1C1KA

Bacteriophage t4 gene 59 helicase assembly protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
MIKLRMPAGGERYIDGKSVYKLYLMIKQHMNGKYDVIKYNWCMRVSDAAYQKRRDKYFFQKLSEKYKLKELALIFISNLVANQDAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIFEYNPKVQSSYIFKLLQSNIISFETFILLDSFLNIIDKHDEQTDNLVWNNYSIKLKAYRKILNIDSQKAKNVFIETVKSCKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPT4 GENE 59 HELICASE ASSEMBLY PROTEIN
publication title Bacteriophage T4 gene 59 helicase assembly protein binds replication fork DNA. The 1.45 A resolution crystal structure reveals a novel alpha-helical two-domain fold.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08993 T4_Gp59_N T4 gene Gp59 loader of gp41 DNA helicase
A PF08994 T4_Gp59_C T4 gene Gp59 loader of gp41 DNA helicase C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1c1kA01
1.10.220.50 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Bacteriophage T4, Gp59, helicase assembly protein, C-terminal domain 1c1kA02
1KYIA 4KODA 1SXJC 1NY5A 2Z4RA 1NJFA 4LRTA 4FW9A 1G3IA 1IQPA 1IY2A 3ZH9B 5EP2A 4JN6A 2HCBA 2ZAOA 1IY1A 2VIIA 4GITA 3GLFA 1R7RA 5EXXA 4D80A 4FCTA 4LJ5A 2QZ4A 5EXSA 3U61B 4LJ4A 3VLFB 1D2NA 2KRKA 3DZDA 4QNRA 2CHVA 2FNAA 1NJGA 5FTNA 4D82A 1SXJE 1XWIA 3H4MA 3SYLA 1G41A 3MHVC 4FWHA 3U60B 3GLHB 2QENA 3PFIA 4FCWA 1JR3D 2C99A 2R65A 5JI3E 1IM2A 4L16A 4LY6A 1LV7A 4LJ7A 4LZZA 5FTLA 2XSZD 2CEAA 4FWGA 5DYGA 4Z8XA 1XXHB 5JI2E 2CHQA 4QHSA 3BOSA 5C18A 3B9PA 4ZPXA 3SC3A 5FTKA 1X37A 1C1KA 1NVMA 2RKOA 1NY6A 2V1UA 1OFIA 2DHRA 1J7KA 4LJ6A 4I4LA 1S3SA 2DZOB 4EIWA 2BJVA 3PXGA 3U5ZB 3VFDA 1IN4A 2QBYB 3GLHA 3HU3A 4FD2A 4L4UA 1IN5A 3PVSA 5FTMA 2ZAMA 1JR3A 3M0EA 4QOSA 5EXTA 3WHKA 1IY0A 2DWZB 5DYIA 3GLGB 1XXHA 1E94E 2R62A 3KW6A 3R8FA 3UK6A 2XSZA 1HT2E 1W5TA 3GLIB 3HWSA 4LRSA 1IN6A 1QVRA 4FCVA 1KSFX 5FTJA 1UM8A 1IXSB 2CE7A 4QNMA 3GLFB 3CF0A 1IN8A 1DO2A 4D81A 2QPAA 1IN7A 4LCBA 3AJIB 5C1BA 2ZANA 3SYKA 3EIEA 1L8QA 3K1JA 2QBYA 2CHGA 3D8BA 5EQTA 1SXJD 1IXRC 1SXJB 2DZNB 1W5SA 2V6ZM 3GLGA 4I81A 1IXZA 2C9CA 1R6BX 1E32A 3WHLA 3GLIA 4LJAA 5EXPA 1DO0A 1FNNA 5EP3A 2QP9X 2C98A 2X8AA 3HU1A 3HU2A 1NSFA 4KLNA 1HQYE 2Z4SA 5EP1A 3KDSE 1HT1E 2C96A 2BJWA 4LGMA 4WW0A 2DVWB 4LJ9A 1JQJC 5EP4A 1QZMA 2C9OA 3EIHA 3CF2A 4KO8A 4QHTA 1OFHA 4FWDA 3M6AA 1G4AE 4L15A 1HQCA 1SXJA 1OJLA 4LJ8A 4A3VB
chains in the Genus database with same CATH superfamily
1KYIA 1QDRA 1TR8A 3ABQA 4JI7M 4EVHA 4L8RC 4GHLA 3GLIE 1T43A 5IT9S 3HGIA 1Z6TA 2VF7A 1T3TA 1ZMVA 4B7FA 4Z6YA 2EUCA 2MROB 1IQPA 1V33A 4B7HA 5EP2A 4JN6A 4XK8F 2ZAOA 4GHAA 2VIIA 3BXWA 2RANA 1R7RA 3RE8A 3A42A 2K0BX 1TH4A 1KFVA 3SAVA 4GKJM 1XSZA 3USYA 3DZDA 5ITRA 4IBCA 1HNXM 2DAIA 2R0DA 1TTEA 1N32M 1XWIA 4GRIA 2I7NA 3H4MA 3NBIA 4MGKE 4R7GA 2XGNA 1DGGA 4OU7A 3IG5A 4FWHA 2OY9A 2XEPA 1Q02A 5E26A 5FLXS 1N34M 3USWA 1QAQA 3JR4A 3PFIA 1XMOM 1N36M 2O25A 2D7HA 2XFSA 3AOEA 4BBAA 3IHPA 4OVZB 3GQ5A 1R4GA 2OOAA 2F4VM 4JMOA 3CF6E 1YSYA 1DGBA 4LFAM 3SMPA 2UXDM 4ITQA 5C18A 2HWJA 3B9PA 4DV3M 3GO8A 4ZPXA 3U6LA 4DV5M 3UGJA 4JI1M 2KNAA 3AJCA 2LVOC 2X49A 1NVMA 3GPPA 1AVRA 1W3WA 1Q39A 2KNZA 4X64M 3KP0E 2HYUA 4MM3B 1NY6A 2V1UA 1ANNA 4MGHA 3TE6A 1IFYA 1GLNA 2XH9A 3QYEA 1QUTA 4L6V6 3PXGA 3U60A 2G8LA 4QOZC 1KU1A 2EKFA 3ABOA 5KO3A 1VDDA 1PRBA 1MU5A 4G4QA 1Z5BA 2Y21A 4EVFA 5FTMA 2ZAMA 3SATA 2Z8YM 4IBIA 2F5QA 1TF0B 2DWZB 3GLGB 2JUJA 1E94E 2R62A 2F5PA 2XSZA 2XZUA 3HWSA 3Q8XA 3GQ3A 1QVRA 3HJLA 4LFCM 4FCVA 5FTJA 4GC9A 2CE7A 3T1YM 1EIJA 2II2A 2QSFX 2ZOCA 2DAKA 4D81A 3U6SA 1QAOA 1A5TA 3DA1A 4RNAA 2JXNA 3KS4A 1E9RA 2I7PA 3J27B 3SYKA 4UN2B 3U5ZA 1DGFA 4W5WA 3ZCBB 3B7NA 5EQTA 3U6OA 4C0AA 1HJPA 4RF0A 5IWAM 1XNQM 1UPTB 1W45A 3QYBA 4JXHA 1SXJB 2XF3A 2ZTCA 2DZNB 3THGA 1W5SA 2XO2A 1K82A 2C9CA 1R6BX 4LJAA 2HKJA 1L2CA 1PJTA 2R4JA 2JY7A 4IBBA 3SASA 3J7AS 4JI2M 3IECA 3ZC7B 1K3WA 2K47A 3FYCA 2QP9X 2C98A 2X8AA 4AW4A 3HU1A 1IXSA 3HU2A 1VG5A 2C96A 2L4EA 2BJWA 2YNMD 3FRHA 2DAEA 1VEGA 3W67A 2CP8A 2L7IA 4XGIA 4IIWA 5LMNM 3FTCA 2C9OA 3BBZA 1VEJA 4KO8A 1A8AA 2ZTDA 1IBLM 3L26A 3C58A 4DR4M 4AKHA 3K9OA 1QANA 1NO1A 1GABA 4Q2SA 2MGWA 4LG2A 1OKSA 1QZEA 2R44A 2E5LM 1OJLA 2P5TA 1M9IA 1SAVA 4MGIE 1YJ0A 3M7GA 3TWKA 4DV2M 1GO5A 1NY5A 4LRTA 4JYAM 3LMMA 4I8OA 3UMMA 2HYVA 1XT0B 4C7PA 2EJSA 2W82A 1G3IA 1ZAEA 2CV2A 3T1HM 3W0LB 2L7HA 3FUUA 1NHGC 5H37D 1BC9A 2JA2A 2ERCA 2WSCF 3GLFA 1XJLA 5EXXA 2CV1A 2CWBA 4HEOA 3B89A 2KNVA 3U6EA 4B08A 4DR6M 1OAIA 4FCTA 4GEWA 1LTMA 2DNAA 2DWMA 3B7ZA 2K6XA 4AI6A 1D2NA 1DGHA 2KRKA 2M5ZA 1I4AA 1NHWC 2FNAA 1NJGA 5FTNA 3GPUA 2Z7JA 2X4AA 2KHHA 3K8ZA 1HVEA 1PGYA 4DUYM 3AOGA 1ORYB 3U6QA 1ANWA 1BCWA 3PNYA 3Q8GA 1YCNA 3AV0A 2R4EA 4REZA 4DV4M 2DAMA 4YHHM 5KPRA 1N00A 3GLHB 1XNRM 2HYWA 2IICA 4JK1X 4FCWA 2C99A 2C5RA 3FRIA 1ZV1A 1IM2A 4L16A 2LNHC 1LV7A 3FD9A 4LJ7A 2APLA 4M0WA 4LY6A 5ITTA 2XSZD 2UU9M 4Z8XA 1XXHB 2HL7A 2CHQA 3GLFE 2IE6A 4AKIA 2CRUA 2FFJA 2FOIC 4MGYE 3T15A 1G59A 3J2PB 3U61A 3JR5A 1L1TA 3LW5F 2DHYA 2JZ0A 5FTKA 1X37A 4DV1M 2RKOA 3UJNA 2L6OA 1OFIA 2DHRA 3I51A 4LJ6A 1S3SA 2D7GA 5DFLA 4IBJA 4M9XA 2QBYB 1IN4A 2LH0A 1HNZM 3LVWA 2EKKA 1HVGA 2G3QA 4JI0M 1JR3A 3M0EA 4QOSA 4KN4X 1SG9A 1TH3A 2OQ4A 2EO2A 2ZBKB 1HT2E 2O01F 3GLIB 3KFUG 4OIYA 1W7BA 4JV5M 3U6PA 1IBMM 1IN6A 1Q3CA 2DWLA 2H0LA 3K9PA 3VDPA 3GRUA 3QAUA 1UM8A 3HJ8A 3GLFB 1TDZA 4CISA 4JI8M 3VKHA 1IN8A 2QPAA 3I04M 2OOBA 3AJIB 4CHTB 1N41A 3D8LA 2ZANA 2XFTA 4IBGA 2CFOA 2Y0QA 2V1CA 3EIEA 1L8QA 3FUVA 3K1JA 4XBOA 4B7GA 3D8BA 1ANXA 4L78A 4NSOB 2K6BA 4IJEA 2RGHA 1N33M 2V6ZM 3LQRA 3OTOM 1JR3E 2D7EA 4L5MA 1YGMA 1P3QQ 4I81A 1IXZA 2LXEA 2H0KA 5EXPA 3UZUA 2LHGA 4IBFA 2NQ8C 3LTLA 5EP3A 1DM5A 1BC0A 1NNJA 3ANYA 3CGWA 4KLNA 5EXTA 2CUZA 3KDSE 3KS8A 4WW0A 4LJ9A 3RGSA 5EP4A 1N44A 1FJGM 3HJQA 3TQSA 2YQZA 4II7A 4AG5A 2XZFA 2ZHJA 4DR5M 2K9DA 3U6DA 2WZJA 3SARA 5IZ7D 4L15A 1HQCA 4A4PA 4DV0M 1BC1A 4G4OA 5KPZA 1HAKA 5BPVA 2QCUA 1A8BA 1SXJC 3FUTA 2BNKA 2GNOA 1AXNA 4PT5A 4R71A 5KPTA 4MH0E 1BVSA 1PJQA 1Q3BA 1Z59A 1R2YA 3JAMS 1IY2A 4NL4H 4DBGB 1QUSA 4IJFA 2HCBA 3GQ4A 1YLAA 3QWLA 1GL7A 2VQEM 4GC5A 2FE8A 5ITQA 2H0MA 4JI6M 4KMUX 4IBKA 1Y8GA 1RE0B 4WP2A 5EXSA 4LF5M 2LVNC 1D0MA 3NWLA 4GIPA 3KOWE 4QNRA 2EA0A 3LVVA 1IBKM 4PD2A 4D82A 2JY8A 1EE8A 2DI0A 3SYLA 4NRVA 1OIZA 1G41A 4PCZA 2KXEA 1HVDA 2OPFA 2HSNA 3U60B 1Z5AA 1ZQ9A 2QQ8A 1G8PA 1G71A 4PDIA 3T38A 2DENA 3C3EA 1QC7A 1JR3D 4Z21A 1AUAA 4NSRA 4LZZA 5FTLA 1V92A 2G5GX 2H5XA 3SAUA 4B3MM 1N75A 4FWGA 5DYGA 5JI2E 1ZMWA 1D0KA 4QHSA 2YFQA 2HAKA 3I4VA 3BOSA 1XHBA 1Q8DA 3KOXE 4FQ0C 2KRUA 2Q2EB 4DR7M 3I01M 4S12A 2BWEA 3E46A 3HJSA 1J7KA 2L2DA 4I4LA 1TH2A 2DZOB 3K2LA 2DAGA 2JP7A 3J7BA 2Q4CA 4BB9A 2BJVA 1MJGM 1AIPC 1UFZA 4I5SA 1OAOC 4Y28F 3U5ZB 3FUWA 1OQYA 3SHGB 3HU3A 1ZMUA 4L4UA 1S9DE 1IN5A 3PVSA 3W0FA 3HHZA 2ZHIA 3FKEA 4OVZA 3A46A 1K3XA 4G6ZA 1PJIA 3R8FA 1BC3A 2H1RA 3UK6A 4MDVA 3RGPA 1GVNA 1MCXA 2MH8A 4G4NA 4F2LA 4LRSA 4P17A 2R09A 1BO9A 1WHCA 1IXSB 4GMQA 3GRVA 4X62M 4G3OA 3ABSA 3CF0A 2DWNA 3C9PA 1J5EM 2HHHM 1PJJA 4JMIA 4CGYB 1IN7A 1L1ZA 1HM6A 1YIIA 5ITUA 3J80S 5C1BA 3SWVA 3GPYA 3FTDA 4F1IA 3LCUA 3DFZA 4JI3M 3PNVA 1R2ZA 2CHGA 2J7OA 3FYDA 3L25A 2M60A 4NC6A 2Z3XA 3GPXA 3VK8A 1D0LA 2LHCA 1MX0A 1H6UA 1NV9A 2DKLA 3BRXA 3GLGA 4LF6M 2XLJA 2B3TA 2WSEF 4HL4A 3FTEA 1E32A 3KOZE 1R8SE 2Y20A 4OW0A 4MGZE 2RGOA 2GQFA 2F5OA 4AZFA 2BWBA 4AKGA 1L2DA 4HLQA 1HQYE 2Z4SA 4G4RA 4LGMA 4LF9M 1BCYA 1L2BA 3L27A 4YY3M 4B3RM 2DVWB 2VDBB 2WSFF 4CJ6A 3B74A 1F4IA 2OO9A 1QZMA 2J5YA 2R0IA 3EIHA 3CF2A 2XO3A 2R18A 3RFWA 4IBDA 4D7QA 1TDHA 1QAMA 4FVMA 3I4YA 4FWDA 3M6AA 1G4AE 1DGHB 2LBCA 2KZUA 2R45A 1SXJA 4DR3M 4DUZM 3L8NA 5ITYA 5L8RF 3F92A 4LF4M 2J7NA 3GLGE 1WGLA 2Y0TA 4HREA 4KODA 4Q7JA 2UXCM 1XC8A 2Z4RA 1NJFA 3GRYA 3H4JA 1HR0M 4FW9A 1HNWM 2JY5A 1GJTA 1R5LA 3GRRA 3K92A 3GP1A 3VK7A 4LF8M 4K0KM 1WGNA 2RRUA 4JXJA 5EJCA 3TWLA 4M9SA 4FHRB 1N78A 1IY1A 4GITA 4MB7A 4DR2M 4NRWA 3L2AA 3IG8A 4M9ZA 1HVFA 4D80A 2UUAM 4LJ5A 4NXMM 2QZ4A 1BCZA 2F5NA 4LF7M 2QEZA 3HHYA 3KXEC 3U61B 4LJ4A 3CTWB 3VLFB 4NXNM 4DV6M 1VEKA 4JWLA 2CHVA 1JB0F 1SXJE 1N77A 4B3TM 1I4WA 3VDUA 1YUBA 4OX9M 3MHVC 4KHPM 3SAWA 4AG6A 3MK6A 3DOAA 3FTFA 1AEIA 2LTUA 3FE3A 4MDUA 2KA6B 4KT0F 3SBJA 1YE9A 2QENA 5JI3E 1AOWA 2R65A 2LWXA 3B7QA 1GL6A 4TUWA 4M0DA 1C7YA 2F5SA 2CEAA 3U6CA 3MMPA 1XMQM 1AIIA 1RU3A 1R4AE 3KP1E 1N42A 1OIPA 2R6FA 2AHMA 3AOEC 3KVWA 1GJSA 4X65M 1PBVA 1QYRA 2KEBA 3SC3A 4CIZA 2ZM6M 3LQQA 1C1KA 5ITXA 1ALAA 3TL4X 3ZQJA 3SOHB 3TPZA 2VF8A 2DXIA 3U6MA 4EIWA 1CUKA 5GKNA 2O5RA 3AO0A 1Z5CA 4LFBM 3KOYE 3VFDA 3GLHA 4RF1A 1OTRA 4LGYA 2L09A 4R3DA 4IBEA 2LVPC 4FD2A 4GH9A 1WJ7A 4DV7M 3ABRA 2UUBM 1R8QE 1EFUB 3WHKA 1IY0A 5DYIA 5DNYA 1J09A 1XXHA 2QNJA 2JZ1A 1WR1B 3KW6A 1TGUA 3KSJA 1E9SA 1W5TA 3E21A 3ILKA 4P16A 2CV0A 1WIVA 5A2QS 2KZSA 3FUXA 3L29A 2KDLA 3L28A 4ANRA 1LKVX 4B3SM 1AVCA 3HKPA 1DK5A 1KSFX 3J81S 1R8ME 4QNMA 3W68A 4D7RA 1DO2A 7CATA 5ITXE 2IE7A 4PDGA 2KW0A 4LCBA 2FH0A 1QQWA 2JWSA 3AFHA 3HHXA 4DR1M 4KN7X 3E4RA 2MJ5B 3NBXX 5F3WA 3AL0C 5FSWA 1GKIA 1QDTA 3C3DA 2QBYA 3TWMA 3HY5A 2JNHA 4WURA 4X66M 1SXJD 5IREB 5BR8M 3GLHE 1IXRC 2A5YB 2FS1A 3HZJA 4JI4M 3HX3A 3HHWA 3E9SA 5E6JA 1AVHA 1PJSA 1G5NA 2VXGA 5LMUM 3TW5A 3WHLA 1XXHE 4A3VB 1NNUC 8CATA 2JY6B 2N35A 3GLIA 1DO0A 1VQ1A 1FNNA 3MJ5A 4BLCA 1DV0A 1VDLA 2LVAA 2QHOB 3AKZA 3VKGA 1XB2B 3A45A 3ZH9B 1NSFA 5EP1A 1HT1E 1V34A 3LCVB 1MN3A 3SFZA 4NOOB 1JQJC 5KQ8A 3SHFA 2YR0A 2DZLA 4LZJA 3R9XB 2UXBM 4GKKM 3T6PA 3V76A 1T6OA 1I94M 5KQDA 3SMSA 4JI5M 4QHTA 1OFHA 1WXQA 2L4FA 4RKUF 4X9PA 2MR9A 1PM5A 3KSXA 2VQFM 4AQYM 1NV8A 2R46A 4LJ8A 3A98B 2UUCM 2LVQD
chains in the Genus database with same CATH topology
1KYIA 4JI7M 4L8RC 4GHLA 5IT9S 3HGIA 1Z6TA 1T3TA 4B7FA 4Z6YA 2EUCA 1IQPA 4B7HA 5EP2A 4JN6A 2ZAOA 4GHAA 2VIIA 1R7RA 3RE8A 3A42A 1TH4A 1KFVA 3SAVA 4GKJM 3DZDA 5ITRA 4IBCA 1HNXM 1N32M 1XWIA 4GRIA 2I7NA 3H4MA 3NBIA 4MGKE 4R7GA 2XGNA 1DGGA 4OU7A 3IG5A 4FWHA 2XEPA 5E26A 5FLXS 1N34M 1QAQA 3JR4A 3PFIA 1XMOM 1N36M 2D7HA 2XFSA 3AOEA 4BBAA 4OVZB 3GQ5A 2F4VM 3CF6E 1YSYA 1DGBA 4LFAM 3SMPA 2UXDM 4ITQA 5C18A 3B9PA 4DV3M 3GO8A 4ZPXA 3U6LA 4DV5M 3UGJA 4JI1M 2X49A 1NVMA 3GPPA 1Q39A 4X64M 3KP0E 4MM3B 1NY6A 2V1UA 4MGHA 3TE6A 1GLNA 2XH9A 3U60A 3PXGA 2G8LA 4QOZC 5KO3A 1VDDA 1MU5A 4G4QA 1Z5BA 2Y21A 5FTMA 2ZAMA 3SATA 4IBIA 2F5QA 2DWZB 3GLGB 1E94E 2R62A 2F5PA 2XSZA 2XZUA 3HWSA 3Q8XA 3GQ3A 1QVRA 4LFCM 4FCVA 5FTJA 4GC9A 2CE7A 3T1YM 4D81A 3U6SA 1QAOA 3DA1A 4RNAA 3KS4A 1E9RA 2I7PA 3J27B 3SYKA 3U5ZA 1DGFA 4W5WA 3ZCBB 3U6OA 5EQTA 4RF0A 5IWAM 1XNQM 1SXJB 2XF3A 3THGA 2DZNB 1W5SA 1K82A 2C9CA 1R6BX 4LJAA 2HKJA 1L2CA 3SASA 2R4JA 4IBBA 3J7AS 4JI2M 3ZC7B 1K3WA 2K47A 3FYCA 2QP9X 2C98A 2X8AA 4AW4A 3HU1A 3HU2A 2C96A 2BJWA 2YNMD 2L7IA 4XGIA 4IIWA 5LMNM 3FTCA 2C9OA 4KO8A 1IBLM 3L26A 3C58A 4DR4M 4AKHA 1QANA 2E5LM 1OJLA 2P5TA 4MGIE 3M7GA 3TWKA 4DV2M 1NY5A 4LRTA 4JYAM 3LMMA 4I8OA 3UMMA 2W82A 1G3IA 1ZAEA 2CV2A 3T1HM 3W0LB 2L7HA 3FUUA 1NHGC 5H37D 2JA2A 2ERCA 3GLFA 5EXXA 2CV1A 3U6EA 4B08A 4DR6M 4FCTA 2DWMA 4AI6A 1D2NA 1DGHA 2KRKA 2M5ZA 1NHWC 2FNAA 1NJGA 5FTNA 3GPUA 2Z7JA 2X4AA 3K8ZA 3U6QA 4DUYM 3AOGA 1ORYB 3PNYA 3AV0A 2R4EA 4REZA 4DV4M 4YHHM 5KPRA 3GLHB 1XNRM 4FCWA 2C99A 2C5RA 1IM2A 4L16A 2LNHC 1LV7A 3FD9A 4LJ7A 4M0WA 4LY6A 5ITTA 2UU9M 2XSZD 4Z8XA 1XXHB 2HL7A 2CHQA 4AKIA 2FFJA 2FOIC 4MGYE 3T15A 1G59A 3J2PB 3U61A 3JR5A 1L1TA 5FTKA 1X37A 4DV1M 2RKOA 3UJNA 2L6OA 1OFIA 2DHRA 3I51A 4LJ6A 1S3SA 2D7GA 4IBJA 4M9XA 2QBYB 1IN4A 2LH0A 1HNZM 3LVWA 4JI0M 1JR3A 3M0EA 4QOSA 1TH3A 2OQ4A 2EO2A 2ZBKB 1HT2E 3GLIB 3KFUG 4JV5M 3U6PA 1IBMM 1IN6A 1Q3CA 2DWLA 3VDPA 3GRUA 3QAUA 1UM8A 3HJ8A 3GLFB 1TDZA 4CISA 4JI8M 3VKHA 1IN8A 2QPAA 3AJIB 4CHTB 3D8LA 2ZANA 2XFTA 4IBGA 2CFOA 2Y0QA 2V1CA 3EIEA 1L8QA 3K1JA 3FUVA 4XBOA 4B7GA 3D8BA 4L78A 4NSOB 4IJEA 2RGHA 1N33M 2V6ZM 3LQRA 3OTOM 2D7EA 4I81A 1IXZA 2LXEA 5EXPA 3UZUA 4IBFA 2NQ8C 5EP3A 1NNJA 4KLNA 5EXTA 2CUZA 3KDSE 3KS8A 4WW0A 4LJ9A 3RGSA 5EP4A 1FJGM 3HJQA 3TQSA 2YQZA 4II7A 4AG5A 2XZFA 4DR5M 3U6DA 3SARA 5IZ7D 4L15A 1HQCA 4DV0M 4G4OA 5KPZA 5BPVA 2QCUA 1SXJC 3FUTA 2BNKA 4PT5A 5KPTA 4MH0E 1Q3BA 1Z59A 1R2YA 3JAMS 1IY2A 4NL4H 4IJFA 2HCBA 3GQ4A 3QWLA 1GL7A 2VQEM 4GC5A 2FE8A 5ITQA 4JI6M 4IBKA 5EXSA 4LF5M 4GIPA 3NWLA 4QNRA 3KOWE 2EA0A 3LVVA 1IBKM 4PD2A 4D82A 1EE8A 3SYLA 4NRVA 1G41A 4PCZA 2KXEA 2OPFA 3U60B 1Z5AA 1ZQ9A 1G8PA 4PDIA 3T38A 1JR3D 4NSRA 5FTLA 4LZZA 2G5GX 3SAUA 4B3MM 1N75A 4FWGA 5DYGA 5JI2E 4QHSA 2YFQA 3I4VA 3BOSA 1XHBA 3KOXE 2KRUA 2Q2EB 4DR7M 4S12A 3HJSA 1J7KA 4I4LA 1TH2A 2DZOB 3K2LA 3J7BA 4BB9A 2BJVA 3U5ZB 4I5SA 3FUWA 3SHGB 3HU3A 4L4UA 1IN5A 3PVSA 3W0FA 3HHZA 3FKEA 4OVZA 3A46A 1K3XA 4G6ZA 1PJIA 3R8FA 2H1RA 3UK6A 3RGPA 1GVNA 4G4NA 4LRSA 1IXSB 4GMQA 3GRVA 4X62M 3CF0A 2DWNA 1J5EM 2HHHM 1PJJA 4CGYB 1IN7A 1L1ZA 5ITUA 3J80S 5C1BA 3GPYA 3FTDA 3DFZA 4JI3M 3PNVA 1R2ZA 2CHGA 2J7OA 3FYDA 3L25A 2M60A 2Z3XA 3GPXA 3VK8A 1MX0A 1H6UA 3GLGA 4LF6M 2XLJA 4HL4A 3FTEA 1E32A 3KOZE 2Y20A 4OW0A 4MGZE 2RGOA 2F5OA 4AZFA 4AKGA 1L2DA 4HLQA 1HQYE 2Z4SA 4G4RA 4LGMA 4LF9M 1L2BA 3L27A 4YY3M 4B3RM 2DVWB 1QZMA 3EIHA 3CF2A 2R18A 3RFWA 4IBDA 1TDHA 1QAMA 4FVMA 3I4YA 4FWDA 3M6AA 1G4AE 1DGHB 2R45A 2KZUA 4DR3M 1SXJA 4DUZM 5ITYA 4LF4M 2J7NA 2Y0TA 4KODA 2UXCM 1XC8A 2Z4RA 1NJFA 3GRYA 1HR0M 4FW9A 1HNWM 3K92A 3GRRA 3GP1A 3VK7A 4LF8M 4K0KM 4JXJA 5EJCA 3TWLA 4M9SA 1N78A 1IY1A 4GITA 4MB7A 4DR2M 4NRWA 3L2AA 3IG8A 4M9ZA 4D80A 2UUAM 4LJ5A 4NXMM 2QZ4A 2F5NA 4LF7M 3HHYA 3KXEC 3U61B 4LJ4A 3CTWB 3VLFB 4NXNM 4DV6M 2CHVA 1SXJE 1N77A 4B3TM 1I4WA 3VDUA 1YUBA 4OX9M 3MHVC 4KHPM 3SAWA 4AG6A 3MK6A 3DOAA 3FTFA 2KA6B 3SBJA 1YE9A 2QENA 5JI3E 2R65A 2LWXA 1GL6A 4TUWA 4M0DA 2F5SA 2CEAA 3U6CA 1XMQM 3KP1E 2AHMA 3AOEC 3KVWA 4X65M 1QYRA 2KEBA 3SC3A 2ZM6M 3LQQA 1C1KA 5ITXA 3TL4X 3TPZA 2DXIA 3U6MA 4EIWA 5GKNA 2O5RA 1Z5CA 4LFBM 3KOYE 3VFDA 3GLHA 4RF1A 4LGYA 2L09A 4R3DA 4IBEA 4FD2A 4GH9A 4DV7M 2UUBM 3WHKA 1IY0A 5DYIA 5DNYA 1J09A 1XXHA 3KW6A 1TGUA 3KSJA 1E9SA 1W5TA 3ILKA 4P16A 2CV0A 5A2QS 2KZSA 3FUXA 3L29A 3L28A 4B3SM 3HKPA 1KSFX 3J81S 4QNMA 1DO2A 7CATA 5ITXE 4PDGA 2KW0A 4LCBA 1QQWA 3HHXA 4DR1M 3E4RA 5F3WA 3AL0C 5FSWA 1GKIA 2QBYA 3TWMA 4WURA 4X66M 5BR8M 1SXJD 5IREB 1IXRC 2A5YB 4JI4M 3HHWA 3E9SA 5E6JA 5LMUM 3WHLA 4A3VB 3GLIA 1NNUC 8CATA 4LG2A 1DO0A 3MJ5A 1FNNA 3A98B 4BLCA 3AKZA 3VKGA 3A45A 3ZH9B 1NSFA 5EP1A 1HT1E 3SFZA 4NOOB 1JQJC 5KQ8A 3SHFA 2YR0A 4LZJA 3R9XB 2UXBM 4GKKM 1I94M 5KQDA 3SMSA 4JI5M 4QHTA 1OFHA 1WXQA 1PM5A 3KSXA 2VQFM 4AQYM 2R46A 4LJ8A 3AFHA 2UUCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYI A;  4KOD A;  1SXJ C;  1NY5 A;  2Z4R A;  1NJF A;  4LRT A;  4FW9 A;  1G3I A;  1IQP A;  1IY2 A;  3ZH9 B;  5EP2 A;  4JN6 A;  2HCB A;  2ZAO A;  1IY1 A;  2VII A;  4GIT A;  3GLF A;  1R7R A;  5EXX A;  4D80 A;  4FCT A;  4LJ5 A;  2QZ4 A;  5EXS A;  3U61 B;  4LJ4 A;  3VLF B;  1D2N A;  2KRK A;  3DZD A;  4QNR A;  2CHV A;  2FNA A;  1NJG A;  5FTN A;  4D82 A;  1SXJ E;  1XWI A;  3H4M A;  3SYL A;  1G41 A;  3MHV C;  4FWH A;  3U60 B;  3GLH B;  2QEN A;  3PFI A;  4FCW A;  1JR3 D;  2C99 A;  2R65 A;  5JI3 E;  1IM2 A;  4L16 A;  4LY6 A;  1LV7 A;  4LJ7 A;  4LZZ A;  5FTL A;  2XSZ D;  2CEA A;  4FWG A;  5DYG A;  4Z8X A;  1XXH B;  5JI2 E;  2CHQ A;  4QHS A;  3BOS A;  5C18 A;  3B9P A;  4ZPX A;  3SC3 A;  5FTK A;  1X37 A;  1C1K A;  1NVM A;  2RKO A;  1NY6 A;  2V1U A;  1OFI A;  2DHR A;  1J7K A;  4LJ6 A;  4I4L A;  1S3S A;  2DZO B;  4EIW A;  2BJV A;  3PXG A;  3U5Z B;  3VFD A;  1IN4 A;  2QBY B;  3GLH A;  3HU3 A;  4FD2 A;  4L4U A;  1IN5 A;  3PVS A;  5FTM A;  2ZAM A;  1JR3 A;  3M0E A;  4QOS A;  5EXT A;  3WHK A;  1IY0 A;  2DWZ B;  5DYI A;  3GLG B;  1XXH A;  1E94 E;  2R62 A;  3KW6 A;  3R8F A;  3UK6 A;  2XSZ A;  1HT2 E;  1W5T A;  3GLI B;  3HWS A;  4LRS A;  1IN6 A;  1QVR A;  4FCV A;  1KSF X;  5FTJ A;  1UM8 A;  1IXS B;  2CE7 A;  4QNM A;  3GLF B;  3CF0 A;  1IN8 A;  1DO2 A;  4D81 A;  2QPA A;  1IN7 A;  4LCB A;  3AJI B;  5C1B A;  2ZAN A;  3SYK A;  3EIE A;  1L8Q A;  3K1J A;  2QBY A;  2CHG A;  3D8B A;  5EQT A;  1SXJ D;  1IXR C;  1SXJ B;  2DZN B;  1W5S A;  2V6Z M;  3GLG A;  4I81 A;  1IXZ A;  2C9C A;  1R6B X;  1E32 A;  3WHL A;  3GLI A;  4LJA A;  5EXP A;  1DO0 A;  1FNN A;  5EP3 A;  2QP9 X;  2C98 A;  2X8A A;  3HU1 A;  3HU2 A;  1NSF A;  4KLN A;  1HQY E;  2Z4S A;  5EP1 A;  3KDS E;  1HT1 E;  2C96 A;  2BJW A;  4LGM A;  4WW0 A;  2DVW B;  4LJ9 A;  1JQJ C;  5EP4 A;  1QZM A;  2C9O A;  3EIH A;  3CF2 A;  4KO8 A;  4QHT A;  1OFH A;  4FWD A;  3M6A A;  1G4A E;  4L15 A;  1HQC A;  1SXJ A;  1OJL A;  4LJ8 A;  4A3V B; 
#chains in the Genus database with same CATH topology
 1KYI A;  1QDR A;  1TR8 A;  3ABQ A;  4JI7 M;  4EVH A;  4L8R C;  4GHL A;  3GLI E;  1T43 A;  5IT9 S;  3HGI A;  1Z6T A;  2VF7 A;  1T3T A;  1ZMV A;  4B7F A;  4Z6Y A;  2EUC A;  2MRO B;  1IQP A;  1V33 A;  4B7H A;  5EP2 A;  4JN6 A;  4XK8 F;  2ZAO A;  4GHA A;  2VII A;  3BXW A;  2RAN A;  1R7R A;  3RE8 A;  3A42 A;  2K0B X;  1TH4 A;  1KFV A;  3SAV A;  4GKJ M;  1XSZ A;  3USY A;  3DZD A;  5ITR A;  4IBC A;  1HNX M;  2DAI A;  2R0D A;  1TTE A;  1N32 M;  1XWI A;  4GRI A;  2I7N A;  3H4M A;  3NBI A;  4MGK E;  4R7G A;  2XGN A;  1DGG A;  4OU7 A;  3IG5 A;  4FWH A;  2OY9 A;  2XEP A;  1Q02 A;  5E26 A;  5FLX S;  1N34 M;  3USW A;  1QAQ A;  3JR4 A;  3PFI A;  1XMO M;  1N36 M;  2O25 A;  2D7H A;  2XFS A;  3AOE A;  4BBA A;  3IHP A;  4OVZ B;  3GQ5 A;  1R4G A;  2OOA A;  2F4V M;  4JMO A;  3CF6 E;  1YSY A;  1DGB A;  4LFA M;  3SMP A;  2UXD M;  4ITQ A;  5C18 A;  2HWJ A;  3B9P A;  4DV3 M;  3GO8 A;  4ZPX A;  3U6L A;  4DV5 M;  3UGJ A;  4JI1 M;  2KNA A;  3AJC A;  2LVO C;  2X49 A;  1NVM A;  3GPP A;  1AVR A;  1W3W A;  1Q39 A;  2KNZ A;  4X64 M;  3KP0 E;  2HYU A;  4MM3 B;  1NY6 A;  2V1U A;  1ANN A;  4MGH A;  3TE6 A;  1IFY A;  1GLN A;  2XH9 A;  3QYE A;  1QUT A;  4L6V 6;  3PXG A;  3U60 A;  2G8L A;  4QOZ C;  1KU1 A;  2EKF A;  3ABO A;  5KO3 A;  1VDD A;  1PRB A;  1MU5 A;  4G4Q A;  1Z5B A;  2Y21 A;  4EVF A;  5FTM A;  2ZAM A;  3SAT A;  2Z8Y M;  4IBI A;  2F5Q A;  1TF0 B;  2DWZ B;  3GLG B;  2JUJ A;  1E94 E;  2R62 A;  2F5P A;  2XSZ A;  2XZU A;  3HWS A;  3Q8X A;  3GQ3 A;  1QVR A;  3HJL A;  4LFC M;  4FCV A;  5FTJ A;  4GC9 A;  2CE7 A;  3T1Y M;  1EIJ A;  2II2 A;  2QSF X;  2ZOC A;  2DAK A;  4D81 A;  3U6S A;  1QAO A;  1A5T A;  3DA1 A;  4RNA A;  2JXN A;  3KS4 A;  1E9R A;  2I7P A;  3J27 B;  3SYK A;  4UN2 B;  3U5Z A;  1DGF A;  4W5W A;  3ZCB B;  3B7N A;  5EQT A;  3U6O A;  4C0A A;  1HJP A;  4RF0 A;  5IWA M;  1XNQ M;  1UPT B;  1W45 A;  3QYB A;  4JXH A;  1SXJ B;  2XF3 A;  2ZTC A;  2DZN B;  3THG A;  1W5S A;  2XO2 A;  1K82 A;  2C9C A;  1R6B X;  4LJA A;  2HKJ A;  1L2C A;  1PJT A;  2R4J A;  2JY7 A;  4IBB A;  3SAS A;  3J7A S;  4JI2 M;  3IEC A;  3ZC7 B;  1K3W A;  2K47 A;  3FYC A;  2QP9 X;  2C98 A;  2X8A A;  4AW4 A;  3HU1 A;  1IXS A;  3HU2 A;  1VG5 A;  2C96 A;  2L4E A;  2BJW A;  2YNM D;  3FRH A;  2DAE A;  1VEG A;  3W67 A;  2CP8 A;  2L7I A;  4XGI A;  4IIW A;  5LMN M;  3FTC A;  2C9O A;  3BBZ A;  1VEJ A;  4KO8 A;  1A8A A;  2ZTD A;  1IBL M;  3L26 A;  3C58 A;  4DR4 M;  4AKH A;  3K9O A;  1QAN A;  1NO1 A;  1GAB A;  4Q2S A;  2MGW A;  4LG2 A;  1OKS A;  1QZE A;  2R44 A;  2E5L M;  1OJL A;  2P5T A;  1M9I A;  1SAV A;  4MGI E;  1YJ0 A;  3M7G A;  3TWK A;  4DV2 M;  1GO5 A;  1NY5 A;  4LRT A;  4JYA M;  3LMM A;  4I8O A;  3UMM A;  2HYV A;  1XT0 B;  4C7P A;  2EJS A;  2W82 A;  1G3I A;  1ZAE A;  2CV2 A;  3T1H M;  3W0L B;  2L7H A;  3FUU A;  1NHG C;  5H37 D;  1BC9 A;  2JA2 A;  2ERC A;  2WSC F;  3GLF A;  1XJL A;  5EXX A;  2CV1 A;  2CWB A;  4HEO A;  3B89 A;  2KNV A;  3U6E A;  4B08 A;  4DR6 M;  1OAI A;  4FCT A;  4GEW A;  1LTM A;  2DNA A;  2DWM A;  3B7Z A;  2K6X A;  4AI6 A;  1D2N A;  1DGH A;  2KRK A;  2M5Z A;  1I4A A;  1NHW C;  2FNA A;  1NJG A;  5FTN A;  3GPU A;  2Z7J A;  2X4A A;  2KHH A;  3K8Z A;  1HVE A;  1PGY A;  4DUY M;  3AOG A;  1ORY B;  3U6Q A;  1ANW A;  1BCW A;  3PNY A;  3Q8G A;  1YCN A;  3AV0 A;  2R4E A;  4REZ A;  4DV4 M;  2DAM A;  4YHH M;  5KPR A;  1N00 A;  3GLH B;  1XNR M;  2HYW A;  2IIC A;  4JK1 X;  4FCW A;  2C99 A;  2C5R A;  3FRI A;  1ZV1 A;  1IM2 A;  4L16 A;  2LNH C;  1LV7 A;  3FD9 A;  4LJ7 A;  2APL A;  4M0W A;  4LY6 A;  5ITT A;  2XSZ D;  2UU9 M;  4Z8X A;  1XXH B;  2HL7 A;  2CHQ A;  3GLF E;  2IE6 A;  4AKI A;  2CRU A;  2FFJ A;  2FOI C;  4MGY E;  3T15 A;  1G59 A;  3J2P B;  3U61 A;  3JR5 A;  1L1T A;  3LW5 F;  2DHY A;  2JZ0 A;  5FTK A;  1X37 A;  4DV1 M;  2RKO A;  3UJN A;  2L6O A;  1OFI A;  2DHR A;  3I51 A;  4LJ6 A;  1S3S A;  2D7G A;  5DFL A;  4IBJ A;  4M9X A;  2QBY B;  1IN4 A;  2LH0 A;  1HNZ M;  3LVW A;  2EKK A;  1HVG A;  2G3Q A;  4JI0 M;  1JR3 A;  3M0E A;  4QOS A;  4KN4 X;  1SG9 A;  1TH3 A;  2OQ4 A;  2EO2 A;  2ZBK B;  1HT2 E;  2O01 F;  3GLI B;  3KFU G;  4OIY A;  1W7B A;  4JV5 M;  3U6P A;  1IBM M;  1IN6 A;  1Q3C A;  2DWL A;  2H0L A;  3K9P A;  3VDP A;  3GRU A;  3QAU A;  1UM8 A;  3HJ8 A;  3GLF B;  1TDZ A;  4CIS A;  4JI8 M;  3VKH A;  1IN8 A;  2QPA A;  3I04 M;  2OOB A;  3AJI B;  4CHT B;  1N41 A;  3D8L A;  2ZAN A;  2XFT A;  4IBG A;  2CFO A;  2Y0Q A;  2V1C A;  3EIE A;  1L8Q A;  3FUV A;  3K1J A;  4XBO A;  4B7G A;  3D8B A;  1ANX A;  4L78 A;  4NSO B;  2K6B A;  4IJE A;  2RGH A;  1N33 M;  2V6Z M;  3LQR A;  3OTO M;  1JR3 E;  2D7E A;  4L5M A;  1YGM A;  1P3Q Q;  4I81 A;  1IXZ A;  2LXE A;  2H0K A;  5EXP A;  3UZU A;  2LHG A;  4IBF A;  2NQ8 C;  3LTL A;  5EP3 A;  1DM5 A;  1BC0 A;  1NNJ A;  3ANY A;  3CGW A;  4KLN A;  5EXT A;  2CUZ A;  3KDS E;  3KS8 A;  4WW0 A;  4LJ9 A;  3RGS A;  5EP4 A;  1N44 A;  1FJG M;  3HJQ A;  3TQS A;  2YQZ A;  4II7 A;  4AG5 A;  2XZF A;  2ZHJ A;  4DR5 M;  2K9D A;  3U6D A;  2WZJ A;  3SAR A;  5IZ7 D;  4L15 A;  1HQC A;  4A4P A;  4DV0 M;  1BC1 A;  4G4O A;  5KPZ A;  1HAK A;  5BPV A;  2QCU A;  1A8B A;  1SXJ C;  3FUT A;  2BNK A;  2GNO A;  1AXN A;  4PT5 A;  4R71 A;  5KPT A;  4MH0 E;  1BVS A;  1PJQ A;  1Q3B A;  1Z59 A;  1R2Y A;  3JAM S;  1IY2 A;  4NL4 H;  4DBG B;  1QUS A;  4IJF A;  2HCB A;  3GQ4 A;  1YLA A;  3QWL A;  1GL7 A;  2VQE M;  4GC5 A;  2FE8 A;  5ITQ A;  2H0M A;  4JI6 M;  4KMU X;  4IBK A;  1Y8G A;  1RE0 B;  4WP2 A;  5EXS A;  4LF5 M;  2LVN C;  1D0M A;  3NWL A;  4GIP A;  3KOW E;  4QNR A;  2EA0 A;  3LVV A;  1IBK M;  4PD2 A;  4D82 A;  2JY8 A;  1EE8 A;  2DI0 A;  3SYL A;  4NRV A;  1OIZ A;  1G41 A;  4PCZ A;  2KXE A;  1HVD A;  2OPF A;  2HSN A;  3U60 B;  1Z5A A;  1ZQ9 A;  2QQ8 A;  1G8P A;  1G71 A;  4PDI A;  3T38 A;  2DEN A;  3C3E A;  1QC7 A;  1JR3 D;  4Z21 A;  1AUA A;  4NSR A;  4LZZ A;  5FTL A;  1V92 A;  2G5G X;  2H5X A;  3SAU A;  4B3M M;  1N75 A;  4FWG A;  5DYG A;  5JI2 E;  1ZMW A;  1D0K A;  4QHS A;  2YFQ A;  2HAK A;  3I4V A;  3BOS A;  1XHB A;  1Q8D A;  3KOX E;  4FQ0 C;  2KRU A;  2Q2E B;  4DR7 M;  3I01 M;  4S12 A;  2BWE A;  3E46 A;  3HJS A;  1J7K A;  2L2D A;  4I4L A;  1TH2 A;  2DZO B;  3K2L A;  2DAG A;  2JP7 A;  3J7B A;  2Q4C A;  4BB9 A;  2BJV A;  1MJG M;  1AIP C;  1UFZ A;  4I5S A;  1OAO C;  4Y28 F;  3U5Z B;  3FUW A;  1OQY A;  3SHG B;  3HU3 A;  1ZMU A;  4L4U A;  1S9D E;  1IN5 A;  3PVS A;  3W0F A;  3HHZ A;  2ZHI A;  3FKE A;  4OVZ A;  3A46 A;  1K3X A;  4G6Z A;  1PJI A;  3R8F A;  1BC3 A;  2H1R A;  3UK6 A;  4MDV A;  3RGP A;  1GVN A;  1MCX A;  2MH8 A;  4G4N A;  4F2L A;  4LRS A;  4P17 A;  2R09 A;  1BO9 A;  1WHC A;  1IXS B;  4GMQ A;  3GRV A;  4X62 M;  4G3O A;  3ABS A;  3CF0 A;  2DWN A;  3C9P A;  1J5E M;  2HHH M;  1PJJ A;  4JMI A;  4CGY B;  1IN7 A;  1L1Z A;  1HM6 A;  1YII A;  5ITU A;  3J80 S;  5C1B A;  3SWV A;  3GPY A;  3FTD A;  4F1I A;  3LCU A;  3DFZ A;  4JI3 M;  3PNV A;  1R2Z A;  2CHG A;  2J7O A;  3FYD A;  3L25 A;  2M60 A;  4NC6 A;  2Z3X A;  3GPX A;  3VK8 A;  1D0L A;  2LHC A;  1MX0 A;  1H6U A;  1NV9 A;  2DKL A;  3BRX A;  3GLG A;  4LF6 M;  2XLJ A;  2B3T A;  2WSE F;  4HL4 A;  3FTE A;  1E32 A;  3KOZ E;  1R8S E;  2Y20 A;  4OW0 A;  4MGZ E;  2RGO A;  2GQF A;  2F5O A;  4AZF A;  2BWB A;  4AKG A;  1L2D A;  4HLQ A;  1HQY E;  2Z4S A;  4G4R A;  4LGM A;  4LF9 M;  1BCY A;  1L2B A;  3L27 A;  4YY3 M;  4B3R M;  2DVW B;  2VDB B;  2WSF F;  4CJ6 A;  3B74 A;  1F4I A;  2OO9 A;  1QZM A;  2J5Y A;  2R0I A;  3EIH A;  3CF2 A;  2XO3 A;  2R18 A;  3RFW A;  4IBD A;  4D7Q A;  1TDH A;  1QAM A;  4FVM A;  3I4Y A;  4FWD A;  3M6A A;  1G4A E;  1DGH B;  2LBC A;  2KZU A;  2R45 A;  1SXJ A;  4DR3 M;  4DUZ M;  3L8N A;  5ITY A;  5L8R F;  3F92 A;  4LF4 M;  2J7N A;  3GLG E;  1WGL A;  2Y0T A;  4HRE A;  4KOD A;  4Q7J A;  2UXC M;  1XC8 A;  2Z4R A;  1NJF A;  3GRY A;  3H4J A;  1HR0 M;  4FW9 A;  1HNW M;  2JY5 A;  1GJT A;  1R5L A;  3GRR A;  3K92 A;  3GP1 A;  3VK7 A;  4LF8 M;  4K0K M;  1WGN A;  2RRU A;  4JXJ A;  5EJC A;  3TWL A;  4M9S A;  4FHR B;  1N78 A;  1IY1 A;  4GIT A;  4MB7 A;  4DR2 M;  4NRW A;  3L2A A;  3IG8 A;  4M9Z A;  1HVF A;  4D80 A;  2UUA M;  4LJ5 A;  4NXM M;  2QZ4 A;  1BCZ A;  2F5N A;  4LF7 M;  2QEZ A;  3HHY A;  3KXE C;  3U61 B;  4LJ4 A;  3CTW B;  3VLF B;  4NXN M;  4DV6 M;  1VEK A;  4JWL A;  2CHV A;  1JB0 F;  1SXJ E;  1N77 A;  4B3T M;  1I4W A;  3VDU A;  1YUB A;  4OX9 M;  3MHV C;  4KHP M;  3SAW A;  4AG6 A;  3MK6 A;  3DOA A;  3FTF A;  1AEI A;  2LTU A;  3FE3 A;  4MDU A;  2KA6 B;  4KT0 F;  3SBJ A;  1YE9 A;  2QEN A;  5JI3 E;  1AOW A;  2R65 A;  2LWX A;  3B7Q A;  1GL6 A;  4TUW A;  4M0D A;  1C7Y A;  2F5S A;  2CEA A;  3U6C A;  3MMP A;  1XMQ M;  1AII A;  1RU3 A;  1R4A E;  3KP1 E;  1N42 A;  1OIP A;  2R6F A;  2AHM A;  3AOE C;  3KVW A;  1GJS A;  4X65 M;  1PBV A;  1QYR A;  2KEB A;  3SC3 A;  4CIZ A;  2ZM6 M;  3LQQ A;  1C1K A;  5ITX A;  1ALA A;  3TL4 X;  3ZQJ A;  3SOH B;  3TPZ A;  2VF8 A;  2DXI A;  3U6M A;  4EIW A;  1CUK A;  5GKN A;  2O5R A;  3AO0 A;  1Z5C A;  4LFB M;  3KOY E;  3VFD A;  3GLH A;  4RF1 A;  1OTR A;  4LGY A;  2L09 A;  4R3D A;  4IBE A;  2LVP C;  4FD2 A;  4GH9 A;  1WJ7 A;  4DV7 M;  3ABR A;  2UUB M;  1R8Q E;  1EFU B;  3WHK A;  1IY0 A;  5DYI A;  5DNY A;  1J09 A;  1XXH A;  2QNJ A;  2JZ1 A;  1WR1 B;  3KW6 A;  1TGU A;  3KSJ A;  1E9S A;  1W5T A;  3E21 A;  3ILK A;  4P16 A;  2CV0 A;  1WIV A;  5A2Q S;  2KZS A;  3FUX A;  3L29 A;  2KDL A;  3L28 A;  4ANR A;  1LKV X;  4B3S M;  1AVC A;  3HKP A;  1DK5 A;  1KSF X;  3J81 S;  1R8M E;  4QNM A;  3W68 A;  4D7R A;  1DO2 A;  7CAT A;  5ITX E;  2IE7 A;  4PDG A;  2KW0 A;  4LCB A;  2FH0 A;  1QQW A;  2JWS A;  3AFH A;  3HHX A;  4DR1 M;  4KN7 X;  3E4R A;  2MJ5 B;  3NBX X;  5F3W A;  3AL0 C;  5FSW A;  1GKI A;  1QDT A;  3C3D A;  2QBY A;  3TWM A;  3HY5 A;  2JNH A;  4WUR A;  4X66 M;  1SXJ D;  5IRE B;  5BR8 M;  3GLH E;  1IXR C;  2A5Y B;  2FS1 A;  3HZJ A;  4JI4 M;  3HX3 A;  3HHW A;  3E9S A;  5E6J A;  1AVH A;  1PJS A;  1G5N A;  2VXG A;  5LMU M;  3TW5 A;  3WHL A;  1XXH E;  4A3V B;  1NNU C;  8CAT A;  2JY6 B;  2N35 A;  3GLI A;  1DO0 A;  1VQ1 A;  1FNN A;  3MJ5 A;  4BLC A;  1DV0 A;  1VDL A;  2LVA A;  2QHO B;  3AKZ A;  3VKG A;  1XB2 B;  3A45 A;  3ZH9 B;  1NSF A;  5EP1 A;  1HT1 E;  1V34 A;  3LCV B;  1MN3 A;  3SFZ A;  4NOO B;  1JQJ C;  5KQ8 A;  3SHF A;  2YR0 A;  2DZL A;  4LZJ A;  3R9X B;  2UXB M;  4GKK M;  3T6P A;  3V76 A;  1T6O A;  1I94 M;  5KQD A;  3SMS A;  4JI5 M;  4QHT A;  1OFH A;  1WXQ A;  2L4F A;  4RKU F;  4X9P A;  2MR9 A;  1PM5 A;  3KSX A;  2VQF M;  4AQY M;  1NV8 A;  2R46 A;  4LJ8 A;  3A98 B;  2UUC M;  2LVQ D; 
#chains in the Genus database with same CATH homology
 1KYI A;  4JI7 M;  4L8R C;  4GHL A;  5IT9 S;  3HGI A;  1Z6T A;  1T3T A;  4B7F A;  4Z6Y A;  2EUC A;  1IQP A;  4B7H A;  5EP2 A;  4JN6 A;  2ZAO A;  4GHA A;  2VII A;  1R7R A;  3RE8 A;  3A42 A;  1TH4 A;  1KFV A;  3SAV A;  4GKJ M;  3DZD A;  5ITR A;  4IBC A;  1HNX M;  1N32 M;  1XWI A;  4GRI A;  2I7N A;  3H4M A;  3NBI A;  4MGK E;  4R7G A;  2XGN A;  1DGG A;  4OU7 A;  3IG5 A;  4FWH A;  2XEP A;  5E26 A;  5FLX S;  1N34 M;  1QAQ A;  3JR4 A;  3PFI A;  1XMO M;  1N36 M;  2D7H A;  2XFS A;  3AOE A;  4BBA A;  4OVZ B;  3GQ5 A;  2F4V M;  3CF6 E;  1YSY A;  1DGB A;  4LFA M;  3SMP A;  2UXD M;  4ITQ A;  5C18 A;  3B9P A;  4DV3 M;  3GO8 A;  4ZPX A;  3U6L A;  4DV5 M;  3UGJ A;  4JI1 M;  2X49 A;  1NVM A;  3GPP A;  1Q39 A;  4X64 M;  3KP0 E;  4MM3 B;  1NY6 A;  2V1U A;  4MGH A;  3TE6 A;  1GLN A;  2XH9 A;  3U60 A;  3PXG A;  2G8L A;  4QOZ C;  5KO3 A;  1VDD A;  1MU5 A;  4G4Q A;  1Z5B A;  2Y21 A;  5FTM A;  2ZAM A;  3SAT A;  4IBI A;  2F5Q A;  2DWZ B;  3GLG B;  1E94 E;  2R62 A;  2F5P A;  2XSZ A;  2XZU A;  3HWS A;  3Q8X A;  3GQ3 A;  1QVR A;  4LFC M;  4FCV A;  5FTJ A;  4GC9 A;  2CE7 A;  3T1Y M;  4D81 A;  3U6S A;  1QAO A;  3DA1 A;  4RNA A;  3KS4 A;  1E9R A;  2I7P A;  3J27 B;  3SYK A;  3U5Z A;  1DGF A;  4W5W A;  3ZCB B;  3U6O A;  5EQT A;  4RF0 A;  5IWA M;  1XNQ M;  1SXJ B;  2XF3 A;  3THG A;  2DZN B;  1W5S A;  1K82 A;  2C9C A;  1R6B X;  4LJA A;  2HKJ A;  1L2C A;  3SAS A;  2R4J A;  4IBB A;  3J7A S;  4JI2 M;  3ZC7 B;  1K3W A;  2K47 A;  3FYC A;  2QP9 X;  2C98 A;  2X8A A;  4AW4 A;  3HU1 A;  3HU2 A;  2C96 A;  2BJW A;  2YNM D;  2L7I A;  4XGI A;  4IIW A;  5LMN M;  3FTC A;  2C9O A;  4KO8 A;  1IBL M;  3L26 A;  3C58 A;  4DR4 M;  4AKH A;  1QAN A;  2E5L M;  1OJL A;  2P5T A;  4MGI E;  3M7G A;  3TWK A;  4DV2 M;  1NY5 A;  4LRT A;  4JYA M;  3LMM A;  4I8O A;  3UMM A;  2W82 A;  1G3I A;  1ZAE A;  2CV2 A;  3T1H M;  3W0L B;  2L7H A;  3FUU A;  1NHG C;  5H37 D;  2JA2 A;  2ERC A;  3GLF A;  5EXX A;  2CV1 A;  3U6E A;  4B08 A;  4DR6 M;  4FCT A;  2DWM A;  4AI6 A;  1D2N A;  1DGH A;  2KRK A;  2M5Z A;  1NHW C;  2FNA A;  1NJG A;  5FTN A;  3GPU A;  2Z7J A;  2X4A A;  3K8Z A;  3U6Q A;  4DUY M;  3AOG A;  1ORY B;  3PNY A;  3AV0 A;  2R4E A;  4REZ A;  4DV4 M;  4YHH M;  5KPR A;  3GLH B;  1XNR M;  4FCW A;  2C99 A;  2C5R A;  1IM2 A;  4L16 A;  2LNH C;  1LV7 A;  3FD9 A;  4LJ7 A;  4M0W A;  4LY6 A;  5ITT A;  2UU9 M;  2XSZ D;  4Z8X A;  1XXH B;  2HL7 A;  2CHQ A;  4AKI A;  2FFJ A;  2FOI C;  4MGY E;  3T15 A;  1G59 A;  3J2P B;  3U61 A;  3JR5 A;  1L1T A;  5FTK A;  1X37 A;  4DV1 M;  2RKO A;  3UJN A;  2L6O A;  1OFI A;  2DHR A;  3I51 A;  4LJ6 A;  1S3S A;  2D7G A;  4IBJ A;  4M9X A;  2QBY B;  1IN4 A;  2LH0 A;  1HNZ M;  3LVW A;  4JI0 M;  1JR3 A;  3M0E A;  4QOS A;  1TH3 A;  2OQ4 A;  2EO2 A;  2ZBK B;  1HT2 E;  3GLI B;  3KFU G;  4JV5 M;  3U6P A;  1IBM M;  1IN6 A;  1Q3C A;  2DWL A;  3VDP A;  3GRU A;  3QAU A;  1UM8 A;  3HJ8 A;  3GLF B;  1TDZ A;  4CIS A;  4JI8 M;  3VKH A;  1IN8 A;  2QPA A;  3AJI B;  4CHT B;  3D8L A;  2ZAN A;  2XFT A;  4IBG A;  2CFO A;  2Y0Q A;  2V1C A;  3EIE A;  1L8Q A;  3K1J A;  3FUV A;  4XBO A;  4B7G A;  3D8B A;  4L78 A;  4NSO B;  4IJE A;  2RGH A;  1N33 M;  2V6Z M;  3LQR A;  3OTO M;  2D7E A;  4I81 A;  1IXZ A;  2LXE A;  5EXP A;  3UZU A;  4IBF A;  2NQ8 C;  5EP3 A;  1NNJ A;  4KLN A;  5EXT A;  2CUZ A;  3KDS E;  3KS8 A;  4WW0 A;  4LJ9 A;  3RGS A;  5EP4 A;  1FJG M;  3HJQ A;  3TQS A;  2YQZ A;  4II7 A;  4AG5 A;  2XZF A;  4DR5 M;  3U6D A;  3SAR A;  5IZ7 D;  4L15 A;  1HQC A;  4DV0 M;  4G4O A;  5KPZ A;  5BPV A;  2QCU A;  1SXJ C;  3FUT A;  2BNK A;  4PT5 A;  5KPT A;  4MH0 E;  1Q3B A;  1Z59 A;  1R2Y A;  3JAM S;  1IY2 A;  4NL4 H;  4IJF A;  2HCB A;  3GQ4 A;  3QWL A;  1GL7 A;  2VQE M;  4GC5 A;  2FE8 A;  5ITQ A;  4JI6 M;  4IBK A;  5EXS A;  4LF5 M;  4GIP A;  3NWL A;  4QNR A;  3KOW E;  2EA0 A;  3LVV A;  1IBK M;  4PD2 A;  4D82 A;  1EE8 A;  3SYL A;  4NRV A;  1G41 A;  4PCZ A;  2KXE A;  2OPF A;  3U60 B;  1Z5A A;  1ZQ9 A;  1G8P A;  4PDI A;  3T38 A;  1JR3 D;  4NSR A;  5FTL A;  4LZZ A;  2G5G X;  3SAU A;  4B3M M;  1N75 A;  4FWG A;  5DYG A;  5JI2 E;  4QHS A;  2YFQ A;  3I4V A;  3BOS A;  1XHB A;  3KOX E;  2KRU A;  2Q2E B;  4DR7 M;  4S12 A;  3HJS A;  1J7K A;  4I4L A;  1TH2 A;  2DZO B;  3K2L A;  3J7B A;  4BB9 A;  2BJV A;  3U5Z B;  4I5S A;  3FUW A;  3SHG B;  3HU3 A;  4L4U A;  1IN5 A;  3PVS A;  3W0F A;  3HHZ A;  3FKE A;  4OVZ A;  3A46 A;  1K3X A;  4G6Z A;  1PJI A;  3R8F A;  2H1R A;  3UK6 A;  3RGP A;  1GVN A;  4G4N A;  4LRS A;  1IXS B;  4GMQ A;  3GRV A;  4X62 M;  3CF0 A;  2DWN A;  1J5E M;  2HHH M;  1PJJ A;  4CGY B;  1IN7 A;  1L1Z A;  5ITU A;  3J80 S;  5C1B A;  3GPY A;  3FTD A;  3DFZ A;  4JI3 M;  3PNV A;  1R2Z A;  2CHG A;  2J7O A;  3FYD A;  3L25 A;  2M60 A;  2Z3X A;  3GPX A;  3VK8 A;  1MX0 A;  1H6U A;  3GLG A;  4LF6 M;  2XLJ A;  4HL4 A;  3FTE A;  1E32 A;  3KOZ E;  2Y20 A;  4OW0 A;  4MGZ E;  2RGO A;  2F5O A;  4AZF A;  4AKG A;  1L2D A;  4HLQ A;  1HQY E;  2Z4S A;  4G4R A;  4LGM A;  4LF9 M;  1L2B A;  3L27 A;  4YY3 M;  4B3R M;  2DVW B;  1QZM A;  3EIH A;  3CF2 A;  2R18 A;  3RFW A;  4IBD A;  1TDH A;  1QAM A;  4FVM A;  3I4Y A;  4FWD A;  3M6A A;  1G4A E;  1DGH B;  2R45 A;  2KZU A;  4DR3 M;  1SXJ A;  4DUZ M;  5ITY A;  4LF4 M;  2J7N A;  2Y0T A;  4KOD A;  2UXC M;  1XC8 A;  2Z4R A;  1NJF A;  3GRY A;  1HR0 M;  4FW9 A;  1HNW M;  3K92 A;  3GRR A;  3GP1 A;  3VK7 A;  4LF8 M;  4K0K M;  4JXJ A;  5EJC A;  3TWL A;  4M9S A;  1N78 A;  1IY1 A;  4GIT A;  4MB7 A;  4DR2 M;  4NRW A;  3L2A A;  3IG8 A;  4M9Z A;  4D80 A;  2UUA M;  4LJ5 A;  4NXM M;  2QZ4 A;  2F5N A;  4LF7 M;  3HHY A;  3KXE C;  3U61 B;  4LJ4 A;  3CTW B;  3VLF B;  4NXN M;  4DV6 M;  2CHV A;  1SXJ E;  1N77 A;  4B3T M;  1I4W A;  3VDU A;  1YUB A;  4OX9 M;  3MHV C;  4KHP M;  3SAW A;  4AG6 A;  3MK6 A;  3DOA A;  3FTF A;  2KA6 B;  3SBJ A;  1YE9 A;  2QEN A;  5JI3 E;  2R65 A;  2LWX A;  1GL6 A;  4TUW A;  4M0D A;  2F5S A;  2CEA A;  3U6C A;  1XMQ M;  3KP1 E;  2AHM A;  3AOE C;  3KVW A;  4X65 M;  1QYR A;  2KEB A;  3SC3 A;  2ZM6 M;  3LQQ A;  1C1K A;  5ITX A;  3TL4 X;  3TPZ A;  2DXI A;  3U6M A;  4EIW A;  5GKN A;  2O5R A;  1Z5C A;  4LFB M;  3KOY E;  3VFD A;  3GLH A;  4RF1 A;  4LGY A;  2L09 A;  4R3D A;  4IBE A;  4FD2 A;  4GH9 A;  4DV7 M;  2UUB M;  3WHK A;  1IY0 A;  5DYI A;  5DNY A;  1J09 A;  1XXH A;  3KW6 A;  1TGU A;  3KSJ A;  1E9S A;  1W5T A;  3ILK A;  4P16 A;  2CV0 A;  5A2Q S;  2KZS A;  3FUX A;  3L29 A;  3L28 A;  4B3S M;  3HKP A;  1KSF X;  3J81 S;  4QNM A;  1DO2 A;  7CAT A;  5ITX E;  4PDG A;  2KW0 A;  4LCB A;  1QQW A;  3HHX A;  4DR1 M;  3E4R A;  5F3W A;  3AL0 C;  5FSW A;  1GKI A;  2QBY A;  3TWM A;  4WUR A;  4X66 M;  5BR8 M;  1SXJ D;  5IRE B;  1IXR C;  2A5Y B;  4JI4 M;  3HHW A;  3E9S A;  5E6J A;  5LMU M;  3WHL A;  4A3V B;  3GLI A;  1NNU C;  8CAT A;  4LG2 A;  1DO0 A;  3MJ5 A;  1FNN A;  3A98 B;  4BLC A;  3AKZ A;  3VKG A;  3A45 A;  3ZH9 B;  1NSF A;  5EP1 A;  1HT1 E;  3SFZ A;  4NOO B;  1JQJ C;  5KQ8 A;  3SHF A;  2YR0 A;  4LZJ A;  3R9X B;  2UXB M;  4GKK M;  1I94 M;  5KQD A;  3SMS A;  4JI5 M;  4QHT A;  1OFH A;  1WXQ A;  1PM5 A;  3KSX A;  2VQF M;  4AQY M;  2R46 A;  4LJ8 A;  3AFH A;  2UUC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...