1C1KA

Bacteriophage t4 gene 59 helicase assembly protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
MIKLRMPAGGERYIDGKSVYKLYLMIKQHMNGKYDVIKYNWCMRVSDAAYQKRRDKYFFQKLSEKYKLKELALIFISNLVANQDAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIFEYNPKVQSSYIFKLLQSNIISFETFILLDSFLNIIDKHDEQTDNLVWNNYSIKLKAYRKILNIDSQKAKNVFIETVKSCKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPT4 GENE 59 HELICASE ASSEMBLY PROTEIN
publication title Bacteriophage T4 gene 59 helicase assembly protein binds replication fork DNA. The 1.45 A resolution crystal structure reveals a novel alpha-helical two-domain fold.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Dna binding protein
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08993 T4_Gp59_N T4 gene Gp59 loader of gp41 DNA helicase
A PF08994 T4_Gp59_C T4 gene Gp59 loader of gp41 DNA helicase C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1c1kA01
1.10.220.50 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Bacteriophage T4, Gp59, helicase assembly protein, C-terminal domain 1c1kA02
1IY0A 1IQPA 1HT1E 4LZZA 5EQTA 3GLHB 5FTNA 1KSFX 2QP9X 4LRTA 3GLGA 4FD2A 2X8AA 1SXJC 2ZAMA 1HT2E 1XXHA 4KO8A 4Z8XA 5EP3A 3GLIB 4LJ4A 4JN6A 5EP1A 3U5ZB 1IN5A 4LJ5A 4FWHA 4WW0A 3GLFA 3HU3A 1KYIA 5JI3E 2CEAA 5DYIA 2HCBA 1D2NA 3M6AA 4L16A 4LJ6A 3AJIB 5FTMA 1HQCA 2R65A 4FCWA 4QNMA 3VLFB 1IN7A 5C18A 1JR3A 4LJAA 2V1UA 4KODA 4FCVA 3CF0A 5DYGA 3SYLA 3WHLA 4D82A 1E94E 1HQYE 2C99A 3KW6A 2QZ4A 1NJFA 4LCBA 3D8BA 3MHVC 1XWIA 4LRSA 3M0EA 1IY1A 1JQJC 3HWSA 1OJLA 2XSZD 1NY5A 3EIHA 1UM8A 3DZDA 3GLHA 3U60B 2KRKA 1E32A 4FW9A 5EP2A 2FNAA 3VFDA 2QBYB 2CHGA 3GLIA 5EXSA 3WHKA 5EXPA 1NSFA 4QOSA 2C9CA 5FTKA 4LJ8A 4EIWA 3BOSA 4LJ7A 5C1BA 1DO0A 2CHVA 4FWGA 2QENA 2CHQA 4LGMA 4LY6A 4A3VB 3K1JA 2BJVA 4GITA 1R7RA 1QVRA 2BJWA 1FNNA 2CE7A 2C9OA 4I4LA 1C1KA 2C98A 4KLNA 2Z4RA 1IN4A 5FTLA 3U61B 2XSZA 1J7KA 1IXSB 3PVSA 1G3IA 1SXJB 3HU2A 1NJGA 4FCTA 4L4UA 5JI2E 2QPAA 4I81A 2R62A 2Z4SA 3PFIA 4QHTA 4ZPXA 3ZH9B 2ZANA 1X37A 3UK6A 2QBYA 1IXZA 1IY2A 1IN8A 4LJ9A 1XXHB 1IN6A 3SYKA 1NY6A 4D80A 3GLFB 1L8QA 3CF2A 4QNRA 2RKOA 5EXXA 1IXRC 4QHSA 1DO2A 2DWZB 4FWDA 2DVWB 5EP4A 2DZOB 3PXGA 4D81A 5FTJA 1QZMA 1S3SA 2VIIA 3HU1A 1OFIA 3B9PA 3R8FA 3KDSE 1LV7A 1IM2A 1NVMA 1JR3D 4L15A 1R6BX 2DHRA 1G4AE 2DZNB 2V6ZM 3SC3A 2ZAOA 5EXTA 1SXJE 1W5TA 3H4MA 1SXJD 1SXJA 1OFHA 1W5SA 3GLGB 2C96A 3EIEA 1G41A
chains in the Genus database with same CATH superfamily
2KA6B 2F4VM 4LZZA 2F5OA 2H1RA 3LVVA 3GPPA 2AHMA 2MROB 2QP9X 4FD2A 5GKNA 4HL4A 2XF3A 1LTMA 4IBKA 2M5ZA 4Z8XA 4NRVA 3J7AS 4R3DA 1W7BA 4JN6A 3U5ZB 3USYA 4LJ5A 4Z6YA 2K6BA 3C3EA 4GC9A 4RF0A 1RU3A 5ITXA 3GLFA 3HU3A 1KYIA 3RE8A 5BR8M 2CRUA 4QNMA 1PJSA 3VLFB 2Y21A 3K2LA 2D7EA 4LZJA 1WXQA 4LJAA 1MCXA 1E9RA 4KODA 5ITQA 3W0LB 4M9ZA 5DYGA 3AO0A 1VEGA 3AFHA 5LMNM 4MDVA 4LCBA 4PDGA 1DGBA 1NJFA 2CFOA 4PDIA 3PNVA 2ZHJA 2LNHC 2JZ1A 4CIZA 2Y0TA 2CV2A 1JQJC 3U6QA 2IICA 3I4VA 2DWLA 2QCUA 1W45A 2RANA 1UM8A 1Q02A 4IBCA 5ITYA 3PNYA 1F4IA 4FW9A 1MJGM 4KT0F 2DWNA 1WHCA 3GLIE 2ZOCA 1L2BA 2L4EA 4MGZE 2CHGA 3U6OA 5F3WA 5E26A 3U5ZA 3FTDA 3WHKA 2DAIA 1YLAA 1L2CA 1BC9A 2M60A 1QDTA 4GMQA 1QC7A 3FRIA 3T1YM 3BOSA 2X4AA 1A5TA 1ZMVA 4DV4M 1C7YA 2JY7A 4DV6M 2DAEA 1AVCA 2II2A 4G4QA 2BJVA 1ANWA 2KNAA 2Z8YM 4X64M 3VDPA 1VEKA 2MGWA 2C9OA 2QQ8A 2R4EA 2DAMA 3W67A 1P3QQ 1C1KA 2C98A 4DR7M 2ZTDA 1IN4A 2LVAA 5LMUM 2XSZA 1WGNA 3RGSA 3PVSA 2MH8A 1AVRA 4NC6A 4JMIA 3MJ5A 3GPUA 1TF0B 2ERCA 3A98B 2KNVA 3SAUA 1G59A 1XMOM 4F2LA 4MGKE 1L1TA 2RRUA 1XSZA 4GKJM 2Z4SA 1QAOA 4NOOB 4QHTA 2B3TA 3ZH9B 2ZANA 1OTRA 3H4JA 4I5SA 3SMPA 3UK6A 4JV5M 1Q3BA 1IXZA 4LGYA 4JI8M 4JK1X 1GO5A 1K82A 3QWLA 4A4PA 3HHYA 2OQ4A 1IBLM 1NY6A 1WR1B 5H37D 3KS8A 4IBIA 4GIPA 1ORYB 2UXCM 1PM5A 4G4RA 1Z5CA 4DV7M 4B3RM 5EXXA 4KN4X 2F5PA 2DWMA 3HY5A 3K8ZA 1EIJA 3ABOA 1TH2A 2DVWB 1GABA 1HNZM 2KRUA 1K3WA 2DHYA 2VIIA 2BWBA 2F5QA 3B9PA 3UJNA 2VF8A 3T38A 4GEWA 1R8ME 1XMQM 4NXMM 1R6BX 3JR5A 3BBZA 1AXNA 2RGHA 2WSFF 2ZAOA 8CATA 5EXTA 1W5TA 2NQ8C 1XJLA 1Z59A 2LHGA 2XFSA 3LMMA 1G41A 3T1HM 1NV9A 2HSNA 1IY0A 4P16A 1IQPA 4X9PA 4G4NA 4NSOB 5EQTA 1XNQM 4MH0E 5FTNA 4DV5M 1OAOC 3GLGA 4AKGA 1VQ1A 1ZMWA 3U6SA 3CF6E 2X8AA 3ABRA 1PJTA 2O25A 2R46A 2XFTA 5ITXE 3E46A 1N33M 3VK7A 2UUAM 3GLFE 1N44A 4IIWA 3GPYA 3LW5F 3UGJA 3L8NA 5JI3E 1BCZA 1OQYA 3FYCA 2WSCF 4FQ0C 1NHWC 4L16A 3GRRA 4MGHA 2KZUA 1HQCA 2R65A 3FYDA 2R0IA 1YIIA 1IN7A 3FUWA 2C5RA 3DOAA 4OVZB 5DFLA 2ZTCA 4LF4M 1A8BA 2V1UA 3CTWB 1GLNA 4X66M 1N32M 2JY8A 1PJIA 4R7GA 3FTEA 3IG5A 1YUBA 2R6FA 1TDHA 1V34A 2LWXA 4MGYE 3SYLA 3B7NA 3KOZE 4AQYM 4LF5M 2R09A 1YGMA 4GHLA 3HZJA 4L5MA 1NV8A 1BO9A 2ZBKB 3K92A 1E9SA 1GL6A 3D8BA 4DR5M 3MHVC 4Y28F 1QANA 3E9SA 3J2PB 3U6EA 3NWLA 1EE8A 1VDLA 1WIVA 2LH0A 3HWSA 2KZSA 2JY5A 3KFUG 1UPTB 1WJ7A 3SOHB 3A42A 4JI4M 1AEIA 1G5NA 2EKKA 2DKLA 3W68A 3VFDA 3L29A 2FOIC 2J5YA 2OY9A 3KVWA 4CGYB 4B7GA 3SASA 5E6JA 2R44A 5FTKA 2JNHA 3L28A 3TWMA 4IBBA 2JP7A 2QEZA 3I04M 3A46A 3KXEC 5C1BA 2ZM6M 4FWGA 3VDUA 1Q3CA 4OVZA 4R71A 2QENA 5L8RF 5DNYA 1SG9A 2KDLA 3DFZA 3JR4A 3L25A 4LF6M 3AOEC 4YY3M 3VKHA 2OO9A 4GITA 2I7PA 2R45A 3GRUA 4MM3B 1TTEA 1D0KA 2Z7JA 4I4LA 4BBAA 2VDBB 3HHXA 4DV3M 4OX9M 2EA0A 2KXEA 1OKSA 2Z4RA 1TDZA 1ALAA 3ABSA 2G3QA 3TWKA 1ZQ9A 1NHGC 2F5SA 2JY6B 1NJGA 3QAUA 4FCTA 5JI2E 4S12A 2LVPC 2R62A 1ZV1A 4PD2A 3ABQA 2BWEA 4ZPXA 4DV1M 5ITUA 1X37A 2HKJA 2VQFM 2JZ0A 3FUUA 3HJLA 3J7BA 3LCUA 3J27B 1IY2A 2KNZA 3KP0E 3J81S 4M0WA 1XXHB 2KEBA 4LFCM 3SYKA 4M9XA 2LVNC 1ZMUA 2LHCA 3KOWE 3NBIA 4AZFA 3U6MA 4JI5M 4KMUX 1QQWA 1XXHE 4JI6M 1N75A 3CF2A 2OOAA 3FRHA 2RKOA 4WURA 1IXRC 2FFJA 3KSJA 1L1ZA 5ITTA 3C9PA 5EP4A 4OW0A 2HHHM 3FTCA 3PXGA 3SARA 4D81A 4DV2M 4GHAA 3AOGA 2K0BX 4G3OA 4B08A 1OFIA 4DBGB 4PCZA 3R8FA 1IBKM 1UFZA 3KDSE 3VK8A 1IM2A 1NVMA 1JR3D 2DAKA 4L15A 2DHRA 2DZNB 1G4AE 1J5EM 3F92A 1I4AA 1GL7A 4W5WA 4DR1M 3LQRA 4AG6A 2VF7A 3HJQA 3H4MA 1R8SE 5KQ8A 1PGYA 1BC3A 3GLGB 2C96A 1HR0M 3FE3A 2LTUA 4GRIA 4IBFA 4II7A 1HT1E 3T15A 5BPVA 3SFZA 4MDUA 3GLGE 2YFQA 3HJSA 3GLHB 3U6LA 1KSFX 2DNAA 4X62M 1SXJC 2V1CA 1R5LA 1HT2E 1XXHA 4KO8A 5EP3A 4B7FA 1G8PA 5EP1A 1IN5A 2HL7A 1DM5A 4JI0M 1PJQA 4FWHA 2W82A 2KHHA 3RFWA 4X65M 2CEAA 4LJ6A 3RGPA 3M6AA 3GQ4A 4EVFA 3GQ5A 3AJIB 2XGNA 2HAKA 4RF1A 2XZUA 5C18A 4JXJA 2FH0A 2FS1A 4ANRA 4DR3M 2H0LA 4FCVA 1LKVX 4JI1M 4Z21A 2KW0A 1XNRM 2EJSA 1N78A 2EUCA 1I4WA 2QSFX 1YCNA 4D82A 1E94E 4DR4M 4OU7A 2MR9A 3SMSA 3SHFA 4QOZC 1XC8A 1XWIA 4LRSA 3M0EA 1Q39A 3ILKA 3TL4X 1IFYA 1N36M 1DGHB 1OJLA 3LTLA 4L8RC 3EIHA 3GLHA 3DZDA 3OTOM 3U60B 1QYRA 1ZAEA 4G6ZA 1GVNA 2KRKA 1E32A 2LXEA 1WGLA 4DV0M 2L09A 5EXSA 3AOEA 3B89A 3SATA 3GRYA 4QOSA 3SAWA 2C9CA 1S9DE 3A45A 2R18A 3GQ3A 2R0DA 2LVOC 1QUTA 1OIZA 4JMOA 4LJ7A 4BLCA 3I4YA 2DZLA 1DO0A 4K0KM 4KHPM 4LFBM 1SAVA 4AG5A 2E5LM 3BRXA 2CHQA 2GQFA 4LGMA 4AW4A 3U6PA 4JI2M 1BC1A 1PBVA 2JWSA 4IBJA 3GO8A 2VXGA 1BVSA 2BJWA 1OIPA 3KOXE 3W0FA 4HREA 4LG2A 1FNNA 4CJ6A 2DAGA 3NBXX 1N77A 2L6OA 4B3MM 4CHTB 2LVQD 4XGIA 1HVDA 3U61B 2HYUA 2Q2EB 4DUZM 1IXSB 1J7KA 3D8LA 4P17A 3B7ZA 3Q8XA 2XH9A 1HVEA 1SXJB 2X49A 2K6XA 4EVHA 1DGHA 3E4RA 3B74A 3TPZA 3FUTA 1W3WA 4L4UA 1XT0B 2MJ5B 1N34M 4I81A 3GPXA 4JI7M 3ZCBB 3U60A 4GH9A 2G8LA 7CATA 3PFIA 3MK6A 4L6V6 2D7GA 3ANYA 4C7PA 2UU9M 4CISA 2H0KA 4ITQA 1T3TA 1Z5AA 4B3TM 2K47A 3KP1E 5FLXS 2I7NA 1YSYA 2CWBA 1MU5A 2F5NA 3FTFA 4BB9A 1R4AE 4PT5A 1IN6A 2UXBM 2XEPA 1BCWA 1RE0B 4IBGA 4I8OA 1BCYA 5KPRA 2QHOB 3T6PA 3J80S 1HAKA 3HKPA 1K3XA 3HHZA 1NO1A 1TH4A 1QUSA 3IECA 3TE6A 4Q7JA 5IWAM 3KS4A 2DWZB 2UUBM 1YE9A 4FWDA 5ITRA 3HX3A 4M9SA 3R9XB 2A5YB 2CP8A 4XK8F 4AKIA 5FTJA 3U6CA 4IJFA 1QZMA 3L26A 1QZEA 2XZFA 4L78A 1HNWM 2D7HA 1VEJA 3HGIA 3LCVB 1TGUA 2LBCA 1JR3E 1J09A 1MN3A 2HYVA 3U61A 3DA1A 4HLQA 2VQEM 1IXSA 3K9PA 3GRVA 5FSWA 2EO2A 2OPFA 4G4OA 2XO3A 3MMPA 1V92A 4XBOA 2WZJA 1SXJD 2APLA 1SXJA 1W5SA 5KPZA 3SAVA 3EIEA 3SHGB 2J7NA 3IHPA 1OAIA 3LQQA 1R2ZA 2L7HA 3UMMA 1DGFA 1HNXM 3USWA 3AL0C 3FUXA 3KSXA 4LRTA 4JYAM 1KFVA 4LF7M 4FVMA 2ZAMA 2OOBA 1XB2B 3GLIB 2CUZA 1CUKA 4LJ4A 4NL4H 4RKUF 2Z3XA 3U6DA 2J7OA 3L2AA 4WW0A 3HHWA 1XHBA 1Y8GA 4IBDA 5DYIA 2HCBA 1D2NA 2GNOA 1JB0F 4JI3M 1L2DA 3I51A 3ZQJA 5FTMA 4FHRB 4FCWA 1QAQA 2DXIA 4AKHA 4IBEA 2JUJA 2JXNA 1JR3A 2HWJA 4OIYA 3TW5A 3M7GA 1PJJA 3FUVA 1NNJA 3B7QA 3CF0A 3QYEA 4AI6A 1HJPA 1VG5A 3WHLA 4B7HA 3HJ8A 4LFAM 1HQYE 2Y0QA 2C99A 3KW6A 2QZ4A 4MB7A 3SBJA 4RNAA 3CGWA 2FE8A 3GP1A 4KN7X 3VKGA 3FKEA 4IJEA 1TH3A 3BXWA 4NSRA 1IY1A 4DUYM 1EFUB 2IE6A 5KQDA 4M0DA 1HVGA 3GLHE 2UXDM 2K9DA 1NY5A 2XSZD 1DV0A 2UUCM 1MX0A 1T43A 4WP2A 5IT9S 3K9OA 1DGGA 4JWLA 5EP2A 4GKKM 1Z6TA 2FNAA 2QBYB 3I01M 1ANNA 3GLIA 1AOWA 2QNJA 1N42A 1N41A 2XLJA 5EXPA 2XO2A 1NSFA 3Q8GA 4F1IA 1G71A 2O5RA 4LJ8A 4EIWA 1PRBA 1D0LA 4YHHM 3C3DA 1VDDA 2CV0A 2CHVA 4NRWA 2L2DA 1R8QE 1T6OA 1HVFA 4LY6A 4A3VB 2JA2A 3K1JA 4NXNM 2YQZA 1FJGM 1NNUC 1R7RA 1QVRA 1QDRA 1AVHA 1N00A 1QAMA 2CE7A 1DK5A 1KU1A 1Z5BA 3QYBA 2DI0A 2N35A 4REZA 4KLNA 1AUAA 1AIPC 5FTLA 2P5TA 3JAMS 4TUWA 1GJSA 4C0AA 5IZ7D 2WSEF 4DR2M 1G3IA 3HU2A 1R2YA 1TR8A 4HEOA 2QPAA 5A2QS 1I94M 1ANXA 3TQSA 4LF9M 1GJTA 2H5XA 2R4JA 1BC0A 3C58A 2EKFA 3ZC7B 3AV0A 2QBYA 1HM6A 1IBMM 5EJCA 4LJ9A 1IN8A 3SWVA 2G5GX 1Q8DA 3KOYE 3UZUA 4Q2SA 1R4GA 4D80A 2O01F 3E21A 1D0MA 1H6UA 1L8QA 3GLFB 3IG8A 3FD9A 2RGOA 4MGIE 4QNRA 2Q4CA 2ZHIA 4QHSA 1DO2A 4DR6M 2L4FA 4B3SM 3THGA 1GKIA 4UN2B 1M9IA 2IE7A 2DZOB 4D7QA 5KO3A 3AKZA 2H0MA 1AIIA 1S3SA 3HU1A 3V76A 3AJCA 2YR0A 3L27A 2DENA 1LV7A 4GC5A 1YJ0A 5KPTA 2YNMD 3TWLA 2V6ZM 2L7IA 3LVWA 3SC3A 1SXJE 2HYWA 4JXHA 4LF8M 4D7RA 2CV1A 1OFHA 1A8AA 2BNKA 2Y20A 1V33A 5IREB
chains in the Genus database with same CATH topology
2KA6B 2F4VM 4LZZA 2F5OA 2H1RA 3LVVA 3GPPA 2AHMA 2QP9X 4FD2A 5GKNA 4HL4A 2XF3A 4IBKA 2M5ZA 4Z8XA 4NRVA 3J7AS 4R3DA 4JN6A 3U5ZB 4LJ5A 4Z6YA 5ITXA 4GC9A 4RF0A 3GLFA 3HU3A 1KYIA 3RE8A 5BR8M 4QNMA 3VLFB 2Y21A 3K2LA 2D7EA 4LZJA 1WXQA 4LJAA 1E9RA 4KODA 5ITQA 3W0LB 4M9ZA 5DYGA 3AFHA 5LMNM 4LCBA 4PDGA 1DGBA 1NJFA 2CFOA 4PDIA 3PNVA 2LNHC 2Y0TA 2CV2A 1JQJC 3U6QA 3I4VA 2DWLA 2QCUA 1UM8A 4IBCA 5ITYA 3PNYA 4FW9A 2DWNA 1L2BA 4MGZE 3U6OA 2CHGA 5F3WA 5E26A 3U5ZA 3FTDA 3WHKA 1L2CA 2M60A 4GMQA 3T1YM 3BOSA 2X4AA 4DV4M 4DV6M 4G4QA 2BJVA 4X64M 3VDPA 2C9OA 2R4EA 1C1KA 2C98A 4DR7M 1IN4A 5LMUM 2XSZA 3RGSA 3PVSA 3MJ5A 3GPUA 2ERCA 3A98B 1G59A 3SAUA 1XMOM 1L1TA 4MGKE 4GKJM 2Z4SA 1QAOA 4NOOB 4QHTA 3ZH9B 2ZANA 4I5SA 3UK6A 3SMPA 4JV5M 1Q3BA 1IXZA 4LGYA 4JI8M 1K82A 3QWLA 3HHYA 2OQ4A 1IBLM 1NY6A 5H37D 3KS8A 4IBIA 4GIPA 1ORYB 2UXCM 1PM5A 4G4RA 1Z5CA 4DV7M 4B3RM 5EXXA 2F5PA 2DWMA 3K8ZA 1TH2A 2DVWB 1HNZM 2KRUA 1K3WA 2VIIA 2F5QA 3B9PA 3UJNA 3T38A 1XMQM 4NXMM 1R6BX 3JR5A 2RGHA 2ZAOA 8CATA 5EXTA 1W5TA 2NQ8C 1Z59A 2XFSA 3LMMA 1G41A 3T1HM 1IY0A 4P16A 1IQPA 4G4NA 4NSOB 5EQTA 1XNQM 4MH0E 5FTNA 4DV5M 3GLGA 4AKGA 3U6SA 3CF6E 2X8AA 2R46A 2XFTA 5ITXE 1N33M 3VK7A 2UUAM 4IIWA 3GPYA 3UGJA 5JI3E 3FYCA 1NHWC 4L16A 3GRRA 4MGHA 2KZUA 1HQCA 2R65A 3FYDA 1IN7A 3FUWA 2C5RA 3DOAA 4OVZB 4LF4M 2V1UA 3CTWB 1GLNA 4X66M 1N32M 1PJIA 4R7GA 3FTEA 3IG5A 1YUBA 1TDHA 2LWXA 4MGYE 3SYLA 3KOZE 4AQYM 4LF5M 4GHLA 2ZBKB 3K92A 1E9SA 1GL6A 3D8BA 4DR5M 3MHVC 1QANA 3E9SA 3J2PB 3U6EA 3NWLA 1EE8A 2LH0A 3HWSA 2KZSA 3KFUG 3A42A 4JI4M 3VFDA 3L29A 2FOIC 3KVWA 4CGYB 4B7GA 3SASA 5E6JA 5FTKA 3L28A 3TWMA 4IBBA 3A46A 3KXEC 5C1BA 2ZM6M 4FWGA 3VDUA 1Q3CA 4OVZA 5DNYA 2QENA 3DFZA 3JR4A 3L25A 4LF6M 3AOEC 4YY3M 3VKHA 4GITA 2I7PA 2R45A 3GRUA 4MM3B 2Z7JA 4I4LA 4BBAA 3HHXA 4DV3M 4OX9M 2EA0A 2KXEA 2Z4RA 1TDZA 3TWKA 1ZQ9A 1NHGC 2F5SA 1NJGA 3QAUA 4FCTA 5JI2E 4S12A 2R62A 4PD2A 4ZPXA 4DV1M 5ITUA 1X37A 2HKJA 2VQFM 3FUUA 3J7BA 3J27B 1IY2A 3KP0E 3J81S 4M0WA 1XXHB 2KEBA 4LFCM 3SYKA 4M9XA 3NBIA 4AZFA 4JI5M 3KOWE 3U6MA 1QQWA 4JI6M 1N75A 3CF2A 1L1ZA 2RKOA 4WURA 1IXRC 2FFJA 3KSJA 5ITTA 2HHHM 5EP4A 4OW0A 3SARA 3FTCA 3PXGA 4D81A 4DV2M 4GHAA 3AOGA 4B08A 1OFIA 4PCZA 1IBKM 3R8FA 3KDSE 3VK8A 1IM2A 1NVMA 1JR3D 4L15A 2DHRA 2DZNB 1G4AE 1J5EM 1GL7A 4W5WA 4DR1M 3LQRA 4AG6A 3HJQA 3H4MA 5KQ8A 3GLGB 2C96A 1HR0M 4GRIA 4IBFA 4II7A 1HT1E 3T15A 5BPVA 3SFZA 2YFQA 3HJSA 3GLHB 3U6LA 1KSFX 4X62M 1SXJC 2V1CA 4B7FA 1HT2E 1XXHA 4KO8A 5EP3A 1G8PA 5EP1A 1IN5A 2HL7A 4JI0M 4FWHA 2W82A 3RFWA 4X65M 2CEAA 4LJ6A 3RGPA 3M6AA 3GQ4A 3GQ5A 3AJIB 2XGNA 4RF1A 2XZUA 5C18A 4JXJA 4DR3M 4FCVA 4JI1M 2KW0A 1XNRM 1N78A 2EUCA 1I4WA 4D82A 1E94E 4DR4M 4OU7A 3SMSA 3SHFA 4QOZC 1XC8A 1XWIA 4LRSA 3M0EA 1Q39A 3ILKA 3TL4X 1N36M 1DGHB 1OJLA 4L8RC 3EIHA 3GLHA 3DZDA 3OTOM 3U60B 1QYRA 1ZAEA 4G6ZA 1GVNA 2KRKA 1E32A 2LXEA 4DV0M 2L09A 5EXSA 3AOEA 3SATA 3GRYA 4QOSA 3SAWA 2C9CA 3A45A 2R18A 3GQ3A 4LJ7A 4BLCA 3I4YA 1DO0A 4K0KM 4KHPM 4LFBM 4AG5A 2E5LM 2CHQA 4LGMA 4AW4A 3U6PA 4JI2M 4IBJA 3GO8A 2BJWA 3KOXE 3W0FA 4LG2A 1FNNA 1N77A 2L6OA 4B3MM 4CHTB 4XGIA 3U61B 2Q2EB 4DUZM 1J7KA 1IXSB 3D8LA 3Q8XA 2XH9A 1SXJB 2X49A 1DGHA 3E4RA 3TPZA 3FUTA 4L4UA 1N34M 4JI7M 4I81A 3GPXA 3ZCBB 3U60A 4GH9A 2G8LA 7CATA 3PFIA 3MK6A 2D7GA 2UU9M 4CISA 4ITQA 1T3TA 1Z5AA 4B3TM 2K47A 3KP1E 5FLXS 2I7NA 1YSYA 3FTFA 1MU5A 2F5NA 4BB9A 4PT5A 1IN6A 2UXBM 2XEPA 4IBGA 4I8OA 5KPRA 3J80S 3HKPA 1K3XA 3HHZA 1TH4A 3TE6A 5IWAM 3KS4A 2DWZB 2UUBM 1YE9A 4FWDA 5ITRA 4M9SA 3R9XB 2A5YB 4AKIA 5FTJA 3U6CA 4IJFA 1QZMA 3L26A 2XZFA 4L78A 1HNWM 2D7HA 3HGIA 1TGUA 1J09A 3U61A 3DA1A 4HLQA 2VQEM 4G4OA 3GRVA 5FSWA 2EO2A 2OPFA 4XBOA 1SXJD 1SXJA 1W5SA 5KPZA 3SAVA 3EIEA 3SHGB 2J7NA 3LQQA 1R2ZA 2L7HA 3UMMA 1DGFA 1HNXM 3AL0C 3FUXA 3KSXA 4LRTA 4JYAM 1KFVA 4LF7M 4FVMA 2ZAMA 3GLIB 2CUZA 4LJ4A 4NL4H 2Z3XA 3U6DA 2J7OA 3L2AA 4WW0A 3HHWA 1XHBA 4IBDA 5DYIA 2HCBA 1D2NA 1L2DA 4JI3M 3I51A 5FTMA 4FCWA 1QAQA 2DXIA 4AKHA 4IBEA 1JR3A 3M7GA 1PJJA 3FUVA 1NNJA 3CF0A 4AI6A 3WHLA 4B7HA 3HJ8A 4LFAM 1HQYE 2Y0QA 2C99A 3KW6A 2QZ4A 4MB7A 3SBJA 4RNAA 2FE8A 3GP1A 3VKGA 3FKEA 4IJEA 1TH3A 4NSRA 1IY1A 4DUYM 5KQDA 4M0DA 2UXDM 2XSZD 1NY5A 2UUCM 1MX0A 5IT9S 1DGGA 5EP2A 4GKKM 1Z6TA 2FNAA 2QBYB 3GLIA 2XLJA 5EXPA 1NSFA 2O5RA 4LJ8A 4EIWA 4YHHM 1VDDA 2CV0A 2CHVA 4NRWA 4LY6A 4A3VB 2JA2A 3K1JA 4NXNM 2YQZA 1FJGM 1NNUC 1R7RA 1QVRA 1QAMA 2CE7A 1Z5BA 4REZA 4KLNA 5FTLA 2P5TA 3JAMS 4TUWA 5IZ7D 4DR2M 1G3IA 3HU2A 1R2YA 2QPAA 5A2QS 1I94M 3TQSA 4LF9M 2R4JA 3ZC7B 3AV0A 2QBYA 1IBMM 5EJCA 4LJ9A 1IN8A 2G5GX 3KOYE 3UZUA 4D80A 1H6UA 1L8QA 3GLFB 3IG8A 3FD9A 2RGOA 4MGIE 4QNRA 4QHSA 1DO2A 4DR6M 4B3SM 3THGA 1GKIA 2DZOB 5KO3A 3AKZA 1S3SA 3HU1A 2YR0A 3L27A 4GC5A 1LV7A 5KPTA 2YNMD 3TWLA 2V6ZM 2L7IA 3LVWA 3SC3A 1SXJE 4LF8M 2CV1A 1OFHA 2BNKA 2Y20A 3C58A 5IREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY0 A;  1IQP A;  1HT1 E;  4LZZ A;  5EQT A;  3GLH B;  5FTN A;  1KSF X;  2QP9 X;  4LRT A;  3GLG A;  4FD2 A;  2X8A A;  1SXJ C;  2ZAM A;  1HT2 E;  1XXH A;  4KO8 A;  4Z8X A;  5EP3 A;  3GLI B;  4LJ4 A;  4JN6 A;  5EP1 A;  3U5Z B;  1IN5 A;  4LJ5 A;  4FWH A;  4WW0 A;  3GLF A;  3HU3 A;  1KYI A;  5JI3 E;  2CEA A;  5DYI A;  2HCB A;  1D2N A;  3M6A A;  4L16 A;  4LJ6 A;  3AJI B;  5FTM A;  1HQC A;  2R65 A;  4FCW A;  4QNM A;  3VLF B;  1IN7 A;  5C18 A;  1JR3 A;  4LJA A;  2V1U A;  4KOD A;  4FCV A;  3CF0 A;  5DYG A;  3SYL A;  3WHL A;  4D82 A;  1E94 E;  1HQY E;  2C99 A;  3KW6 A;  2QZ4 A;  1NJF A;  4LCB A;  3D8B A;  3MHV C;  1XWI A;  4LRS A;  3M0E A;  1IY1 A;  1JQJ C;  3HWS A;  1OJL A;  2XSZ D;  1NY5 A;  3EIH A;  1UM8 A;  3DZD A;  3GLH A;  3U60 B;  2KRK A;  1E32 A;  4FW9 A;  5EP2 A;  2FNA A;  3VFD A;  2QBY B;  2CHG A;  3GLI A;  5EXS A;  3WHK A;  5EXP A;  1NSF A;  4QOS A;  2C9C A;  5FTK A;  4LJ8 A;  4EIW A;  3BOS A;  4LJ7 A;  5C1B A;  1DO0 A;  2CHV A;  4FWG A;  2QEN A;  2CHQ A;  4LGM A;  4LY6 A;  4A3V B;  3K1J A;  2BJV A;  4GIT A;  1R7R A;  1QVR A;  2BJW A;  1FNN A;  2CE7 A;  2C9O A;  4I4L A;  1C1K A;  2C98 A;  4KLN A;  2Z4R A;  1IN4 A;  5FTL A;  3U61 B;  2XSZ A;  1J7K A;  1IXS B;  3PVS A;  1G3I A;  1SXJ B;  3HU2 A;  1NJG A;  4FCT A;  4L4U A;  5JI2 E;  2QPA A;  4I81 A;  2R62 A;  2Z4S A;  3PFI A;  4QHT A;  4ZPX A;  3ZH9 B;  2ZAN A;  1X37 A;  3UK6 A;  2QBY A;  1IXZ A;  1IY2 A;  1IN8 A;  4LJ9 A;  1XXH B;  1IN6 A;  3SYK A;  1NY6 A;  4D80 A;  3GLF B;  1L8Q A;  3CF2 A;  4QNR A;  2RKO A;  5EXX A;  1IXR C;  4QHS A;  1DO2 A;  2DWZ B;  4FWD A;  2DVW B;  5EP4 A;  2DZO B;  3PXG A;  4D81 A;  5FTJ A;  1QZM A;  1S3S A;  2VII A;  3HU1 A;  1OFI A;  3B9P A;  3R8F A;  3KDS E;  1LV7 A;  1IM2 A;  1NVM A;  1JR3 D;  4L15 A;  1R6B X;  2DHR A;  1G4A E;  2DZN B;  2V6Z M;  3SC3 A;  2ZAO A;  5EXT A;  1SXJ E;  1W5T A;  3H4M A;  1SXJ D;  1SXJ A;  1OFH A;  1W5S A;  3GLG B;  2C96 A;  3EIE A;  1G41 A; 
#chains in the Genus database with same CATH topology
 2KA6 B;  2F4V M;  4LZZ A;  2F5O A;  2H1R A;  3LVV A;  3GPP A;  2AHM A;  2MRO B;  2QP9 X;  4FD2 A;  5GKN A;  4HL4 A;  2XF3 A;  1LTM A;  4IBK A;  2M5Z A;  4Z8X A;  4NRV A;  3J7A S;  4R3D A;  1W7B A;  4JN6 A;  3U5Z B;  3USY A;  4LJ5 A;  4Z6Y A;  2K6B A;  3C3E A;  4GC9 A;  4RF0 A;  1RU3 A;  5ITX A;  3GLF A;  3HU3 A;  1KYI A;  3RE8 A;  5BR8 M;  2CRU A;  4QNM A;  1PJS A;  3VLF B;  2Y21 A;  3K2L A;  2D7E A;  4LZJ A;  1WXQ A;  4LJA A;  1MCX A;  1E9R A;  4KOD A;  5ITQ A;  3W0L B;  4M9Z A;  5DYG A;  3AO0 A;  1VEG A;  3AFH A;  5LMN M;  4MDV A;  4LCB A;  4PDG A;  1DGB A;  1NJF A;  2CFO A;  4PDI A;  3PNV A;  2ZHJ A;  2LNH C;  2JZ1 A;  4CIZ A;  2Y0T A;  2CV2 A;  1JQJ C;  3U6Q A;  2IIC A;  3I4V A;  2DWL A;  2QCU A;  1W45 A;  2RAN A;  1UM8 A;  1Q02 A;  4IBC A;  5ITY A;  3PNY A;  1F4I A;  4FW9 A;  1MJG M;  4KT0 F;  2DWN A;  1WHC A;  3GLI E;  2ZOC A;  1L2B A;  2L4E A;  4MGZ E;  2CHG A;  3U6O A;  5F3W A;  5E26 A;  3U5Z A;  3FTD A;  3WHK A;  2DAI A;  1YLA A;  1L2C A;  1BC9 A;  2M60 A;  1QDT A;  4GMQ A;  1QC7 A;  3FRI A;  3T1Y M;  3BOS A;  2X4A A;  1A5T A;  1ZMV A;  4DV4 M;  1C7Y A;  2JY7 A;  4DV6 M;  2DAE A;  1AVC A;  2II2 A;  4G4Q A;  2BJV A;  1ANW A;  2KNA A;  2Z8Y M;  4X64 M;  3VDP A;  1VEK A;  2MGW A;  2C9O A;  2QQ8 A;  2R4E A;  2DAM A;  3W67 A;  1P3Q Q;  1C1K A;  2C98 A;  4DR7 M;  2ZTD A;  1IN4 A;  2LVA A;  5LMU M;  2XSZ A;  1WGN A;  3RGS A;  3PVS A;  2MH8 A;  1AVR A;  4NC6 A;  4JMI A;  3MJ5 A;  3GPU A;  1TF0 B;  2ERC A;  3A98 B;  2KNV A;  3SAU A;  1G59 A;  1XMO M;  4F2L A;  4MGK E;  1L1T A;  2RRU A;  1XSZ A;  4GKJ M;  2Z4S A;  1QAO A;  4NOO B;  4QHT A;  2B3T A;  3ZH9 B;  2ZAN A;  1OTR A;  3H4J A;  4I5S A;  3SMP A;  3UK6 A;  4JV5 M;  1Q3B A;  1IXZ A;  4LGY A;  4JI8 M;  4JK1 X;  1GO5 A;  1K82 A;  3QWL A;  4A4P A;  3HHY A;  2OQ4 A;  1IBL M;  1NY6 A;  1WR1 B;  5H37 D;  3KS8 A;  4IBI A;  4GIP A;  1ORY B;  2UXC M;  1PM5 A;  4G4R A;  1Z5C A;  4DV7 M;  4B3R M;  5EXX A;  4KN4 X;  2F5P A;  2DWM A;  3HY5 A;  3K8Z A;  1EIJ A;  3ABO A;  1TH2 A;  2DVW B;  1GAB A;  1HNZ M;  2KRU A;  1K3W A;  2DHY A;  2VII A;  2BWB A;  2F5Q A;  3B9P A;  3UJN A;  2VF8 A;  3T38 A;  4GEW A;  1R8M E;  1XMQ M;  4NXM M;  1R6B X;  3JR5 A;  3BBZ A;  1AXN A;  2RGH A;  2WSF F;  2ZAO A;  8CAT A;  5EXT A;  1W5T A;  2NQ8 C;  1XJL A;  1Z59 A;  2LHG A;  2XFS A;  3LMM A;  1G41 A;  3T1H M;  1NV9 A;  2HSN A;  1IY0 A;  4P16 A;  1IQP A;  4X9P A;  4G4N A;  4NSO B;  5EQT A;  1XNQ M;  4MH0 E;  5FTN A;  4DV5 M;  1OAO C;  3GLG A;  4AKG A;  1VQ1 A;  1ZMW A;  3U6S A;  3CF6 E;  2X8A A;  3ABR A;  1PJT A;  2O25 A;  2R46 A;  2XFT A;  5ITX E;  3E46 A;  1N33 M;  3VK7 A;  2UUA M;  3GLF E;  1N44 A;  4IIW A;  3GPY A;  3LW5 F;  3UGJ A;  3L8N A;  5JI3 E;  1BCZ A;  1OQY A;  3FYC A;  2WSC F;  4FQ0 C;  1NHW C;  4L16 A;  3GRR A;  4MGH A;  2KZU A;  1HQC A;  2R65 A;  3FYD A;  2R0I A;  1YII A;  1IN7 A;  3FUW A;  2C5R A;  3DOA A;  4OVZ B;  5DFL A;  2ZTC A;  4LF4 M;  1A8B A;  2V1U A;  3CTW B;  1GLN A;  4X66 M;  1N32 M;  2JY8 A;  1PJI A;  4R7G A;  3FTE A;  3IG5 A;  1YUB A;  2R6F A;  1TDH A;  1V34 A;  2LWX A;  4MGY E;  3SYL A;  3B7N A;  3KOZ E;  4AQY M;  4LF5 M;  2R09 A;  1YGM A;  4GHL A;  3HZJ A;  4L5M A;  1NV8 A;  1BO9 A;  2ZBK B;  3K92 A;  1E9S A;  1GL6 A;  3D8B A;  4DR5 M;  3MHV C;  4Y28 F;  1QAN A;  3E9S A;  3J2P B;  3U6E A;  3NWL A;  1EE8 A;  1VDL A;  1WIV A;  2LH0 A;  3HWS A;  2KZS A;  2JY5 A;  3KFU G;  1UPT B;  1WJ7 A;  3SOH B;  3A42 A;  4JI4 M;  1AEI A;  1G5N A;  2EKK A;  2DKL A;  3W68 A;  3VFD A;  3L29 A;  2FOI C;  2J5Y A;  2OY9 A;  3KVW A;  4CGY B;  4B7G A;  3SAS A;  5E6J A;  2R44 A;  5FTK A;  2JNH A;  3L28 A;  3TWM A;  4IBB A;  2JP7 A;  2QEZ A;  3I04 M;  3A46 A;  3KXE C;  5C1B A;  2ZM6 M;  4FWG A;  3VDU A;  1Q3C A;  4OVZ A;  4R71 A;  2QEN A;  5L8R F;  5DNY A;  1SG9 A;  2KDL A;  3DFZ A;  3JR4 A;  3L25 A;  4LF6 M;  3AOE C;  4YY3 M;  3VKH A;  2OO9 A;  4GIT A;  2I7P A;  2R45 A;  3GRU A;  4MM3 B;  1TTE A;  1D0K A;  2Z7J A;  4I4L A;  4BBA A;  2VDB B;  3HHX A;  4DV3 M;  4OX9 M;  2EA0 A;  2KXE A;  1OKS A;  2Z4R A;  1TDZ A;  1ALA A;  3ABS A;  2G3Q A;  3TWK A;  1ZQ9 A;  1NHG C;  2F5S A;  2JY6 B;  1NJG A;  3QAU A;  4FCT A;  5JI2 E;  4S12 A;  2LVP C;  2R62 A;  1ZV1 A;  4PD2 A;  3ABQ A;  2BWE A;  4ZPX A;  4DV1 M;  5ITU A;  1X37 A;  2HKJ A;  2VQF M;  2JZ0 A;  3FUU A;  3HJL A;  3J7B A;  3LCU A;  3J27 B;  1IY2 A;  2KNZ A;  3KP0 E;  3J81 S;  4M0W A;  1XXH B;  2KEB A;  4LFC M;  3SYK A;  4M9X A;  2LVN C;  1ZMU A;  2LHC A;  3KOW E;  3NBI A;  4AZF A;  3U6M A;  4JI5 M;  4KMU X;  1QQW A;  1XXH E;  4JI6 M;  1N75 A;  3CF2 A;  2OOA A;  3FRH A;  2RKO A;  4WUR A;  1IXR C;  2FFJ A;  3KSJ A;  1L1Z A;  5ITT A;  3C9P A;  5EP4 A;  4OW0 A;  2HHH M;  3FTC A;  3PXG A;  3SAR A;  4D81 A;  4DV2 M;  4GHA A;  3AOG A;  2K0B X;  4G3O A;  4B08 A;  1OFI A;  4DBG B;  4PCZ A;  3R8F A;  1IBK M;  1UFZ A;  3KDS E;  3VK8 A;  1IM2 A;  1NVM A;  1JR3 D;  2DAK A;  4L15 A;  2DHR A;  2DZN B;  1G4A E;  1J5E M;  3F92 A;  1I4A A;  1GL7 A;  4W5W A;  4DR1 M;  3LQR A;  4AG6 A;  2VF7 A;  3HJQ A;  3H4M A;  1R8S E;  5KQ8 A;  1PGY A;  1BC3 A;  3GLG B;  2C96 A;  1HR0 M;  3FE3 A;  2LTU A;  4GRI A;  4IBF A;  4II7 A;  1HT1 E;  3T15 A;  5BPV A;  3SFZ A;  4MDU A;  3GLG E;  2YFQ A;  3HJS A;  3GLH B;  3U6L A;  1KSF X;  2DNA A;  4X62 M;  1SXJ C;  2V1C A;  1R5L A;  1HT2 E;  1XXH A;  4KO8 A;  5EP3 A;  4B7F A;  1G8P A;  5EP1 A;  1IN5 A;  2HL7 A;  1DM5 A;  4JI0 M;  1PJQ A;  4FWH A;  2W82 A;  2KHH A;  3RFW A;  4X65 M;  2CEA A;  4LJ6 A;  3RGP A;  3M6A A;  3GQ4 A;  4EVF A;  3GQ5 A;  3AJI B;  2XGN A;  2HAK A;  4RF1 A;  2XZU A;  5C18 A;  4JXJ A;  2FH0 A;  2FS1 A;  4ANR A;  4DR3 M;  2H0L A;  4FCV A;  1LKV X;  4JI1 M;  4Z21 A;  2KW0 A;  1XNR M;  2EJS A;  1N78 A;  2EUC A;  1I4W A;  2QSF X;  1YCN A;  4D82 A;  1E94 E;  4DR4 M;  4OU7 A;  2MR9 A;  3SMS A;  3SHF A;  4QOZ C;  1XC8 A;  1XWI A;  4LRS A;  3M0E A;  1Q39 A;  3ILK A;  3TL4 X;  1IFY A;  1N36 M;  1DGH B;  1OJL A;  3LTL A;  4L8R C;  3EIH A;  3GLH A;  3DZD A;  3OTO M;  3U60 B;  1QYR A;  1ZAE A;  4G6Z A;  1GVN A;  2KRK A;  1E32 A;  2LXE A;  1WGL A;  4DV0 M;  2L09 A;  5EXS A;  3AOE A;  3B89 A;  3SAT A;  3GRY A;  4QOS A;  3SAW A;  2C9C A;  1S9D E;  3A45 A;  2R18 A;  3GQ3 A;  2R0D A;  2LVO C;  1QUT A;  1OIZ A;  4JMO A;  4LJ7 A;  4BLC A;  3I4Y A;  2DZL A;  1DO0 A;  4K0K M;  4KHP M;  4LFB M;  1SAV A;  4AG5 A;  2E5L M;  3BRX A;  2CHQ A;  2GQF A;  4LGM A;  4AW4 A;  3U6P A;  4JI2 M;  1BC1 A;  1PBV A;  2JWS A;  4IBJ A;  3GO8 A;  2VXG A;  1BVS A;  2BJW A;  1OIP A;  3KOX E;  3W0F A;  4HRE A;  4LG2 A;  1FNN A;  4CJ6 A;  2DAG A;  3NBX X;  1N77 A;  2L6O A;  4B3M M;  4CHT B;  2LVQ D;  4XGI A;  1HVD A;  3U61 B;  2HYU A;  2Q2E B;  4DUZ M;  1IXS B;  1J7K A;  3D8L A;  4P17 A;  3B7Z A;  3Q8X A;  2XH9 A;  1HVE A;  1SXJ B;  2X49 A;  2K6X A;  4EVH A;  1DGH A;  3E4R A;  3B74 A;  3TPZ A;  3FUT A;  1W3W A;  4L4U A;  1XT0 B;  2MJ5 B;  1N34 M;  4I81 A;  3GPX A;  4JI7 M;  3ZCB B;  3U60 A;  4GH9 A;  2G8L A;  7CAT A;  3PFI A;  3MK6 A;  4L6V 6;  2D7G A;  3ANY A;  4C7P A;  2UU9 M;  4CIS A;  2H0K A;  4ITQ A;  1T3T A;  1Z5A A;  4B3T M;  2K47 A;  3KP1 E;  5FLX S;  2I7N A;  1YSY A;  2CWB A;  1MU5 A;  2F5N A;  3FTF A;  4BB9 A;  1R4A E;  4PT5 A;  1IN6 A;  2UXB M;  2XEP A;  1BCW A;  1RE0 B;  4IBG A;  4I8O A;  1BCY A;  5KPR A;  2QHO B;  3T6P A;  3J80 S;  1HAK A;  3HKP A;  1K3X A;  3HHZ A;  1NO1 A;  1TH4 A;  1QUS A;  3IEC A;  3TE6 A;  4Q7J A;  5IWA M;  3KS4 A;  2DWZ B;  2UUB M;  1YE9 A;  4FWD A;  5ITR A;  3HX3 A;  4M9S A;  3R9X B;  2A5Y B;  2CP8 A;  4XK8 F;  4AKI A;  5FTJ A;  3U6C A;  4IJF A;  1QZM A;  3L26 A;  1QZE A;  2XZF A;  4L78 A;  1HNW M;  2D7H A;  1VEJ A;  3HGI A;  3LCV B;  1TGU A;  2LBC A;  1JR3 E;  1J09 A;  1MN3 A;  2HYV A;  3U61 A;  3DA1 A;  4HLQ A;  2VQE M;  1IXS A;  3K9P A;  3GRV A;  5FSW A;  2EO2 A;  2OPF A;  4G4O A;  2XO3 A;  3MMP A;  1V92 A;  4XBO A;  2WZJ A;  1SXJ D;  2APL A;  1SXJ A;  1W5S A;  5KPZ A;  3SAV A;  3EIE A;  3SHG B;  2J7N A;  3IHP A;  1OAI A;  3LQQ A;  1R2Z A;  2L7H A;  3UMM A;  1DGF A;  1HNX M;  3USW A;  3AL0 C;  3FUX A;  3KSX A;  4LRT A;  4JYA M;  1KFV A;  4LF7 M;  4FVM A;  2ZAM A;  2OOB A;  1XB2 B;  3GLI B;  2CUZ A;  1CUK A;  4LJ4 A;  4NL4 H;  4RKU F;  2Z3X A;  3U6D A;  2J7O A;  3L2A A;  4WW0 A;  3HHW A;  1XHB A;  1Y8G A;  4IBD A;  5DYI A;  2HCB A;  1D2N A;  2GNO A;  1JB0 F;  4JI3 M;  1L2D A;  3I51 A;  3ZQJ A;  5FTM A;  4FHR B;  4FCW A;  1QAQ A;  2DXI A;  4AKH A;  4IBE A;  2JUJ A;  2JXN A;  1JR3 A;  2HWJ A;  4OIY A;  3TW5 A;  3M7G A;  1PJJ A;  3FUV A;  1NNJ A;  3B7Q A;  3CF0 A;  3QYE A;  4AI6 A;  1HJP A;  1VG5 A;  3WHL A;  4B7H A;  3HJ8 A;  4LFA M;  1HQY E;  2Y0Q A;  2C99 A;  3KW6 A;  2QZ4 A;  4MB7 A;  3SBJ A;  4RNA A;  3CGW A;  2FE8 A;  3GP1 A;  4KN7 X;  3VKG A;  3FKE A;  4IJE A;  1TH3 A;  3BXW A;  4NSR A;  1IY1 A;  4DUY M;  1EFU B;  2IE6 A;  5KQD A;  4M0D A;  1HVG A;  3GLH E;  2UXD M;  2K9D A;  1NY5 A;  2XSZ D;  1DV0 A;  2UUC M;  1MX0 A;  1T43 A;  4WP2 A;  5IT9 S;  3K9O A;  1DGG A;  4JWL A;  5EP2 A;  4GKK M;  1Z6T A;  2FNA A;  2QBY B;  3I01 M;  1ANN A;  3GLI A;  1AOW A;  2QNJ A;  1N42 A;  1N41 A;  2XLJ A;  5EXP A;  2XO2 A;  1NSF A;  3Q8G A;  4F1I A;  1G71 A;  2O5R A;  4LJ8 A;  4EIW A;  1PRB A;  1D0L A;  4YHH M;  3C3D A;  1VDD A;  2CV0 A;  2CHV A;  4NRW A;  2L2D A;  1R8Q E;  1T6O A;  1HVF A;  4LY6 A;  4A3V B;  2JA2 A;  3K1J A;  4NXN M;  2YQZ A;  1FJG M;  1NNU C;  1R7R A;  1QVR A;  1QDR A;  1AVH A;  1N00 A;  1QAM A;  2CE7 A;  1DK5 A;  1KU1 A;  1Z5B A;  3QYB A;  2DI0 A;  2N35 A;  4REZ A;  4KLN A;  1AUA A;  1AIP C;  5FTL A;  2P5T A;  3JAM S;  4TUW A;  1GJS A;  4C0A A;  5IZ7 D;  2WSE F;  4DR2 M;  1G3I A;  3HU2 A;  1R2Y A;  1TR8 A;  4HEO A;  2QPA A;  5A2Q S;  1I94 M;  1ANX A;  3TQS A;  4LF9 M;  1GJT A;  2H5X A;  2R4J A;  1BC0 A;  3C58 A;  2EKF A;  3ZC7 B;  3AV0 A;  2QBY A;  1HM6 A;  1IBM M;  5EJC A;  4LJ9 A;  1IN8 A;  3SWV A;  2G5G X;  1Q8D A;  3KOY E;  3UZU A;  4Q2S A;  1R4G A;  4D80 A;  2O01 F;  3E21 A;  1D0M A;  1H6U A;  1L8Q A;  3GLF B;  3IG8 A;  3FD9 A;  2RGO A;  4MGI E;  4QNR A;  2Q4C A;  2ZHI A;  4QHS A;  1DO2 A;  4DR6 M;  2L4F A;  4B3S M;  3THG A;  1GKI A;  4UN2 B;  1M9I A;  2IE7 A;  2DZO B;  4D7Q A;  5KO3 A;  3AKZ A;  2H0M A;  1AII A;  1S3S A;  3HU1 A;  3V76 A;  3AJC A;  2YR0 A;  3L27 A;  2DEN A;  1LV7 A;  4GC5 A;  1YJ0 A;  5KPT A;  2YNM D;  3TWL A;  2V6Z M;  2L7I A;  3LVW A;  3SC3 A;  1SXJ E;  2HYW A;  4JXH A;  4LF8 M;  4D7R A;  2CV1 A;  1OFH A;  1A8A A;  2BNK A;  2Y20 A;  1V33 A;  5IRE B; 
#chains in the Genus database with same CATH homology
 2KA6 B;  2F4V M;  4LZZ A;  2F5O A;  2H1R A;  3LVV A;  3GPP A;  2AHM A;  2QP9 X;  4FD2 A;  5GKN A;  4HL4 A;  2XF3 A;  4IBK A;  2M5Z A;  4Z8X A;  4NRV A;  3J7A S;  4R3D A;  4JN6 A;  3U5Z B;  4LJ5 A;  4Z6Y A;  5ITX A;  4GC9 A;  4RF0 A;  3GLF A;  3HU3 A;  1KYI A;  3RE8 A;  5BR8 M;  4QNM A;  3VLF B;  2Y21 A;  3K2L A;  2D7E A;  4LZJ A;  1WXQ A;  4LJA A;  1E9R A;  4KOD A;  5ITQ A;  3W0L B;  4M9Z A;  5DYG A;  3AFH A;  5LMN M;  4LCB A;  4PDG A;  1DGB A;  1NJF A;  2CFO A;  4PDI A;  3PNV A;  2LNH C;  2Y0T A;  2CV2 A;  1JQJ C;  3U6Q A;  3I4V A;  2DWL A;  2QCU A;  1UM8 A;  4IBC A;  5ITY A;  3PNY A;  4FW9 A;  2DWN A;  1L2B A;  4MGZ E;  3U6O A;  2CHG A;  5F3W A;  5E26 A;  3U5Z A;  3FTD A;  3WHK A;  1L2C A;  2M60 A;  4GMQ A;  3T1Y M;  3BOS A;  2X4A A;  4DV4 M;  4DV6 M;  4G4Q A;  2BJV A;  4X64 M;  3VDP A;  2C9O A;  2R4E A;  1C1K A;  2C98 A;  4DR7 M;  1IN4 A;  5LMU M;  2XSZ A;  3RGS A;  3PVS A;  3MJ5 A;  3GPU A;  2ERC A;  3A98 B;  1G59 A;  3SAU A;  1XMO M;  1L1T A;  4MGK E;  4GKJ M;  2Z4S A;  1QAO A;  4NOO B;  4QHT A;  3ZH9 B;  2ZAN A;  4I5S A;  3UK6 A;  3SMP A;  4JV5 M;  1Q3B A;  1IXZ A;  4LGY A;  4JI8 M;  1K82 A;  3QWL A;  3HHY A;  2OQ4 A;  1IBL M;  1NY6 A;  5H37 D;  3KS8 A;  4IBI A;  4GIP A;  1ORY B;  2UXC M;  1PM5 A;  4G4R A;  1Z5C A;  4DV7 M;  4B3R M;  5EXX A;  2F5P A;  2DWM A;  3K8Z A;  1TH2 A;  2DVW B;  1HNZ M;  2KRU A;  1K3W A;  2VII A;  2F5Q A;  3B9P A;  3UJN A;  3T38 A;  1XMQ M;  4NXM M;  1R6B X;  3JR5 A;  2RGH A;  2ZAO A;  8CAT A;  5EXT A;  1W5T A;  2NQ8 C;  1Z59 A;  2XFS A;  3LMM A;  1G41 A;  3T1H M;  1IY0 A;  4P16 A;  1IQP A;  4G4N A;  4NSO B;  5EQT A;  1XNQ M;  4MH0 E;  5FTN A;  4DV5 M;  3GLG A;  4AKG A;  3U6S A;  3CF6 E;  2X8A A;  2R46 A;  2XFT A;  5ITX E;  1N33 M;  3VK7 A;  2UUA M;  4IIW A;  3GPY A;  3UGJ A;  5JI3 E;  3FYC A;  1NHW C;  4L16 A;  3GRR A;  4MGH A;  2KZU A;  1HQC A;  2R65 A;  3FYD A;  1IN7 A;  3FUW A;  2C5R A;  3DOA A;  4OVZ B;  4LF4 M;  2V1U A;  3CTW B;  1GLN A;  4X66 M;  1N32 M;  1PJI A;  4R7G A;  3FTE A;  3IG5 A;  1YUB A;  1TDH A;  2LWX A;  4MGY E;  3SYL A;  3KOZ E;  4AQY M;  4LF5 M;  4GHL A;  2ZBK B;  3K92 A;  1E9S A;  1GL6 A;  3D8B A;  4DR5 M;  3MHV C;  1QAN A;  3E9S A;  3J2P B;  3U6E A;  3NWL A;  1EE8 A;  2LH0 A;  3HWS A;  2KZS A;  3KFU G;  3A42 A;  4JI4 M;  3VFD A;  3L29 A;  2FOI C;  3KVW A;  4CGY B;  4B7G A;  3SAS A;  5E6J A;  5FTK A;  3L28 A;  3TWM A;  4IBB A;  3A46 A;  3KXE C;  5C1B A;  2ZM6 M;  4FWG A;  3VDU A;  1Q3C A;  4OVZ A;  5DNY A;  2QEN A;  3DFZ A;  3JR4 A;  3L25 A;  4LF6 M;  3AOE C;  4YY3 M;  3VKH A;  4GIT A;  2I7P A;  2R45 A;  3GRU A;  4MM3 B;  2Z7J A;  4I4L A;  4BBA A;  3HHX A;  4DV3 M;  4OX9 M;  2EA0 A;  2KXE A;  2Z4R A;  1TDZ A;  3TWK A;  1ZQ9 A;  1NHG C;  2F5S A;  1NJG A;  3QAU A;  4FCT A;  5JI2 E;  4S12 A;  2R62 A;  4PD2 A;  4ZPX A;  4DV1 M;  5ITU A;  1X37 A;  2HKJ A;  2VQF M;  3FUU A;  3J7B A;  3J27 B;  1IY2 A;  3KP0 E;  3J81 S;  4M0W A;  1XXH B;  2KEB A;  4LFC M;  3SYK A;  4M9X A;  3NBI A;  4AZF A;  4JI5 M;  3KOW E;  3U6M A;  1QQW A;  4JI6 M;  1N75 A;  3CF2 A;  1L1Z A;  2RKO A;  4WUR A;  1IXR C;  2FFJ A;  3KSJ A;  5ITT A;  2HHH M;  5EP4 A;  4OW0 A;  3SAR A;  3FTC A;  3PXG A;  4D81 A;  4DV2 M;  4GHA A;  3AOG A;  4B08 A;  1OFI A;  4PCZ A;  1IBK M;  3R8F A;  3KDS E;  3VK8 A;  1IM2 A;  1NVM A;  1JR3 D;  4L15 A;  2DHR A;  2DZN B;  1G4A E;  1J5E M;  1GL7 A;  4W5W A;  4DR1 M;  3LQR A;  4AG6 A;  3HJQ A;  3H4M A;  5KQ8 A;  3GLG B;  2C96 A;  1HR0 M;  4GRI A;  4IBF A;  4II7 A;  1HT1 E;  3T15 A;  5BPV A;  3SFZ A;  2YFQ A;  3HJS A;  3GLH B;  3U6L A;  1KSF X;  4X62 M;  1SXJ C;  2V1C A;  4B7F A;  1HT2 E;  1XXH A;  4KO8 A;  5EP3 A;  1G8P A;  5EP1 A;  1IN5 A;  2HL7 A;  4JI0 M;  4FWH A;  2W82 A;  3RFW A;  4X65 M;  2CEA A;  4LJ6 A;  3RGP A;  3M6A A;  3GQ4 A;  3GQ5 A;  3AJI B;  2XGN A;  4RF1 A;  2XZU A;  5C18 A;  4JXJ A;  4DR3 M;  4FCV A;  4JI1 M;  2KW0 A;  1XNR M;  1N78 A;  2EUC A;  1I4W A;  4D82 A;  1E94 E;  4DR4 M;  4OU7 A;  3SMS A;  3SHF A;  4QOZ C;  1XC8 A;  1XWI A;  4LRS A;  3M0E A;  1Q39 A;  3ILK A;  3TL4 X;  1N36 M;  1DGH B;  1OJL A;  4L8R C;  3EIH A;  3GLH A;  3DZD A;  3OTO M;  3U60 B;  1QYR A;  1ZAE A;  4G6Z A;  1GVN A;  2KRK A;  1E32 A;  2LXE A;  4DV0 M;  2L09 A;  5EXS A;  3AOE A;  3SAT A;  3GRY A;  4QOS A;  3SAW A;  2C9C A;  3A45 A;  2R18 A;  3GQ3 A;  4LJ7 A;  4BLC A;  3I4Y A;  1DO0 A;  4K0K M;  4KHP M;  4LFB M;  4AG5 A;  2E5L M;  2CHQ A;  4LGM A;  4AW4 A;  3U6P A;  4JI2 M;  4IBJ A;  3GO8 A;  2BJW A;  3KOX E;  3W0F A;  4LG2 A;  1FNN A;  1N77 A;  2L6O A;  4B3M M;  4CHT B;  4XGI A;  3U61 B;  2Q2E B;  4DUZ M;  1J7K A;  1IXS B;  3D8L A;  3Q8X A;  2XH9 A;  1SXJ B;  2X49 A;  1DGH A;  3E4R A;  3TPZ A;  3FUT A;  4L4U A;  1N34 M;  4JI7 M;  4I81 A;  3GPX A;  3ZCB B;  3U60 A;  4GH9 A;  2G8L A;  7CAT A;  3PFI A;  3MK6 A;  2D7G A;  2UU9 M;  4CIS A;  4ITQ A;  1T3T A;  1Z5A A;  4B3T M;  2K47 A;  3KP1 E;  5FLX S;  2I7N A;  1YSY A;  3FTF A;  1MU5 A;  2F5N A;  4BB9 A;  4PT5 A;  1IN6 A;  2UXB M;  2XEP A;  4IBG A;  4I8O A;  5KPR A;  3J80 S;  3HKP A;  1K3X A;  3HHZ A;  1TH4 A;  3TE6 A;  5IWA M;  3KS4 A;  2DWZ B;  2UUB M;  1YE9 A;  4FWD A;  5ITR A;  4M9S A;  3R9X B;  2A5Y B;  4AKI A;  5FTJ A;  3U6C A;  4IJF A;  1QZM A;  3L26 A;  2XZF A;  4L78 A;  1HNW M;  2D7H A;  3HGI A;  1TGU A;  1J09 A;  3U61 A;  3DA1 A;  4HLQ A;  2VQE M;  4G4O A;  3GRV A;  5FSW A;  2EO2 A;  2OPF A;  4XBO A;  1SXJ D;  1SXJ A;  1W5S A;  5KPZ A;  3SAV A;  3EIE A;  3SHG B;  2J7N A;  3LQQ A;  1R2Z A;  2L7H A;  3UMM A;  1DGF A;  1HNX M;  3AL0 C;  3FUX A;  3KSX A;  4LRT A;  4JYA M;  1KFV A;  4LF7 M;  4FVM A;  2ZAM A;  3GLI B;  2CUZ A;  4LJ4 A;  4NL4 H;  2Z3X A;  3U6D A;  2J7O A;  3L2A A;  4WW0 A;  3HHW A;  1XHB A;  4IBD A;  5DYI A;  2HCB A;  1D2N A;  1L2D A;  4JI3 M;  3I51 A;  5FTM A;  4FCW A;  1QAQ A;  2DXI A;  4AKH A;  4IBE A;  1JR3 A;  3M7G A;  1PJJ A;  3FUV A;  1NNJ A;  3CF0 A;  4AI6 A;  3WHL A;  4B7H A;  3HJ8 A;  4LFA M;  1HQY E;  2Y0Q A;  2C99 A;  3KW6 A;  2QZ4 A;  4MB7 A;  3SBJ A;  4RNA A;  2FE8 A;  3GP1 A;  3VKG A;  3FKE A;  4IJE A;  1TH3 A;  4NSR A;  1IY1 A;  4DUY M;  5KQD A;  4M0D A;  2UXD M;  2XSZ D;  1NY5 A;  2UUC M;  1MX0 A;  5IT9 S;  1DGG A;  5EP2 A;  4GKK M;  1Z6T A;  2FNA A;  2QBY B;  3GLI A;  2XLJ A;  5EXP A;  1NSF A;  2O5R A;  4LJ8 A;  4EIW A;  4YHH M;  1VDD A;  2CV0 A;  2CHV A;  4NRW A;  4LY6 A;  4A3V B;  2JA2 A;  3K1J A;  4NXN M;  2YQZ A;  1FJG M;  1NNU C;  1R7R A;  1QVR A;  1QAM A;  2CE7 A;  1Z5B A;  4REZ A;  4KLN A;  5FTL A;  2P5T A;  3JAM S;  4TUW A;  5IZ7 D;  4DR2 M;  1G3I A;  3HU2 A;  1R2Y A;  2QPA A;  5A2Q S;  1I94 M;  3TQS A;  4LF9 M;  2R4J A;  3ZC7 B;  3AV0 A;  2QBY A;  1IBM M;  5EJC A;  4LJ9 A;  1IN8 A;  2G5G X;  3KOY E;  3UZU A;  4D80 A;  1H6U A;  1L8Q A;  3GLF B;  3IG8 A;  3FD9 A;  2RGO A;  4MGI E;  4QNR A;  4QHS A;  1DO2 A;  4DR6 M;  4B3S M;  3THG A;  1GKI A;  2DZO B;  5KO3 A;  3AKZ A;  1S3S A;  3HU1 A;  2YR0 A;  3L27 A;  4GC5 A;  1LV7 A;  5KPT A;  2YNM D;  3TWL A;  2V6Z M;  2L7I A;  3LVW A;  3SC3 A;  1SXJ E;  4LF8 M;  2CV1 A;  1OFH A;  2BNK A;  2Y20 A;  3C58 A;  5IRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...