWA 1IY0A 5FTJA 1E32A 3GLHA 2V1UA 2ZAMA 2CEAA 2VIIA 2DVWB 4KODA 4FCVA 1IXSB 2QBYA 1SXJA 1IN4A 3EIHA 4FCTA 1C1KA 4I4LA 2Z4SA 1QZMA 1HQCA 1IQPA 2C99A 3KW6A 4JN6A 1SXJC 4Z8XA 2XSZA 2C9CA 1XXHB 2ZANA 2DWZB 2QP9X 5EP1A 1IXZA 5EP2A 3BOSA 3SYKA 1NSFA 4LJAA 2C98A 1IY2A 4FWDA 3U60B 4L4UA 1JQJC 1IY1A
chains in the Genus database with same CATH superfamily
1YCNA 1ALAA 1AVCA 1OQYA 1HT1E 2KRUA 3SATA 1N78A 2O25A 2QQ8A 4IBBA 3GLHB 4LGYA 5FTNA 5ITQA 3K9OA 2FOIC 3THGA 1TGUA 4DR7M 3KOYE 4FWHA 3FRIA 3HJLA 3ABOA 2R0IA 4XK8F 1QUTA 1XB2B 3FUVA 3SMSA 3FTEA 1Z5CA 2QBYB 1QZEA 1XSZA 4AI6A 1LTMA 2DZLA 1IM2A 2HKJA 1X37A 1G41A 5E26A 3L25A 2HAKA 3PNVA 3HU3A 3TW5A 1C7YA 1J09A 1K3XA 4GIPA 1G71A 2O01F 3K2LA 1NY5A 1OIZA 3VKHA 1DGFA 4OW0A 2F5PA 3UJNA 3K1JA 2F5NA 4JYAM 1Q8DA 4OIYA 1D0LA 5ITXA 1IBLM 3VKGA 4GEWA 4DV6M 2Y0QA 3KOZE 3L27A 4L78A 2DXIA 4JV5M 4D80A 2Z4RA 4GITA 3U61A 4LJ7A 3U6QA 1GJSA 5KPZA 4II7A 4R7GA 1SXJE 3FYDA 2IE6A 2L6OA 4MGYE 2DWNA 1S9DE 4JMOA 2BJWA 1DGHB 2CHGA 2DAGA 4M9ZA 4G4RA 4LF5M 2HYUA 3PVSA 4ANRA 1QDTA 1E9RA 2XGNA 3ZQJA 3CTWB 3FUWA 5FTMA 3LQQA 2CHVA 2M5ZA 3GLFA 1YGMA 3AOEA 3L28A 4LY6A 4MH0E 3GPUA 2V1CA 3C9PA 3GLIB 1V33A 1OKSA 3IG8A 3T38A 4DR5M 4JI6M 4HREA 3LCUA 3IECA 4I5SA 2EKFA 1Z6TA 2K9DA 3NWLA 4GRIA 3GPXA 3SAUA 3J27B 4HEOA 5EP4A 2RANA 4Y28F 4DUYM 2F5SA 2UUCM 1Q3BA 1TF0B 3L29A 1R2ZA 2ZTCA 1Z5BA 3I51A 1PRBA 4JI3M 3TPZA 4D7QA 1I4WA 2HL7A 4M9SA 2H0LA 1TDHA 2I7PA 4CJ6A 3AKZA 4DR1M 3HHZA 4JI2M 2V6ZM 4DR2M 1XXHA 3GLGE 3HJSA 4QNRA 1LV7A 1OIPA 2XF3A 2KW0A 4EIWA 4YY3M 4LF6M 2OO9A 1HNZM 2OPFA 4KLNA 4OVZA 2UXCM 5DYIA 3U60A 1BC0A 1K82A 3SASA 1G3IA 2RKOA 4IBJA 1DO0A 3RE8A 1QANA 2YFQA 3HHXA 2R18A 3T1YM 1L1TA 2J5YA 3GLHA 1BCYA 2HYWA 4HL4A 4DV0M 3QYEA 1OTRA 2DVWB 5ITYA 4IBIA 3J7BA 2XZUA 2BWEA 4NRVA 2VQEM 4G4NA 4JI4M 4JXHA 2QBYA 2ZM6M 3EIHA 4FCTA 4P17A 3AOGA 2L2DA 5FSWA 3U6PA 4GHAA 1TH2A 2C99A 2QNJA 4NL4H 4X66M 2Z8YM 1N34M 1GABA 4IBCA 4LF9M 2Y21A 4R3DA 5EP2A 1UFZA 5E6JA 2JZ0A 2JXNA 2MROB 3RGPA 4LJAA 2C98A 1VG5A 1E9SA 1HVEA 3KP1E 4IBFA 4DV7M 1AEIA 1NV9A 4MGHA 2F5QA 4B3MM 2WSEF 2UUAM 4D7RA 2LNHC 3RGSA 3SHGB 2CV0A 4B3TM 1DGHA 3DZDA 3LQRA 3HHWA 2DAMA 5F3WA 4LF8M 1CUKA 1Q3CA 1XNRM 3SAVA 2VDBB 1UPTB 1SG9A 1SXJB 1HM6A 4MGZE 2DHRA 4JI1M 1MX0A 1W5SA 4D82A 2ZAOA 2DENA 2JY7A 3GO8A 2UU9M 2DZOB 3R9XB 4C0AA 3VK7A 3LCVB 2L7HA 5EP3A 1QVRA 3GLIA 4JXJA 3MMPA 4ZPXA 3ZCBB 4JI5M 1W3WA 2VXGA 4FHRB 3USYA 5KQ8A 4RF0A 2KNAA 2LVQD 1IN8A 4KMUX 2B3TA 2F4VM 3ABQA 1IXRC 4A3VB 3LTLA 1N36M 3FRHA 3KXEC 3T15A 1QDRA 2K6BA 4NSOB 4G4QA 2Y20A 3SHFA 4WW0A 2GQFA 3D8LA 2VQFM 1T43A 4FD2A 4I81A 1YIIA 2J7OA 3A45A 2D7GA 4AZFA 4LCBA 1N41A 1RU3A 2CE7A 3K9PA 1G8PA 1YE9A 1ZMWA 1WIVA 2OY9A 1EFUB 2LVPC 1A5TA 2R62A 2UXBM 2A5YB 3ZH9B 4HLQA 1OJLA 5GKNA 5DNYA 2Z7JA 1AXNA 2QENA 4X62M 4S12A 3I4YA 4DBGB 3GLGB 2EUCA 5KQDA 3B7NA 1DM5A 2EO2A 3UGJA 1TDZA 2HYVA 3QWLA 4LZZA 4AKIA 4DV3M 2WSCF 3T1HM 3SMPA 1Z59A 3AOEC 4LJ4A 3GQ4A 1FNNA 1BC1A 3U6DA 3U6EA 3UK6A 4M0WA 1AIIA 3TWMA 4YHHM 1R6BX 1ORYB 4QOSA 4BLCA 4G4OA 2H5XA 7CATA 3FYCA 2CHQA 4JI8M 1GO5A 3BBZA 1N75A 3LVWA 5DFLA 5JI2E 2HWJA 2QZ4A 2DAEA 1ZMUA 2Q2EB 3J80S 4AQYM 4NXMM 1E94E 1UM8A 2DNAA 2II2A 1KFVA 1IN7A 1WXQA 4W5WA 1L2CA 1JR3E 2EJSA 1NO1A 3USWA 4Z6YA 4LRTA 2OQ4A 2FS1A 1NVMA 3IG5A 3GPPA 2JY8A 4ITQA 3GRVA 1XJLA 3ABRA 2O5RA 1R5LA 2KNZA 3VLFB 1MCXA 3PFIA 1NHGC 1Q02A 1Z5AA 1WR1B 3NBXX 5FTJA 1E32A 1W45A 1XMOM 4GKJM 3BXWA 1PGYA 3IHPA 2CUZA 2ZAMA 2KA6B 1TH3A 1R4GA 4Q2SA 3SWVA 3KSJA 2APLA 1EE8A 4L6V6 3W0LB 1SXJA 1WGNA 4G6ZA 1IN4A 3HJQA 4B08A 1XMQM 2Z4SA 4LFCM 1N44A 3FKEA 2MJ5B 3KP0E 2MR9A 1VEKA 4Z21A 2KZUA 3ILKA 2VF8A 3VDPA 2JUJA 4PD2A 1EIJA 2AHMA 1R2YA 1AVHA 2DWZB 4IBKA 4NSRA 4JK1X 5ITRA 1R8SE 1DV0A 4M9XA 3BOSA 1GKIA 2R45A 3FUXA 3SYKA 3VK8A 4DV1M 1PJTA 4BBAA 3KOWE 3KVWA 1IY2A 2MGWA 1LKVX 4IBEA 1V92A 1IY1A 2ZOCA 3BRXA 2P5TA 1S3SA 5A2QS 1QQWA 4LZJA 1D2NA 2G8LA 3HX3A 2XLJA 1SXJD 1H6UA 4LJ9A 2E5LM 4NRWA 2Y0TA 1J7KA 3PNYA 4MB7A 4F1IA 5LMUM 3SBJA 2DWLA 2OOAA 4DV2M 4DR3M 1DK5A 4WP2A 4D81A 1BC9A 1JR3D 3CF2A 3HWSA 5DYGA 3RFWA 3GP1A 1NHWC 3HY5A 1HR0M 4CISA 2K47A 1F4IA 1DGBA 4B7GA 1IFYA 4DR6M 2JNHA 1TTEA 4LFAM 3GLGA 3MHVC 3U5ZB 2MH8A 1M9IA 2JP7A 3GRUA 3W68A 4NOOB 3CF0A 1QYRA 2L09A 2QHOB 1PBVA 3JR4A 3DFZA 4NC6A 2L4FA 5IT9S 5EXXA 2H0KA 2EKKA 3M7GA 4LRSA 3JAMS 3LVVA 3U6OA 1GVNA 2KDLA 2XZFA 1NNUC 2LHGA 1ZMVA 2KEBA 1N77A 1BO9A 3AJCA 2H0MA 3QYBA 4PDIA 3HZJA 4L5MA 4LF7M 3PXGA 4PDGA 1G59A 3FD9A 2ZHIA 2CWBA 1NJFA 1TH4A 3TL4X 3GPYA 1NY6A 1WJ7A 2JY5A 2LHCA 4GC5A 1DO2A 3FTCA 4GC9A 3B89A 5KPTA 3R8FA 2BJVA 1G5NA 1R8QE 4JMIA 1XWIA 3HJ8A 2RGHA 3W67A 1QAQA 3Q8GA 1IBKM 2CV1A 3I4VA 1L1ZA 2DKLA 3FTFA 3KFUG 1OFHA 4FWGA 1G4AE 3L26A 4OU7A 1BCZA 4IJEA 4A4PA 4LFBM 1GL7A 2DZNB 4MDVA 4IBDA 2CP8A 2CFOA 2G3QA 2K0BX 5EJCA 3KS4A 1L8QA 2LVAA 4FVMA 1AUAA 2LH0A 1QC7A 3K8ZA 3U6CA 5JI3E 3I04M 5EXTA 1K3WA 1AVRA 1W7BA 4LJ5A 2LBCA 2LVNC 4R71A 3SC3A 1VEGA 5BR8M 2EA0A 2JZ1A 4NXNM 2LVOC 1PJSA 8CATA 4JWLA 1R4AE 2HHHM 4LJ8A 1KSFX 1L2BA 3C3DA 2R4EA 3L2AA 4TUWA 1T3TA 4B3RM 3M6AA 4IIWA 1W5TA 1J5EM 1ZV1A 3SARA 4AKGA 1ANXA 2I7NA 4JI0M 1I94M 3ANYA 1XC8A 4MGKE 1PJIA 2KRKA 5ITXE 4QOZC 5KPRA 4FCWA 5IREB 2KHHA 2XFSA 1XNQM 2CEAA 3CF6E 4AG5A 4FQ0C 2FH0A 3F92A 2ERCA 2X49A 1N33M 4KODA 1HJPA 1YSYA 1AIPC 3E46A 4FCVA 1IXSB 3HHYA 2CV2A 4EVHA 1WHCA 5KO3A 4I4LA 2Q4CA 4XBOA 4AW4A 3FUTA 1QZMA 3UMMA 3AFHA 1HQCA 1L2DA 2XH9A 3ABSA 3KW6A 4JN6A 1DGGA 3UZUA 1SXJC 3U5ZA 1IBMM 2DAKA 2XSZA 1Q39A 1MN3A 3E4RA 3GLFE 3U6SA 4GMQA 1AOWA 1BC3A 4L8RC 2QP9X 2OOBA 3T6PA 1IXZA 5BPVA 2NQ8C 1RE0B 1A8AA 2DAIA 1BVSA 2KXEA 3FUUA 3JR5A 1NSFA 2R46A 1D0KA 4FWDA 4X9PA 4L4UA 1JQJC 3E21A 2JWSA 4M0DA 2QSFX 4B7FA 3KOXE 2C96A 4B7HA 2R4JA 4X65M 1XT0B 3GRRA 1ANWA 4L16A 1KYIA 4DR4M 4K0KM 3LW5F 2M60A 1PM5A 3DA1A 4AG6A 1V34A 1PJQA 3SAWA 3TWLA 1MU5A 2XSZD 3SOHB 1XXHE 5EXPA 3KDSE 2QPAA 2HCBA 4RNAA 1Y8GA 2WZJA 4JI7M 1HNWM 2JY6B 3MK6A 3HU1A 5L8RF 1JR3A 1HQYE 4G3OA 4RF1A 1HT2E 2C9OA 3D8BA 2XFTA 3HGIA 4OVZB 1I4AA 4I8OA 3W0FA 4PT5A 2FFJA 1P3QQ 1NJGA 1YLAA 3U6LA 2W82A 3J7AS 1KU1A 4CIZA 2JA2A 1HNXM 3V76A 3GLHE 3DOAA 3H4MA 2XO2A 3TE6A 1QAOA 4P16A 4QHTA 3SYLA 3WHLA 2K6XA 1GLNA 2XEPA 3TWKA 4DV5M 1HVFA 2QCUA 4MGIE 1TR8A 2WSFF 5ITTA 2Z3XA 2LXEA 4LGMA 4LG2A 1A8BA 4RKUF 4DUZM 3GRYA 2DHYA 5C1BA 4CGYB 4C7PA 2X8AA 5EXSA 3U6MA 4UN2B 3GQ5A 3AV0A 1FJGM 4F2LA 4GHLA 3OTOM 2KZSA 2R0DA 4KN7X 5FLXS 3HU2A 3M0EA 1JB0F 1IN6A 2UUBM 3B9PA 3AJIB 1HAKA 4KT0F 2GNOA 4QNMA 3Q8XA 4KN4X 4OX9M 4AKHA 3ZC7B 1R7RA 1IN5A 1N00A 4B3SM 2D7HA 4FW9A 1GJTA 3C58A 3NBIA 1D0MA 2R6FA 2X4AA 2R65A 4DV4M 3KS8A 2KNVA 5C18A 4Q7JA 3KSXA 4QHSA 1OAIA 1PJJA 2G5GX 1NV8A 1QUSA 1IXSA 2ZBKB 3VFDA 3I01M 2QEZA 4MDUA 2LWXA 1VDLA 5H37D 2CRUA 2D7EA 3J81S 2BWBA 3U61B 4GKKM 2BNKA 2FE8A 1N32M 1HVDA 5EQTA 1OFIA 3B74A 4BB9A 5LMNM 2FNAA 4KO8A 1R8ME 3LMMA 2DI0A 2L7IA 3E9SA 2VF7A 3H4JA 5IZ7D 3GLIE 4L15A 2DWMA 2LTUA 1ZAEA 2H1RA 4EVFA 4LJ6A 5FTLA 2F5OA 3EIEA 2ZHJA 2RGOA 2IE7A 3K92A 3WHKA 3L8NA 2RRUA 3A42A 1BCWA 3GLFB 3VDUA 2UXDM 4MM3B 2YR0A 5FTKA 3AL0C 1IY0A 3B7QA 4GH9A 4REZA 1GL6A 4WURA 3SFZA 1ANNA 3A46A 2V1UA 2VIIA 2IICA 3MJ5A 1VDDA 1HVGA 1VEJA 2N35A 3FE3A 3A98B 3GQ3A 2R44A 3FTDA 1YUBA 4IJFA 2XO3A 1SAVA 2C5RA 3CGWA 1T6OA 4IBGA 1C1KA 1VQ1A 4X64M 4XGIA 2YQZA 2HSNA 3AO0A 1IQPA 4Z8XA 4KHPM 1MJGM 4PCZA 1QAMA 2C9CA 5ITUA 1NNJA 1YJ0A 3QAUA 1N42A 3B7ZA 1XXHB 2ZANA 5EP1A 2J7NA 3HKPA 2YNMD 4LF4M 1XHBA 5IWAM 2ZTDA 1OAOC 3C3EA 4CHTB 2R09A 2L4EA 3J2PB 1WGLA 3U60B 1ZQ9A 3TQSA
chains in the Genus database with same CATH topology
1HT1E 2KRUA 3SATA 1N78A 4IBBA 3GLHB 4LGYA 5FTNA 5ITQA 4DR7M 2FOIC 3THGA 1TGUA 3KOYE 4FWHA 3SMSA 3FUVA 3FTEA 1Z5CA 2QBYB 4AI6A 2HKJA 1IM2A 5E26A 1X37A 1G41A 3L25A 3PNVA 3HU3A 1J09A 1K3XA 4GIPA 3K2LA 1NY5A 3VKHA 1DGFA 4OW0A 2F5PA 3UJNA 3K1JA 2F5NA 4JYAM 5ITXA 1IBLM 3VKGA 4DV6M 2Y0QA 3KOZE 3L27A 4L78A 2DXIA 4JV5M 4D80A 2Z4RA 4GITA 3U61A 4LJ7A 3U6QA 5KPZA 4II7A 4R7GA 1SXJE 3FYDA 2L6OA 4MGYE 2DWNA 2BJWA 1DGHB 2CHGA 4G4RA 4M9ZA 4LF5M 3PVSA 1E9RA 2XGNA 3CTWB 3FUWA 5FTMA 3LQQA 2CHVA 2M5ZA 3GLFA 3AOEA 3L28A 4LY6A 4MH0E 3GPUA 2V1CA 3GLIB 4JI6M 3IG8A 3T38A 4DR5M 4I5SA 1Z6TA 3NWLA 4GRIA 3GPXA 3SAUA 3J27B 5EP4A 4DUYM 2F5SA 2UUCM 1Q3BA 3L29A 1R2ZA 1Z5BA 3I51A 4JI3M 3TPZA 1I4WA 2HL7A 4M9SA 1TDHA 2I7PA 3AKZA 4DR1M 3HHZA 4JI2M 2V6ZM 4DR2M 1XXHA 3HJSA 4QNRA 1LV7A 2XF3A 2KW0A 4EIWA 4YY3M 4LF6M 1HNZM 2OPFA 4KLNA 4OVZA 2UXCM 5DYIA 3U60A 1K82A 3SASA 1G3IA 2RKOA 4IBJA 1DO0A 3RE8A 1QANA 2YFQA 3HHXA 2R18A 3T1YM 1L1TA 3GLHA 1N32M 4HL4A 4DV0M 5ITYA 2DVWB 4IBIA 3J7BA 2XZUA 4NRVA 2VQEM 4G4NA 4JI4M 2QBYA 2ZM6M 3EIHA 4FCTA 3AOGA 5FSWA 3U6PA 4GHAA 1TH2A 2C99A 4NL4H 4X66M 1N34M 4IBCA 4LF9M 2Y21A 4R3DA 5EP2A 5E6JA 3RGPA 4LJAA 2C98A 1E9SA 3KP1E 4IBFA 4DV7M 2F5QA 4MGHA 4B3MM 2UUAM 2LNHC 3RGSA 3SHGB 2CV0A 4B3TM 1DGHA 3DZDA 3LQRA 3HHWA 5F3WA 4LF8M 1Q3CA 1XNRM 3SAVA 1SXJB 4MGZE 2DHRA 4JI1M 1MX0A 1W5SA 4D82A 2ZAOA 3GO8A 2UU9M 3R9XB 2DZOB 3VK7A 3GLIA 2L7HA 5EP3A 1QVRA 4JXJA 4ZPXA 3ZCBB 4JI5M 5KQ8A 4RF0A 1IN8A 2F4VM 1IXRC 4A3VB 1N36M 3KXEC 3T15A 4NSOB 4G4QA 2Y20A 3SHFA 4WW0A 3D8LA 2VQFM 4FD2A 4I81A 2J7OA 3A45A 2D7GA 4AZFA 4LCBA 2CE7A 1G8PA 1YE9A 2R62A 2UXBM 2A5YB 3ZH9B 4HLQA 1OJLA 5GKNA 5DNYA 2Z7JA 2QENA 4X62M 4S12A 3I4YA 3GLGB 2EUCA 5KQDA 2EO2A 3UGJA 1TDZA 3QWLA 4LZZA 4AKIA 4DV3M 3T1HM 3SMPA 1Z59A 3AOEC 4LJ4A 3GQ4A 1FNNA 3U6DA 3U6EA 3UK6A 4M0WA 3TWMA 4YHHM 1R6BX 1ORYB 4QOSA 4BLCA 4G4OA 7CATA 3FYCA 2CHQA 4JI8M 1N75A 3LVWA 5JI2E 2QZ4A 2Q2EB 3J80S 4AQYM 4NXMM 1E94E 1UM8A 1KFVA 1IN7A 1WXQA 4W5WA 1L2CA 4Z6YA 4LRTA 2OQ4A 1NVMA 3IG5A 3GPPA 4ITQA 3GRVA 2O5RA 3VLFB 3PFIA 1NHGC 1Z5AA 5FTJA 1E32A 1XMOM 4GKJM 2CUZA 2ZAMA 2KA6B 1TH3A 3KSJA 1EE8A 3W0LB 1SXJA 4G6ZA 4B08A 1IN4A 3HJQA 1XMQM 2Z4SA 4LFCM 3FKEA 3KP0E 2KZUA 3ILKA 3VDPA 4PD2A 2AHMA 1R2YA 2DWZB 4IBKA 4NSRA 5ITRA 4M9XA 3BOSA 1GKIA 2R45A 3FUXA 3SYKA 3VK8A 4DV1M 4BBAA 3KOWE 3KVWA 1IY2A 4IBEA 1IY1A 2P5TA 1S3SA 5A2QS 1QQWA 4LZJA 1D2NA 2G8LA 2XLJA 2E5LM 1SXJD 1H6UA 4LJ9A 4NRWA 2Y0TA 1J7KA 3PNYA 4MB7A 3SBJA 5LMUM 2DWLA 4DR3M 4DV2M 4D81A 1JR3D 3CF2A 3HWSA 5DYGA 3RFWA 3GP1A 1NHWC 1HR0M 4CISA 2K47A 1DGBA 4B7GA 4DR6M 4LFAM 3GLGA 3MHVC 3U5ZB 3GRUA 4NOOB 3CF0A 1QYRA 2L09A 3JR4A 3DFZA 5IT9S 5EXXA 3M7GA 4LRSA 3JAMS 3LVVA 3U6OA 1GVNA 2XZFA 1NNUC 2KEBA 1N77A 4PDIA 4LF7M 3PXGA 4PDGA 1G59A 3FD9A 1NJFA 1TH4A 3TL4X 3GPYA 1NY6A 4GC5A 1DO2A 3FTCA 4GC9A 5KPTA 3R8FA 2BJVA 1XWIA 3HJ8A 2RGHA 1QAQA 1IBKM 2CV1A 3I4VA 1L1ZA 3FTFA 3KFUG 1OFHA 4FWGA 1G4AE 3L26A 4OU7A 4IJEA 4LFBM 1GL7A 2DZNB 4IBDA 5EJCA 2CFOA 3KS4A 1L8QA 4FVMA 2LH0A 3K8ZA 3U6CA 5JI3E 5EXTA 1K3WA 4LJ5A 3SC3A 5BR8M 2EA0A 4NXNM 8CATA 2HHHM 4LJ8A 1KSFX 1L2BA 3L2AA 2R4EA 4TUWA 1T3TA 4B3RM 3M6AA 4IIWA 1W5TA 1J5EM 3SARA 4AKGA 2I7NA 4JI0M 1I94M 1XC8A 4MGKE 1PJIA 2KRKA 5ITXE 4QOZC 5KPRA 4FCWA 5IREB 2XFSA 1XNQM 2CEAA 3CF6E 4AG5A 2ERCA 2X49A 1N33M 4KODA 1YSYA 3HHYA 2CV2A 4FCVA 1IXSB 5KO3A 4I4LA 4XBOA 4AW4A 3FUTA 1QZMA 3UMMA 3AFHA 1HQCA 1L2DA 2XH9A 3KW6A 4JN6A 1DGGA 3UZUA 1SXJC 3U5ZA 1IBMM 2XSZA 1Q39A 3E4RA 3U6SA 4GMQA 4L8RC 2QP9X 1IXZA 5BPVA 2NQ8C 2KXEA 3FUUA 3JR5A 1NSFA 2R46A 4FWDA 4L4UA 1JQJC 4M0DA 4B7FA 3KOXE 2C96A 4B7HA 2R4JA 4X65M 3GRRA 4L16A 1KYIA 4DR4M 4K0KM 2M60A 1PM5A 3DA1A 4AG6A 3SAWA 3TWLA 1MU5A 2XSZD 5EXPA 3KDSE 2QPAA 2HCBA 4RNAA 1HNWM 4JI7M 3MK6A 3HU1A 1JR3A 1HQYE 4RF1A 1HT2E 2C9OA 3D8BA 2XFTA 3HGIA 4I8OA 3W0FA 4PT5A 2FFJA 1NJGA 3U6LA 2W82A 3J7AS 2JA2A 1HNXM 3DOAA 3H4MA 3TE6A 1QAOA 4P16A 4QHTA 3SYLA 3WHLA 1GLNA 2XEPA 3TWKA 4DV5M 2QCUA 4MGIE 5ITTA 2Z3XA 2LXEA 4LGMA 4LG2A 4DUZM 3GRYA 5C1BA 4CGYB 2X8AA 5EXSA 3U6MA 3GQ5A 3AV0A 1FJGM 4GHLA 3OTOM 2KZSA 5FLXS 3HU2A 3M0EA 1IN6A 2UUBM 3B9PA 3AJIB 4QNMA 3Q8XA 4OX9M 4AKHA 3ZC7B 1R7RA 1IN5A 4B3SM 2D7HA 4FW9A 3C58A 3NBIA 2X4AA 2R65A 4DV4M 3KS8A 5C18A 3KSXA 4QHSA 1PJJA 2G5GX 2ZBKB 3VFDA 2LWXA 5H37D 2D7EA 3J81S 3U61B 4GKKM 2BNKA 2FE8A 5EQTA 1OFIA 4BB9A 5LMNM 2FNAA 4KO8A 3LMMA 2L7IA 3E9SA 5IZ7D 4L15A 2DWMA 1ZAEA 2H1RA 4LJ6A 5FTLA 2F5OA 3EIEA 2RGOA 3K92A 3WHKA 3A42A 3GLFB 3VDUA 2UXDM 4MM3B 2YR0A 5FTKA 3AL0C 1IY0A 4GH9A 4REZA 1GL6A 4WURA 3SFZA 3A46A 2V1UA 2VIIA 3MJ5A 1VDDA 3GQ3A 3A98B 3FTDA 1YUBA 4IJFA 2C5RA 4IBGA 1C1KA 4X64M 4XGIA 2YQZA 1IQPA 4Z8XA 4KHPM 4PCZA 1QAMA 2C9CA 5ITUA 1NNJA 3QAUA 1XXHB 2ZANA 5EP1A 2J7NA 3HKPA 2YNMD 4LF4M 1XHBA 5IWAM 4CHTB 3J2PB 4OVZB 3U60B 1ZQ9A 3TQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3S A;  1HT1 E;  2C96 A;  1D2N A;  3GLH B;  5FTN A;  1SXJ D;  4LJ9 A;  4L16 A;  1KYI A;  1J7K A;  4FWH A;  3DZD A;  4D81 A;  1JR3 D;  3CF2 A;  3HWS A;  2XSZ D;  5DYG A;  2QBY B;  1SXJ B;  5EXP A;  3KDS E;  2QPA A;  2HCB A;  2DHR A;  1IM2 A;  1X37 A;  1G41 A;  1W5S A;  4D82 A;  3HU1 A;  2ZAO A;  1JR3 A;  1HQY E;  3MHV C;  3GLG A;  2DZO B;  1HT2 E;  2C9O A;  3D8B A;  3HU3 A;  3U5Z B;  3GLI A;  5EP3 A;  1QVR A;  4ZPX A;  3CF0 A;  1NJG A;  1NY5 A;  1IN8 A;  3K1J A;  5EXX A;  3H4M A;  4LRS A;  4QHT A;  3SYL A;  3WHL A;  1IXR C;  4A3V B;  4D80 A;  2Z4R A;  4GIT A;  4LJ7 A;  4LGM A;  1SXJ E;  4WW0 A;  3PXG A;  4FD2 A;  4I81 A;  5C1B A;  2X8A A;  5EXS A;  1NJF A;  2BJW A;  4LCB A;  1NY6 A;  2CHG A;  2CE7 A;  3PVS A;  1DO2 A;  2R62 A;  3R8F A;  2BJV A;  3HU2 A;  1OJL A;  1IN6 A;  3M0E A;  3ZH9 B;  3B9P A;  3AJI B;  1XWI A;  2QEN A;  5FTM A;  3GLF A;  2CHV A;  4QNM A;  3GLG B;  1R7R A;  1IN5 A;  4LY6 A;  4FW9 A;  3GLI B;  1OFH A;  4FWG A;  4LZZ A;  1G4A E;  2R65 A;  4LJ4 A;  1FNN A;  3UK6 A;  2DZN B;  5EP4 A;  5C18 A;  4QHS A;  1R6B X;  4QOS A;  1L8Q A;  3VFD A;  2CHQ A;  3U61 B;  5JI2 E;  5JI3 E;  2QZ4 A;  5EXT A;  5EQT A;  1E94 E;  1UM8 A;  4LJ5 A;  1OFI A;  3SC3 A;  2FNA A;  1IN7 A;  4KO8 A;  2V6Z M;  1XXH A;  4QNR A;  4LJ8 A;  1KSF X;  1LV7 A;  4LRT A;  4L15 A;  1NVM A;  4EIW A;  4LJ6 A;  5FTL A;  3EIE A;  3M6A A;  3WHK A;  1W5T A;  3VLF B;  4KLN A;  3GLF B;  3PFI A;  5DYI A;  1G3I A;  2KRK A;  2RKO A;  5FTK A;  1DO0 A;  4FCW A;  1IY0 A;  5FTJ A;  1E32 A;  3GLH A;  2V1U A;  2ZAM A;  2CEA A;  2VII A;  2DVW B;  4KOD A;  4FCV A;  1IXS B;  2QBY A;  1SXJ A;  1IN4 A;  3EIH A;  4FCT A;  1C1K A;  4I4L A;  2Z4S A;  1QZM A;  1HQC A;  1IQP A;  2C99 A;  3KW6 A;  4JN6 A;  1SXJ C;  4Z8X A;  2XSZ A;  2C9C A;  1XXH B;  2ZAN A;  2DWZ B;  2QP9 X;  5EP1 A;  1IXZ A;  5EP2 A;  3BOS A;  3SYK A;  1NSF A;  4LJA A;  2C98 A;  1IY2 A;  4FWD A;  3U60 B;  4L4U A;  1JQJ C;  1IY1 A; 
#chains in the Genus database with same CATH topology
 1YCN A;  1ALA A;  1AVC A;  1OQY A;  1HT1 E;  2KRU A;  3SAT A;  1N78 A;  2O25 A;  2QQ8 A;  4IBB A;  3GLH B;  4LGY A;  5FTN A;  5ITQ A;  3K9O A;  2FOI C;  3THG A;  1TGU A;  4DR7 M;  3KOY E;  4FWH A;  3FRI A;  3HJL A;  3ABO A;  2R0I A;  4XK8 F;  1QUT A;  1XB2 B;  3FUV A;  3SMS A;  3FTE A;  1Z5C A;  2QBY B;  1QZE A;  1XSZ A;  4AI6 A;  1LTM A;  2DZL A;  1IM2 A;  2HKJ A;  1X37 A;  1G41 A;  5E26 A;  3L25 A;  2HAK A;  3PNV A;  3HU3 A;  3TW5 A;  1C7Y A;  1J09 A;  1K3X A;  4GIP A;  1G71 A;  2O01 F;  3K2L A;  1NY5 A;  1OIZ A;  3VKH A;  1DGF A;  4OW0 A;  2F5P A;  3UJN A;  3K1J A;  2F5N A;  4JYA M;  1Q8D A;  4OIY A;  1D0L A;  5ITX A;  1IBL M;  3VKG A;  4GEW A;  4DV6 M;  2Y0Q A;  3KOZ E;  3L27 A;  4L78 A;  2DXI A;  4JV5 M;  4D80 A;  2Z4R A;  4GIT A;  3U61 A;  4LJ7 A;  3U6Q A;  1GJS A;  5KPZ A;  4II7 A;  4R7G A;  1SXJ E;  3FYD A;  2IE6 A;  2L6O A;  4MGY E;  2DWN A;  1S9D E;  4JMO A;  2BJW A;  1DGH B;  2CHG A;  2DAG A;  4M9Z A;  4G4R A;  4LF5 M;  2HYU A;  3PVS A;  4ANR A;  1QDT A;  1E9R A;  2XGN A;  3ZQJ A;  3CTW B;  3FUW A;  5FTM A;  3LQQ A;  2CHV A;  2M5Z A;  3GLF A;  1YGM A;  3AOE A;  3L28 A;  4LY6 A;  4MH0 E;  3GPU A;  2V1C A;  3C9P A;  3GLI B;  1V33 A;  1OKS A;  3IG8 A;  3T38 A;  4DR5 M;  4JI6 M;  4HRE A;  3LCU A;  3IEC A;  4I5S A;  2EKF A;  1Z6T A;  2K9D A;  3NWL A;  4GRI A;  3GPX A;  3SAU A;  3J27 B;  4HEO A;  5EP4 A;  2RAN A;  4Y28 F;  4DUY M;  2F5S A;  2UUC M;  1Q3B A;  1TF0 B;  3L29 A;  1R2Z A;  2ZTC A;  1Z5B A;  3I51 A;  1PRB A;  4JI3 M;  3TPZ A;  4D7Q A;  1I4W A;  2HL7 A;  4M9S A;  2H0L A;  1TDH A;  2I7P A;  4CJ6 A;  3AKZ A;  4DR1 M;  3HHZ A;  4JI2 M;  2V6Z M;  4DR2 M;  1XXH A;  3GLG E;  3HJS A;  4QNR A;  1LV7 A;  1OIP A;  2XF3 A;  2KW0 A;  4EIW A;  4YY3 M;  4LF6 M;  2OO9 A;  1HNZ M;  2OPF A;  4KLN A;  4OVZ A;  2UXC M;  5DYI A;  3U60 A;  1BC0 A;  1K82 A;  3SAS A;  1G3I A;  2RKO A;  4IBJ A;  1DO0 A;  3RE8 A;  1QAN A;  2YFQ A;  3HHX A;  2R18 A;  3T1Y M;  1L1T A;  2J5Y A;  3GLH A;  1BCY A;  2HYW A;  4HL4 A;  4DV0 M;  3QYE A;  1OTR A;  2DVW B;  5ITY A;  4IBI A;  3J7B A;  2XZU A;  2BWE A;  4NRV A;  2VQE M;  4G4N A;  4JI4 M;  4JXH A;  2QBY A;  2ZM6 M;  3EIH A;  4FCT A;  4P17 A;  3AOG A;  2L2D A;  5FSW A;  3U6P A;  4GHA A;  1TH2 A;  2C99 A;  2QNJ A;  4NL4 H;  4X66 M;  2Z8Y M;  1N34 M;  1GAB A;  4IBC A;  4LF9 M;  2Y21 A;  4R3D A;  5EP2 A;  1UFZ A;  5E6J A;  2JZ0 A;  2JXN A;  2MRO B;  3RGP A;  4LJA A;  2C98 A;  1VG5 A;  1E9S A;  1HVE A;  3KP1 E;  4IBF A;  4DV7 M;  1AEI A;  1NV9 A;  4MGH A;  2F5Q A;  4B3M M;  2WSE F;  2UUA M;  4D7R A;  2LNH C;  3RGS A;  3SHG B;  2CV0 A;  4B3T M;  1DGH A;  3DZD A;  3LQR A;  3HHW A;  2DAM A;  5F3W A;  4LF8 M;  1CUK A;  1Q3C A;  1XNR M;  3SAV A;  2VDB B;  1UPT B;  1SG9 A;  1SXJ B;  1HM6 A;  4MGZ E;  2DHR A;  4JI1 M;  1MX0 A;  1W5S A;  4D82 A;  2ZAO A;  2DEN A;  2JY7 A;  3GO8 A;  2UU9 M;  2DZO B;  3R9X B;  4C0A A;  3VK7 A;  3LCV B;  2L7H A;  5EP3 A;  1QVR A;  3GLI A;  4JXJ A;  3MMP A;  4ZPX A;  3ZCB B;  4JI5 M;  1W3W A;  2VXG A;  4FHR B;  3USY A;  5KQ8 A;  4RF0 A;  2KNA A;  2LVQ D;  1IN8 A;  4KMU X;  2B3T A;  2F4V M;  3ABQ A;  1IXR C;  4A3V B;  3LTL A;  1N36 M;  3FRH A;  3KXE C;  3T15 A;  1QDR A;  2K6B A;  4NSO B;  4G4Q A;  2Y20 A;  3SHF A;  4WW0 A;  2GQF A;  3D8L A;  2VQF M;  1T43 A;  4FD2 A;  4I81 A;  1YII A;  2J7O A;  3A45 A;  2D7G A;  4AZF A;  4LCB A;  1N41 A;  1RU3 A;  2CE7 A;  3K9P A;  1G8P A;  1YE9 A;  1ZMW A;  1WIV A;  2OY9 A;  1EFU B;  2LVP C;  1A5T A;  2R62 A;  2UXB M;  2A5Y B;  3ZH9 B;  4HLQ A;  1OJL A;  5GKN A;  5DNY A;  2Z7J A;  1AXN A;  2QEN A;  4X62 M;  4S12 A;  3I4Y A;  4DBG B;  3GLG B;  2EUC A;  5KQD A;  3B7N A;  1DM5 A;  2EO2 A;  3UGJ A;  1TDZ A;  2HYV A;  3QWL A;  4LZZ A;  4AKI A;  4DV3 M;  2WSC F;  3T1H M;  3SMP A;  1Z59 A;  3AOE C;  4LJ4 A;  3GQ4 A;  1FNN A;  1BC1 A;  3U6D A;  3U6E A;  3UK6 A;  4M0W A;  1AII A;  3TWM A;  4YHH M;  1R6B X;  1ORY B;  4QOS A;  4BLC A;  4G4O A;  2H5X A;  7CAT A;  3FYC A;  2CHQ A;  4JI8 M;  1GO5 A;  3BBZ A;  1N75 A;  3LVW A;  5DFL A;  5JI2 E;  2HWJ A;  2QZ4 A;  2DAE A;  1ZMU A;  2Q2E B;  3J80 S;  4AQY M;  4NXM M;  1E94 E;  1UM8 A;  2DNA A;  2II2 A;  1KFV A;  1IN7 A;  1WXQ A;  4W5W A;  1L2C A;  1JR3 E;  2EJS A;  1NO1 A;  3USW A;  4Z6Y A;  4LRT A;  2OQ4 A;  2FS1 A;  1NVM A;  3IG5 A;  3GPP A;  2JY8 A;  4ITQ A;  3GRV A;  1XJL A;  3ABR A;  2O5R A;  1R5L A;  2KNZ A;  3VLF B;  1MCX A;  3PFI A;  1NHG C;  1Q02 A;  1Z5A A;  1WR1 B;  3NBX X;  5FTJ A;  1E32 A;  1W45 A;  1XMO M;  4GKJ M;  3BXW A;  1PGY A;  3IHP A;  2CUZ A;  2ZAM A;  2KA6 B;  1TH3 A;  1R4G A;  4Q2S A;  3SWV A;  3KSJ A;  2APL A;  1EE8 A;  4L6V 6;  3W0L B;  1SXJ A;  1WGN A;  4G6Z A;  1IN4 A;  3HJQ A;  4B08 A;  1XMQ M;  2Z4S A;  4LFC M;  1N44 A;  3FKE A;  2MJ5 B;  3KP0 E;  2MR9 A;  1VEK A;  4Z21 A;  2KZU A;  3ILK A;  2VF8 A;  3VDP A;  2JUJ A;  4PD2 A;  1EIJ A;  2AHM A;  1R2Y A;  1AVH A;  2DWZ B;  4IBK A;  4NSR A;  4JK1 X;  5ITR A;  1R8S E;  1DV0 A;  4M9X A;  3BOS A;  1GKI A;  2R45 A;  3FUX A;  3SYK A;  3VK8 A;  4DV1 M;  1PJT A;  4BBA A;  3KOW E;  3KVW A;  1IY2 A;  2MGW A;  1LKV X;  4IBE A;  1V92 A;  1IY1 A;  2ZOC A;  3BRX A;  2P5T A;  1S3S A;  5A2Q S;  1QQW A;  4LZJ A;  1D2N A;  2G8L A;  3HX3 A;  2XLJ A;  1SXJ D;  1H6U A;  4LJ9 A;  2E5L M;  4NRW A;  2Y0T A;  1J7K A;  3PNY A;  4MB7 A;  4F1I A;  5LMU M;  3SBJ A;  2DWL A;  2OOA A;  4DV2 M;  4DR3 M;  1DK5 A;  4WP2 A;  4D81 A;  1BC9 A;  1JR3 D;  3CF2 A;  3HWS A;  5DYG A;  3RFW A;  3GP1 A;  1NHW C;  3HY5 A;  1HR0 M;  4CIS A;  2K47 A;  1F4I A;  1DGB A;  4B7G A;  1IFY A;  4DR6 M;  2JNH A;  1TTE A;  4LFA M;  3GLG A;  3MHV C;  3U5Z B;  2MH8 A;  1M9I A;  2JP7 A;  3GRU A;  3W68 A;  4NOO B;  3CF0 A;  1QYR A;  2L09 A;  2QHO B;  1PBV A;  3JR4 A;  3DFZ A;  4NC6 A;  2L4F A;  5IT9 S;  5EXX A;  2H0K A;  2EKK A;  3M7G A;  4LRS A;  3JAM S;  3LVV A;  3U6O A;  1GVN A;  2KDL A;  2XZF A;  1NNU C;  2LHG A;  1ZMV A;  2KEB A;  1N77 A;  1BO9 A;  3AJC A;  2H0M A;  3QYB A;  4PDI A;  3HZJ A;  4L5M A;  4LF7 M;  3PXG A;  4PDG A;  1G59 A;  3FD9 A;  2ZHI A;  2CWB A;  1NJF A;  1TH4 A;  3TL4 X;  3GPY A;  1NY6 A;  1WJ7 A;  2JY5 A;  2LHC A;  4GC5 A;  1DO2 A;  3FTC A;  4GC9 A;  3B89 A;  5KPT A;  3R8F A;  2BJV A;  1G5N A;  1R8Q E;  4JMI A;  1XWI A;  3HJ8 A;  2RGH A;  3W67 A;  1QAQ A;  3Q8G A;  1IBK M;  2CV1 A;  3I4V A;  1L1Z A;  2DKL A;  3FTF A;  3KFU G;  1OFH A;  4FWG A;  1G4A E;  3L26 A;  4OU7 A;  1BCZ A;  4IJE A;  4A4P A;  4LFB M;  1GL7 A;  2DZN B;  4MDV A;  4IBD A;  2CP8 A;  2CFO A;  2G3Q A;  2K0B X;  5EJC A;  3KS4 A;  1L8Q A;  2LVA A;  4FVM A;  1AUA A;  2LH0 A;  1QC7 A;  3K8Z A;  3U6C A;  5JI3 E;  3I04 M;  5EXT A;  1K3W A;  1AVR A;  1W7B A;  4LJ5 A;  2LBC A;  2LVN C;  4R71 A;  3SC3 A;  1VEG A;  5BR8 M;  2EA0 A;  2JZ1 A;  4NXN M;  2LVO C;  1PJS A;  8CAT A;  4JWL A;  1R4A E;  2HHH M;  4LJ8 A;  1KSF X;  1L2B A;  3C3D A;  2R4E A;  3L2A A;  4TUW A;  1T3T A;  4B3R M;  3M6A A;  4IIW A;  1W5T A;  1J5E M;  1ZV1 A;  3SAR A;  4AKG A;  1ANX A;  2I7N A;  4JI0 M;  1I94 M;  3ANY A;  1XC8 A;  4MGK E;  1PJI A;  2KRK A;  5ITX E;  4QOZ C;  5KPR A;  4FCW A;  5IRE B;  2KHH A;  2XFS A;  1XNQ M;  2CEA A;  3CF6 E;  4AG5 A;  4FQ0 C;  2FH0 A;  3F92 A;  2ERC A;  2X49 A;  1N33 M;  4KOD A;  1HJP A;  1YSY A;  1AIP C;  3E46 A;  4FCV A;  1IXS B;  3HHY A;  2CV2 A;  4EVH A;  1WHC A;  5KO3 A;  4I4L A;  2Q4C A;  4XBO A;  4AW4 A;  3FUT A;  1QZM A;  3UMM A;  3AFH A;  1HQC A;  1L2D A;  2XH9 A;  3ABS A;  3KW6 A;  4JN6 A;  1DGG A;  3UZU A;  1SXJ C;  3U5Z A;  1IBM M;  2DAK A;  2XSZ A;  1Q39 A;  1MN3 A;  3E4R A;  3GLF E;  3U6S A;  4GMQ A;  1AOW A;  1BC3 A;  4L8R C;  2QP9 X;  2OOB A;  3T6P A;  1IXZ A;  5BPV A;  2NQ8 C;  1RE0 B;  1A8A A;  2DAI A;  1BVS A;  2KXE A;  3FUU A;  3JR5 A;  1NSF A;  2R46 A;  1D0K A;  4FWD A;  4X9P A;  4L4U A;  1JQJ C;  3E21 A;  2JWS A;  4M0D A;  2QSF X;  4B7F A;  3KOX E;  2C96 A;  4B7H A;  2R4J A;  4X65 M;  1XT0 B;  3GRR A;  1ANW A;  4L16 A;  1KYI A;  4DR4 M;  4K0K M;  3LW5 F;  2M60 A;  1PM5 A;  3DA1 A;  4AG6 A;  1V34 A;  1PJQ A;  3SAW A;  3TWL A;  1MU5 A;  2XSZ D;  3SOH B;  1XXH E;  5EXP A;  3KDS E;  2QPA A;  2HCB A;  4RNA A;  1Y8G A;  2WZJ A;  4JI7 M;  1HNW M;  2JY6 B;  3MK6 A;  3HU1 A;  5L8R F;  1JR3 A;  1HQY E;  4G3O A;  4RF1 A;  1HT2 E;  2C9O A;  3D8B A;  2XFT A;  3HGI A;  4OVZ B;  1I4A A;  4I8O A;  3W0F A;  4PT5 A;  2FFJ A;  1P3Q Q;  1NJG A;  1YLA A;  3U6L A;  2W82 A;  3J7A S;  1KU1 A;  4CIZ A;  2JA2 A;  1HNX M;  3V76 A;  3GLH E;  3DOA A;  3H4M A;  2XO2 A;  3TE6 A;  1QAO A;  4P16 A;  4QHT A;  3SYL A;  3WHL A;  2K6X A;  1GLN A;  2XEP A;  3TWK A;  4DV5 M;  1HVF A;  2QCU A;  4MGI E;  1TR8 A;  2WSF F;  5ITT A;  2Z3X A;  2LXE A;  4LGM A;  4LG2 A;  1A8B A;  4RKU F;  4DUZ M;  3GRY A;  2DHY A;  5C1B A;  4CGY B;  4C7P A;  2X8A A;  5EXS A;  3U6M A;  4UN2 B;  3GQ5 A;  3AV0 A;  1FJG M;  4F2L A;  4GHL A;  3OTO M;  2KZS A;  2R0D A;  4KN7 X;  5FLX S;  3HU2 A;  3M0E A;  1JB0 F;  1IN6 A;  2UUB M;  3B9P A;  3AJI B;  1HAK A;  4KT0 F;  2GNO A;  4QNM A;  3Q8X A;  4KN4 X;  4OX9 M;  4AKH A;  3ZC7 B;  1R7R A;  1IN5 A;  1N00 A;  4B3S M;  2D7H A;  4FW9 A;  1GJT A;  3C58 A;  3NBI A;  1D0M A;  2R6F A;  2X4A A;  2R65 A;  4DV4 M;  3KS8 A;  2KNV A;  5C18 A;  4Q7J A;  3KSX A;  4QHS A;  1OAI A;  1PJJ A;  2G5G X;  1NV8 A;  1QUS A;  1IXS A;  2ZBK B;  3VFD A;  3I01 M;  2QEZ A;  4MDU A;  2LWX A;  1VDL A;  5H37 D;  2CRU A;  2D7E A;  3J81 S;  2BWB A;  3U61 B;  4GKK M;  2BNK A;  2FE8 A;  1N32 M;  1HVD A;  5EQT A;  1OFI A;  3B74 A;  4BB9 A;  5LMN M;  2FNA A;  4KO8 A;  1R8M E;  3LMM A;  2DI0 A;  2L7I A;  3E9S A;  2VF7 A;  3H4J A;  5IZ7 D;  3GLI E;  4L15 A;  2DWM A;  2LTU A;  1ZAE A;  2H1R A;  4EVF A;  4LJ6 A;  5FTL A;  2F5O A;  3EIE A;  2ZHJ A;  2RGO A;  2IE7 A;  3K92 A;  3WHK A;  3L8N A;  2RRU A;  3A42 A;  1BCW A;  3GLF B;  3VDU A;  2UXD M;  4MM3 B;  2YR0 A;  5FTK A;  3AL0 C;  1IY0 A;  3B7Q A;  4GH9 A;  4REZ A;  1GL6 A;  4WUR A;  3SFZ A;  1ANN A;  3A46 A;  2V1U A;  2VII A;  2IIC A;  3MJ5 A;  1VDD A;  1HVG A;  1VEJ A;  2N35 A;  3FE3 A;  3A98 B;  3GQ3 A;  2R44 A;  3FTD A;  1YUB A;  4IJF A;  2XO3 A;  1SAV A;  2C5R A;  3CGW A;  1T6O A;  4IBG A;  1C1K A;  1VQ1 A;  4X64 M;  4XGI A;  2YQZ A;  2HSN A;  3AO0 A;  1IQP A;  4Z8X A;  4KHP M;  1MJG M;  4PCZ A;  1QAM A;  2C9C A;  5ITU A;  1NNJ A;  1YJ0 A;  3QAU A;  1N42 A;  3B7Z A;  1XXH B;  2ZAN A;  5EP1 A;  2J7N A;  3HKP A;  2YNM D;  4LF4 M;  1XHB A;  5IWA M;  2ZTD A;  1OAO C;  3C3E A;  4CHT B;  2R09 A;  2L4E A;  3J2P B;  1WGL A;  3U60 B;  1ZQ9 A;  3TQS A; 
#chains in the Genus database with same CATH homology
 1HT1 E;  2KRU A;  3SAT A;  1N78 A;  4IBB A;  3GLH B;  4LGY A;  5FTN A;  5ITQ A;  4DR7 M;  2FOI C;  3THG A;  1TGU A;  3KOY E;  4FWH A;  3SMS A;  3FUV A;  3FTE A;  1Z5C A;  2QBY B;  4AI6 A;  2HKJ A;  1IM2 A;  5E26 A;  1X37 A;  1G41 A;  3L25 A;  3PNV A;  3HU3 A;  1J09 A;  1K3X A;  4GIP A;  3K2L A;  1NY5 A;  3VKH A;  1DGF A;  4OW0 A;  2F5P A;  3UJN A;  3K1J A;  2F5N A;  4JYA M;  5ITX A;  1IBL M;  3VKG A;  4DV6 M;  2Y0Q A;  3KOZ E;  3L27 A;  4L78 A;  2DXI A;  4JV5 M;  4D80 A;  2Z4R A;  4GIT A;  3U61 A;  4LJ7 A;  3U6Q A;  5KPZ A;  4II7 A;  4R7G A;  1SXJ E;  3FYD A;  2L6O A;  4MGY E;  2DWN A;  2BJW A;  1DGH B;  2CHG A;  4G4R A;  4M9Z A;  4LF5 M;  3PVS A;  1E9R A;  2XGN A;  3CTW B;  3FUW A;  5FTM A;  3LQQ A;  2CHV A;  2M5Z A;  3GLF A;  3AOE A;  3L28 A;  4LY6 A;  4MH0 E;  3GPU A;  2V1C A;  3GLI B;  4JI6 M;  3IG8 A;  3T38 A;  4DR5 M;  4I5S A;  1Z6T A;  3NWL A;  4GRI A;  3GPX A;  3SAU A;  3J27 B;  5EP4 A;  4DUY M;  2F5S A;  2UUC M;  1Q3B A;  3L29 A;  1R2Z A;  1Z5B A;  3I51 A;  4JI3 M;  3TPZ A;  1I4W A;  2HL7 A;  4M9S A;  1TDH A;  2I7P A;  3AKZ A;  4DR1 M;  3HHZ A;  4JI2 M;  2V6Z M;  4DR2 M;  1XXH A;  3HJS A;  4QNR A;  1LV7 A;  2XF3 A;  2KW0 A;  4EIW A;  4YY3 M;  4LF6 M;  1HNZ M;  2OPF A;  4KLN A;  4OVZ A;  2UXC M;  5DYI A;  3U60 A;  1K82 A;  3SAS A;  1G3I A;  2RKO A;  4IBJ A;  1DO0 A;  3RE8 A;  1QAN A;  2YFQ A;  3HHX A;  2R18 A;  3T1Y M;  1L1T A;  3GLH A;  1N32 M;  4HL4 A;  4DV0 M;  5ITY A;  2DVW B;  4IBI A;  3J7B A;  2XZU A;  4NRV A;  2VQE M;  4G4N A;  4JI4 M;  2QBY A;  2ZM6 M;  3EIH A;  4FCT A;  3AOG A;  5FSW A;  3U6P A;  4GHA A;  1TH2 A;  2C99 A;  4NL4 H;  4X66 M;  1N34 M;  4IBC A;  4LF9 M;  2Y21 A;  4R3D A;  5EP2 A;  5E6J A;  3RGP A;  4LJA A;  2C98 A;  1E9S A;  3KP1 E;  4IBF A;  4DV7 M;  2F5Q A;  4MGH A;  4B3M M;  2UUA M;  2LNH C;  3RGS A;  3SHG B;  2CV0 A;  4B3T M;  1DGH A;  3DZD A;  3LQR A;  3HHW A;  5F3W A;  4LF8 M;  1Q3C A;  1XNR M;  3SAV A;  1SXJ B;  4MGZ E;  2DHR A;  4JI1 M;  1MX0 A;  1W5S A;  4D82 A;  2ZAO A;  3GO8 A;  2UU9 M;  3R9X B;  2DZO B;  3VK7 A;  3GLI A;  2L7H A;  5EP3 A;  1QVR A;  4JXJ A;  4ZPX A;  3ZCB B;  4JI5 M;  5KQ8 A;  4RF0 A;  1IN8 A;  2F4V M;  1IXR C;  4A3V B;  1N36 M;  3KXE C;  3T15 A;  4NSO B;  4G4Q A;  2Y20 A;  3SHF A;  4WW0 A;  3D8L A;  2VQF M;  4FD2 A;  4I81 A;  2J7O A;  3A45 A;  2D7G A;  4AZF A;  4LCB A;  2CE7 A;  1G8P A;  1YE9 A;  2R62 A;  2UXB M;  2A5Y B;  3ZH9 B;  4HLQ A;  1OJL A;  5GKN A;  5DNY A;  2Z7J A;  2QEN A;  4X62 M;  4S12 A;  3I4Y A;  3GLG B;  2EUC A;  5KQD A;  2EO2 A;  3UGJ A;  1TDZ A;  3QWL A;  4LZZ A;  4AKI A;  4DV3 M;  3T1H M;  3SMP A;  1Z59 A;  3AOE C;  4LJ4 A;  3GQ4 A;  1FNN A;  3U6D A;  3U6E A;  3UK6 A;  4M0W A;  3TWM A;  4YHH M;  1R6B X;  1ORY B;  4QOS A;  4BLC A;  4G4O A;  7CAT A;  3FYC A;  2CHQ A;  4JI8 M;  1N75 A;  3LVW A;  5JI2 E;  2QZ4 A;  2Q2E B;  3J80 S;  4AQY M;  4NXM M;  1E94 E;  1UM8 A;  1KFV A;  1IN7 A;  1WXQ A;  4W5W A;  1L2C A;  4Z6Y A;  4LRT A;  2OQ4 A;  1NVM A;  3IG5 A;  3GPP A;  4ITQ A;  3GRV A;  2O5R A;  3VLF B;  3PFI A;  1NHG C;  1Z5A A;  5FTJ A;  1E32 A;  1XMO M;  4GKJ M;  2CUZ A;  2ZAM A;  2KA6 B;  1TH3 A;  3KSJ A;  1EE8 A;  3W0L B;  1SXJ A;  4G6Z A;  4B08 A;  1IN4 A;  3HJQ A;  1XMQ M;  2Z4S A;  4LFC M;  3FKE A;  3KP0 E;  2KZU A;  3ILK A;  3VDP A;  4PD2 A;  2AHM A;  1R2Y A;  2DWZ B;  4IBK A;  4NSR A;  5ITR A;  4M9X A;  3BOS A;  1GKI A;  2R45 A;  3FUX A;  3SYK A;  3VK8 A;  4DV1 M;  4BBA A;  3KOW E;  3KVW A;  1IY2 A;  4IBE A;  1IY1 A;  2P5T A;  1S3S A;  5A2Q S;  1QQW A;  4LZJ A;  1D2N A;  2G8L A;  2XLJ A;  2E5L M;  1SXJ D;  1H6U A;  4LJ9 A;  4NRW A;  2Y0T A;  1J7K A;  3PNY A;  4MB7 A;  3SBJ A;  5LMU M;  2DWL A;  4DR3 M;  4DV2 M;  4D81 A;  1JR3 D;  3CF2 A;  3HWS A;  5DYG A;  3RFW A;  3GP1 A;  1NHW C;  1HR0 M;  4CIS A;  2K47 A;  1DGB A;  4B7G A;  4DR6 M;  4LFA M;  3GLG A;  3MHV C;  3U5Z B;  3GRU A;  4NOO B;  3CF0 A;  1QYR A;  2L09 A;  3JR4 A;  3DFZ A;  5IT9 S;  5EXX A;  3M7G A;  4LRS A;  3JAM S;  3LVV A;  3U6O A;  1GVN A;  2XZF A;  1NNU C;  2KEB A;  1N77 A;  4PDI A;  4LF7 M;  3PXG A;  4PDG A;  1G59 A;  3FD9 A;  1NJF A;  1TH4 A;  3TL4 X;  3GPY A;  1NY6 A;  4GC5 A;  1DO2 A;  3FTC A;  4GC9 A;  5KPT A;  3R8F A;  2BJV A;  1XWI A;  3HJ8 A;  2RGH A;  1QAQ A;  1IBK M;  2CV1 A;  3I4V A;  1L1Z A;  3FTF A;  3KFU G;  1OFH A;  4FWG A;  1G4A E;  3L26 A;  4OU7 A;  4IJE A;  4LFB M;  1GL7 A;  2DZN B;  4IBD A;  5EJC A;  2CFO A;  3KS4 A;  1L8Q A;  4FVM A;  2LH0 A;  3K8Z A;  3U6C A;  5JI3 E;  5EXT A;  1K3W A;  4LJ5 A;  3SC3 A;  5BR8 M;  2EA0 A;  4NXN M;  8CAT A;  2HHH M;  4LJ8 A;  1KSF X;  1L2B A;  3L2A A;  2R4E A;  4TUW A;  1T3T A;  4B3R M;  3M6A A;  4IIW A;  1W5T A;  1J5E M;  3SAR A;  4AKG A;  2I7N A;  4JI0 M;  1I94 M;  1XC8 A;  4MGK E;  1PJI A;  2KRK A;  5ITX E;  4QOZ C;  5KPR A;  4FCW A;  5IRE B;  2XFS A;  1XNQ M;  2CEA A;  3CF6 E;  4AG5 A;  2ERC A;  2X49 A;  1N33 M;  4KOD A;  1YSY A;  3HHY A;  2CV2 A;  4FCV A;  1IXS B;  5KO3 A;  4I4L A;  4XBO A;  4AW4 A;  3FUT A;  1QZM A;  3UMM A;  3AFH A;  1HQC A;  1L2D A;  2XH9 A;  3KW6 A;  4JN6 A;  1DGG A;  3UZU A;  1SXJ C;  3U5Z A;  1IBM M;  2XSZ A;  1Q39 A;  3E4R A;  3U6S A;  4GMQ A;  4L8R C;  2QP9 X;  1IXZ A;  5BPV A;  2NQ8 C;  2KXE A;  3FUU A;  3JR5 A;  1NSF A;  2R46 A;  4FWD A;  4L4U A;  1JQJ C;  4M0D A;  4B7F A;  3KOX E;  2C96 A;  4B7H A;  2R4J A;  4X65 M;  3GRR A;  4L16 A;  1KYI A;  4DR4 M;  4K0K M;  2M60 A;  1PM5 A;  3DA1 A;  4AG6 A;  3SAW A;  3TWL A;  1MU5 A;  2XSZ D;  5EXP A;  3KDS E;  2QPA A;  2HCB A;  4RNA A;  1HNW M;  4JI7 M;  3MK6 A;  3HU1 A;  1JR3 A;  1HQY E;  4RF1 A;  1HT2 E;  2C9O A;  3D8B A;  2XFT A;  3HGI A;  4I8O A;  3W0F A;  4PT5 A;  2FFJ A;  1NJG A;  3U6L A;  2W82 A;  3J7A S;  2JA2 A;  1HNX M;  3DOA A;  3H4M A;  3TE6 A;  1QAO A;  4P16 A;  4QHT A;  3SYL A;  3WHL A;  1GLN A;  2XEP A;  3TWK A;  4DV5 M;  2QCU A;  4MGI E;  5ITT A;  2Z3X A;  2LXE A;  4LGM A;  4LG2 A;  4DUZ M;  3GRY A;  5C1B A;  4CGY B;  2X8A A;  5EXS A;  3U6M A;  3GQ5 A;  3AV0 A;  1FJG M;  4GHL A;  3OTO M;  2KZS A;  5FLX S;  3HU2 A;  3M0E A;  1IN6 A;  2UUB M;  3B9P A;  3AJI B;  4QNM A;  3Q8X A;  4OX9 M;  4AKH A;  3ZC7 B;  1R7R A;  1IN5 A;  4B3S M;  2D7H A;  4FW9 A;  3C58 A;  3NBI A;  2X4A A;  2R65 A;  4DV4 M;  3KS8 A;  5C18 A;  3KSX A;  4QHS A;  1PJJ A;  2G5G X;  2ZBK B;  3VFD A;  2LWX A;  5H37 D;  2D7E A;  3J81 S;  3U61 B;  4GKK M;  2BNK A;  2FE8 A;  5EQT A;  1OFI A;  4BB9 A;  5LMN M;  2FNA A;  4KO8 A;  3LMM A;  2L7I A;  3E9S A;  5IZ7 D;  4L15 A;  2DWM A;  1ZAE A;  2H1R A;  4LJ6 A;  5FTL A;  2F5O A;  3EIE A;  2RGO A;  3K92 A;  3WHK A;  3A42 A;  3GLF B;  3VDU A;  2UXD M;  4MM3 B;  2YR0 A;  5FTK A;  3AL0 C;  1IY0 A;  4GH9 A;  4REZ A;  1GL6 A;  4WUR A;  3SFZ A;  3A46 A;  2V1U A;  2VII A;  3MJ5 A;  1VDD A;  3GQ3 A;  3A98 B;  3FTD A;  1YUB A;  4IJF A;  2C5R A;  4IBG A;  1C1K A;  4X64 M;  4XGI A;  2YQZ A;  1IQP A;  4Z8X A;  4KHP M;  4PCZ A;  1QAM A;  2C9C A;  5ITU A;  1NNJ A;  3QAU A;  1XXH B;  2ZAN A;  5EP1 A;  2J7N A;  3HKP A;  2YNM D;  4LF4 M;  1XHB A;  5IWA M;  4CHT B;  3J2P B;  4OVZ B;  3U60 B;  1ZQ9 A;  3TQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...