4D7QA

Crystal structure of a chimeric protein with the sec7 domain of legionella pneumophila ralf and the capping domain of rickettsia prowazekii ralf
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
347
structure length
347
Chain Sequence
HHHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVYGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQNNNLTIEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPLREEGRQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RALF, PROLINE/BETAINE TRANSPORTER
publication title On the Use of Legionella/Rickettsia Chimeras to Investigate the Structure and Regulation of Rickettsia Effector Ralf.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Signaling protein
total genus 125
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4d7qA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 4d7qA02
3.30.310.140 Alpha Beta 2-Layer Sandwich TATA-Binding Protein sec7 domains 4d7qA03
4Z21A 1XSZA 1R8ME 4A4PA 1S9DE 3SWVA 1KU1A 1BC9A 3LTLA 4D7QA 4JWLA 1XT0B 4JMIA 1PBVA 4JMOA 4C0AA 4OIYA 2R0DA 1R8QE 3L8NA 4C7PA 4JXHA 4L5MA 2R09A 1RE0B 1R8SE 4D7RA
chains in the Genus database with same CATH superfamily
2MZ8A 4MDUA 3PDKA 1YTBA 1QN8A 3SWVA 2Q4CA 1AVCA 3ABRA 1K35A 1KO9A 5BMPA 1UT4A 2R0DA 2II2A 4KN7X 4L5MA 1N44A 1AXNA 2H5AX 2LAEA 1XJLA 2NOFA 2IE6A 3ABSA 3SOHB 4A4PA 1C1KA 4B0AA 1TGHA 2V92A 2F7LA 3ASMA 1AEIA 1A8BA 1N42A 1PBVA 4C0AA 1QTSA 3PMGA 4MDVA 2FGTA 1KY7A 2Z8UA 2XHIA 1BCYA 3SNSA 3OH6A 1MPGA 2H0LA 1PVSA 2Z0FA 2O3OA 1EBMA 1LXTA 1A8AA 3CWSA 1BO9A 2Y8QA 3AJCA 1VOKA 3OCIA 4WX8A 1VKLA 2DKDA 1RM1A 1AOWA 2YH5A 1LWWA 1YTFA 1M3QA 2R09A 3OGDA 1R8SE 1WJWA 3H1ZA 1CDWA 4EALA 3OH9A 3OSTA 4DULA 1XT0B 2ZOCA 2HKPA 2QR1A 1QC7A 5JN5A 2IV8A 2QRDA 3F10A 1HVFA 2NWVA 2K6XA 3EAYA 1DIZA 1BCZA 3RPJA 1MCXA 1ANXA 4EVHA 1QN5A 3CVTA 1VOLB 1AVHA 2D0AA 3RSMA 1YGMA 1NVPA 2I5WA 3OLPA 1LKVX 4HREA 4X9PA 1QN6A 1AVRA 4FQ0C 4HJHA 1I4AA 4QG5A 4Z21A 4MRQA 4EAGA 1EUVA 1YQRA 1R4XA 1PCMX 4I8OA 2FUVA 1DM5A 1KFIA 1K2YX 5KL0A 1TBAB 2NVMA 1QN3A 5HSHA 5IYCP 1P5DX 4JXHA 2HZSA 1C9BB 1MP9A 3VN5A 1HVDA 1W80A 1YIIA 4Q11A 2V8QA 2OOYA 3TDHA 3ULXA 3LTLA 4EAKA 1QN7A 2R5XA 2HYUA 1KYFA 3OSEA 3ENOC 2NOZA 4C7PA 3HJLA 2D0BA 2HL8A 1FN7A 2IE7A 1W45A 1KFQA 4Q2SA 2QLVA 1YCNA 1KU1A 4D7QA 1KY6A 2PWWA 4JMIA 2FKMX 1HVEA 1SAVA 1YJ0A 3F0ZA 1HU0A 2QRCA 2ZHJA 1XSZA 2EHBD 4TPSA 1VTLE 4EAIA 4EJYA 1S9DE 3ABOA 3HS8A 1C47A 5IYDP 5EPCA 1HAKA 1LWYA 1AIIA 2NOLA 1HM6A 3BKQX 1VTOA 3ENCA 2IV9A 2D0CA 2OOXA 2YA3A 3USYA 1P5GX 1V5SA 1E42A 4PY5A 4WZSD 1NH2A 1W7BA 3BRXA 2XO3A 2ZHIA 2DKCA 3L8NA 1UT7A 2QEZA 5AN4A 1QNEA 1BC0A 1JDYA 1YQKA 3N89A 1C4GA 1WQAA 2FKFA 2ZFDB 1Q9UA 3ABQA 4BJUA 1N39A 4JK1X 3OSMA 1R8QE 1BCWA 4D7RA 3I0XA 1ALAA 3CVSA 3NA5A 1YQLA 4ROEB 1KYDA 3EIKA 1BC3A 4CFFA 2HYVA 3I3WA 2VXGA 1AISA 2JOIA 1W3WA 2JHNA 4FHRB 1B9KA 4KMUX 3KTUA 1QNCA 2RANA 5BMNA 2NLVA 3D7QA 1PCZA 1BC1A 1QNAA 1NGMA 1RE0B 2HSNA 5F9CA 2XO2A 2H0KA 4IL8A 1PCJX 2H0MA 1BC9A 1UPTB 3DPUA 1M3HA 4OIYA 3KRMA 3CWAA 1PZDA 1Q8DA 3T4NA 5JMVD 2Y8LA 1QN4A 2HL9A 2JPIA 4ROCB 1R8ME 1QTPA 1QN9A 2NOIA 5IYBP 1YQMA 2NOEA 4EJZA 1TUOA 3DPTA 1DK5A 4JWLA 2QREA 4RODB 1N41A 1M9IA 3C04A 3IH7A 4EAJA 3CWTA 3UW2A 1M5Q1 3OC3C 2DKAA 3CWUA 3D4VA 1G5NA 2JHJA 3USWA 3CW7A 2VJ0A 2NOBA 4EVFA 1LWVA 2HZMA 2HYWA 3HS9A 4KN4X 1QNBA 1R4AE 4WXAA 1J3MA 2OY9A 1ANNA 2G30A 1KYUA 2V9JA 1N3CA 1HVGA 1D3UA 2IICA 2NOHA 2MJ7A 1TBPA 3TW5A 1ANWA 3AO0A 3TE5A 2H4LX 1N3AA 1UL7A 4JMOA 3I0WA 1N00A 1JFIC 3ANYA 1T6AA
chains in the Genus database with same CATH topology
4Z21A 1XSZA 1R8ME 3SOHB 3USYA 4A4PA 2HSNA 1S9DE 1R8SE 3USWA 3SWVA 1KU1A 1BC9A 3AJCA 3LTLA 3TW5A 4D7QA 4JWLA 1XT0B 4FHRB 1LKVX 4JMIA 1PBVA 4JMOA 4JK1X 4C0AA 4KMUX 4KN4X 4OIYA 2R0DA 1Q8DA 1R8QE 3L8NA 4C7PA 4JXHA 4KN7X 4L5MA 1QC7A 2R09A 1RE0B 3HJLA 4D7RA 2K6XA 4FQ0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z21 A;  1XSZ A;  1R8M E;  4A4P A;  1S9D E;  3SWV A;  1KU1 A;  1BC9 A;  3LTL A;  4D7Q A;  4JWL A;  1XT0 B;  4JMI A;  1PBV A;  4JMO A;  4C0A A;  4OIY A;  2R0D A;  1R8Q E;  3L8N A;  4C7P A;  4JXH A;  4L5M A;  2R09 A;  1RE0 B;  1R8S E;  4D7R A; 
#chains in the Genus database with same CATH topology
 2MZ8 A;  4MDU A;  3PDK A;  1YTB A;  1QN8 A;  3SWV A;  2Q4C A;  1AVC A;  3ABR A;  1K35 A;  1KO9 A;  5BMP A;  1UT4 A;  2R0D A;  2II2 A;  4KN7 X;  4L5M A;  1N44 A;  1AXN A;  2H5A X;  2LAE A;  1XJL A;  2NOF A;  2IE6 A;  3ABS A;  3SOH B;  4A4P A;  1C1K A;  4B0A A;  1TGH A;  2V92 A;  2F7L A;  3ASM A;  1AEI A;  1A8B A;  1N42 A;  1PBV A;  4C0A A;  1QTS A;  3PMG A;  4MDV A;  2FGT A;  1KY7 A;  2Z8U A;  2XHI A;  1BCY A;  3SNS A;  3OH6 A;  1MPG A;  2H0L A;  1PVS A;  2Z0F A;  2O3O A;  1EBM A;  1LXT A;  1A8A A;  3CWS A;  1BO9 A;  2Y8Q A;  3AJC A;  1VOK A;  3OCI A;  4WX8 A;  1VKL A;  2DKD A;  1RM1 A;  1AOW A;  2YH5 A;  1LWW A;  1YTF A;  1M3Q A;  2R09 A;  3OGD A;  1R8S E;  1WJW A;  3H1Z A;  1CDW A;  4EAL A;  3OH9 A;  3OST A;  4DUL A;  1XT0 B;  2ZOC A;  2HKP A;  2QR1 A;  1QC7 A;  5JN5 A;  2IV8 A;  2QRD A;  3F10 A;  1HVF A;  2NWV A;  2K6X A;  3EAY A;  1DIZ A;  1BCZ A;  3RPJ A;  1MCX A;  1ANX A;  4EVH A;  1QN5 A;  3CVT A;  1VOL B;  1AVH A;  2D0A A;  3RSM A;  1YGM A;  1NVP A;  2I5W A;  3OLP A;  1LKV X;  4HRE A;  4X9P A;  1QN6 A;  1AVR A;  4FQ0 C;  4HJH A;  1I4A A;  4QG5 A;  4Z21 A;  4MRQ A;  4EAG A;  1EUV A;  1YQR A;  1R4X A;  1PCM X;  4I8O A;  2FUV A;  1DM5 A;  1KFI A;  1K2Y X;  5KL0 A;  1TBA B;  2NVM A;  1QN3 A;  5HSH A;  5IYC P;  1P5D X;  4JXH A;  2HZS A;  1C9B B;  1MP9 A;  3VN5 A;  1HVD A;  1W80 A;  1YII A;  4Q11 A;  2V8Q A;  2OOY A;  3TDH A;  3ULX A;  3LTL A;  4EAK A;  1QN7 A;  2R5X A;  2HYU A;  1KYF A;  3OSE A;  3ENO C;  2NOZ A;  4C7P A;  3HJL A;  2D0B A;  2HL8 A;  1FN7 A;  2IE7 A;  1W45 A;  1KFQ A;  4Q2S A;  2QLV A;  1YCN A;  1KU1 A;  4D7Q A;  1KY6 A;  2PWW A;  4JMI A;  2FKM X;  1HVE A;  1SAV A;  1YJ0 A;  3F0Z A;  1HU0 A;  2QRC A;  2ZHJ A;  1XSZ A;  2EHB D;  4TPS A;  1VTL E;  4EAI A;  4EJY A;  1S9D E;  3ABO A;  3HS8 A;  1C47 A;  5IYD P;  5EPC A;  1HAK A;  1LWY A;  1AII A;  2NOL A;  1HM6 A;  3BKQ X;  1VTO A;  3ENC A;  2IV9 A;  2D0C A;  2OOX A;  2YA3 A;  3USY A;  1P5G X;  1V5S A;  1E42 A;  4PY5 A;  4WZS D;  1NH2 A;  1W7B A;  3BRX A;  2XO3 A;  2ZHI A;  2DKC A;  3L8N A;  1UT7 A;  2QEZ A;  5AN4 A;  1QNE A;  1BC0 A;  1JDY A;  1YQK A;  3N89 A;  1C4G A;  1WQA A;  2FKF A;  2ZFD B;  1Q9U A;  3ABQ A;  4BJU A;  1N39 A;  4JK1 X;  3OSM A;  1R8Q E;  1BCW A;  4D7R A;  3I0X A;  1ALA A;  3CVS A;  3NA5 A;  1YQL A;  4ROE B;  1KYD A;  3EIK A;  1BC3 A;  4CFF A;  2HYV A;  3I3W A;  2VXG A;  1AIS A;  2JOI A;  1W3W A;  2JHN A;  4FHR B;  1B9K A;  4KMU X;  3KTU A;  1QNC A;  2RAN A;  5BMN A;  2NLV A;  3D7Q A;  1PCZ A;  1BC1 A;  1QNA A;  1NGM A;  1RE0 B;  2HSN A;  5F9C A;  2XO2 A;  2H0K A;  4IL8 A;  1PCJ X;  2H0M A;  1BC9 A;  1UPT B;  3DPU A;  1M3H A;  4OIY A;  3KRM A;  3CWA A;  1PZD A;  1Q8D A;  3T4N A;  5JMV D;  2Y8L A;  1QN4 A;  2HL9 A;  2JPI A;  4ROC B;  1R8M E;  1QTP A;  1QN9 A;  2NOI A;  5IYB P;  1YQM A;  2NOE A;  4EJZ A;  1TUO A;  3DPT A;  1DK5 A;  4JWL A;  2QRE A;  4ROD B;  1N41 A;  1M9I A;  3C04 A;  3IH7 A;  4EAJ A;  3CWT A;  3UW2 A;  1M5Q 1;  3OC3 C;  2DKA A;  3CWU A;  3D4V A;  1G5N A;  2JHJ A;  3USW A;  3CW7 A;  2VJ0 A;  2NOB A;  4EVF A;  1LWV A;  2HZM A;  2HYW A;  3HS9 A;  4KN4 X;  1QNB A;  1R4A E;  4WXA A;  1J3M A;  2OY9 A;  1ANN A;  2G30 A;  1KYU A;  2V9J A;  1N3C A;  1HVG A;  1D3U A;  2IIC A;  2NOH A;  2MJ7 A;  1TBP A;  3TW5 A;  1ANW A;  3AO0 A;  3TE5 A;  2H4L X;  1N3A A;  1UL7 A;  4JMO A;  3I0W A;  1N00 A;  1JFI C;  3ANY A;  1T6A A; 
#chains in the Genus database with same CATH homology
 4Z21 A;  1XSZ A;  1R8M E;  3SOH B;  3USY A;  4A4P A;  2HSN A;  1S9D E;  1R8S E;  3USW A;  3SWV A;  1KU1 A;  1BC9 A;  3AJC A;  3LTL A;  3TW5 A;  4D7Q A;  4JWL A;  1XT0 B;  4FHR B;  1LKV X;  4JMI A;  1PBV A;  4JMO A;  4JK1 X;  4C0A A;  4KMU X;  4KN4 X;  4OIY A;  2R0D A;  1Q8D A;  1R8Q E;  3L8N A;  4C7P A;  4JXH A;  4KN7 X;  4L5M A;  1QC7 A;  2R09 A;  1RE0 B;  3HJL A;  4D7R A;  2K6X A;  4FQ0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...