4D7QA

Crystal structure of a chimeric protein with the sec7 domain of legionella pneumophila ralf and the capping domain of rickettsia prowazekii ralf
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
347
structure length
347
Chain Sequence
HHHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVYGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVDSSPGYQINNISSQNDKTFKQLNQFLEEKRNIQNIFPKLQNNNLTIEFKNPKTFLSKFTGYKGSVIIKDEKSGAAEIQVYKPSIFSRWFLGEKSKIIIQPLREEGRQPSEQSLKLAAQITASFETKVTSIKATYDYLKEDLKSQYDNIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RALF, PROLINE/BETAINE TRANSPORTER
publication title On the Use of Legionella/Rickettsia Chimeras to Investigate the Structure and Regulation of Rickettsia Effector Ralf.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 125
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4d7qA01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 4d7qA02
3.30.310.140 Alpha Beta 2-Layer Sandwich TATA-Binding Protein sec7 domains 4d7qA03
3L8NA 1S9DE 3SWVA 4JMIA 4OIYA 1XSZA 4D7RA 4JWLA 1BC9A 4C0AA 4JMOA 2R0DA 1R8SE 4C7PA 4L5MA 1XT0B 4JXHA 1PBVA 4A4PA 4Z21A 3LTLA 4D7QA 2R09A 1R8QE 1R8ME 1KU1A 1RE0B
chains in the Genus database with same CATH superfamily
1XJLA 2ZHIA 5HSHA 4PY5A 3OH9A 1N39A 2QRCA 3CWSA 2JPIA 2II2A 1A8AA 2NOEA 1PCMX 1D3UA 4JK1X 3OSTA 3C04A 2H0KA 5BMPA 2NOHA 1E42A 1QN7A 4L5MA 4MDUA 1JDYA 2FKMX 2FUVA 1ANNA 3ASMA 1BCWA 1B9KA 2D0AA 3PMGA 4X9PA 3CWUA 1C47A 1WJWA 3USWA 1R8ME 1VOLB 1W3WA 1BC0A 3I0WA 3SWVA 1C4GA 1VTLE 1HAKA 1WQAA 3RPJA 1PCZA 3NA5A 4C0AA 2IICA 4WXAA 1R4AE 1VTOA 1DK5A 1LWVA 3UW2A 1YJ0A 2VJ0A 1HVDA 1A8BA 1XSZA 1QNAA 1QN6A 3T4NA 3PDKA 5EPCA 3EAYA 1C9BB 2PWWA 1BC1A 4D7QA 2R09A 1R8QE 1YGMA 4HREA 3H1ZA 1K2YX 1AVRA 4MDVA 1QTSA 1M9IA 2VXGA 4BJUA 2G30A 4QG5A 1BC9A 1QN9A 1BO9A 2HSNA 3SNSA 1N41A 2XO2A 1C1KA 1AOWA 2D0BA 2NOBA 1TBAB 3CW7A 2HKPA 4WX8A 3ABQA 2NOLA 2NOFA 1AEIA 4EVHA 1UPTB 4MRQA 1RM1A 3OC3C 4Z21A 3I3WA 1AXNA 1KU1A 1P5GX 2EHBD 4IL8A 2NOZA 2F7LA 3DPTA 4D7RA 1PZDA 2HZSA 4EAGA 4JMOA 1KY7A 1Q9UA 1HM6A 2Z0FA 1G5NA 1AVCA 4JXHA 2IE6A 2QRDA 2QR1A 2OOYA 1RE0B 2YH5A 4ROEB 3ANYA 1VKLA 3CVTA 3ABRA 3OH6A 1N00A 5JN5A 1NH2A 4Q2SA 2QEZA 3TE5A 2LAEA 1K35A 2QREA 3F0ZA 3BRXA 1JFIC 1QN8A 3OCIA 4ROCB 4EALA 1NGMA 2JOIA 1J3MA 1MCXA 5AN4A 1KO9A 1R4XA 1S9DE 1PVSA 2H0LA 2JHNA 2HL8A 1YQMA 1YCNA 2OY9A 3ABSA 4DULA 1FN7A 4FHRB 4C7PA 1TGHA 1QNBA 1HVEA 2HYUA 4A4PA 2DKDA 1AIIA 5IYBP 1HVGA 2Z8UA 2Y8QA 3ENCA 1MPGA 1Q8DA 1VOKA 4EJYA 3HS8A 3TW5A 2HYVA 2IV8A 1BC3A 3OLPA 2DKCA 1HVFA 3AO0A 2R5XA 3CWAA 4CFFA 3AJCA 1QN5A 2IE7A 1KYUA 1QTPA 3HS9A 5KL0A 2D0CA 3KTUA 4Q11A 2K6XA 2HZMA 5IYCP 1V5SA 3D7QA 1KYFA 5BMNA 1UL7A 2ZOCA 2ZFDB 1YIIA 2MJ7A 3OSMA 3L8NA 2DKAA 1EUVA 3F10A 4EJZA 3D4VA 2XO3A 4EVFA 2RANA 2NOIA 1PCJX 3OSEA 4I8OA 2V8QA 4TPSA 1CDWA 1LKVX 1ALAA 2JHJA 4RODB 2HL9A 3KRMA 2NWVA 2YA3A 1W45A 4KMUX 1QN4A 1P5DX 3IH7A 2NLVA 1KFQA 1TUOA 1I4AA 2OOXA 4EAIA 5JMVD 3EIKA 4JMIA 1TBPA 1SAVA 3RSMA 3HJLA 2IV9A 1MP9A 3N89A 2V92A 1QNCA 4JWLA 1AVHA 4EAJA 3VN5A 2QLVA 1DM5A 3ABOA 1LWWA 2H0MA 4KN7X 4HJHA 4EAKA 1QN3A 1YQRA 1NVPA 1UT7A 2H4LX 2Y8LA 1M5Q1 1BCYA 2HYWA 4OIYA 1KY6A 1HU0A 2FGTA 1YTBA 4WZSD 4B0AA 2FKFA 1W7BA 1QNEA 1W80A 4FQ0C 1DIZA 3ENOC 1AISA 1YQLA 1BCZA 1KYDA 3TDHA 3BKQX 2Q4CA 2ZHJA 1M3QA 1N44A 2V9JA 2R0DA 3SOHB 1R8SE 1N42A 1QC7A 4KN4X 2XHIA 1UT4A 5F9CA 2I5WA 3ULXA 1EBMA 1PBVA 3OGDA 3LTLA 2O3OA 1ANWA 1N3AA 1KFIA 1N3CA 1ANXA 1YQKA 3I0XA 1YTFA 1M3HA 3USYA 1LXTA 3DPUA 2H5AX 3CVSA 2NVMA 3CWTA 1XT0B 5IYDP 2MZ8A 1LWYA 1T6AA
chains in the Genus database with same CATH topology
3L8NA 1S9DE 3SWVA 4JMIA 3HJLA 3TW5A 4OIYA 2K6XA 1XSZA 3USYA 4D7RA 4JWLA 4JK1X 1BC9A 4C0AA 4JMOA 1LKVX 2R0DA 3SOHB 4FHRB 1R8SE 3AJCA 4C7PA 1QC7A 4KN4X 2HSNA 4FQ0C 1XT0B 4L5MA 4JXHA 1PBVA 4A4PA 4Z21A 4KMUX 3LTLA 4KN7X 4D7QA 2R09A 1R8QE 3USWA 1R8ME 1Q8DA 1KU1A 1RE0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8N A;  1S9D E;  3SWV A;  4JMI A;  4OIY A;  1XSZ A;  4D7R A;  4JWL A;  1BC9 A;  4C0A A;  4JMO A;  2R0D A;  1R8S E;  4C7P A;  4L5M A;  1XT0 B;  4JXH A;  1PBV A;  4A4P A;  4Z21 A;  3LTL A;  4D7Q A;  2R09 A;  1R8Q E;  1R8M E;  1KU1 A;  1RE0 B; 
#chains in the Genus database with same CATH topology
 1XJL A;  2ZHI A;  5HSH A;  4PY5 A;  3OH9 A;  1N39 A;  2QRC A;  3CWS A;  2JPI A;  2II2 A;  1A8A A;  2NOE A;  1PCM X;  1D3U A;  4JK1 X;  3OST A;  3C04 A;  2H0K A;  5BMP A;  2NOH A;  1E42 A;  1QN7 A;  4L5M A;  4MDU A;  1JDY A;  2FKM X;  2FUV A;  1ANN A;  3ASM A;  1BCW A;  1B9K A;  2D0A A;  3PMG A;  4X9P A;  3CWU A;  1C47 A;  1WJW A;  3USW A;  1R8M E;  1VOL B;  1W3W A;  1BC0 A;  3I0W A;  3SWV A;  1C4G A;  1VTL E;  1HAK A;  1WQA A;  3RPJ A;  1PCZ A;  3NA5 A;  4C0A A;  2IIC A;  4WXA A;  1R4A E;  1VTO A;  1DK5 A;  1LWV A;  3UW2 A;  1YJ0 A;  2VJ0 A;  1HVD A;  1A8B A;  1XSZ A;  1QNA A;  1QN6 A;  3T4N A;  3PDK A;  5EPC A;  3EAY A;  1C9B B;  2PWW A;  1BC1 A;  4D7Q A;  2R09 A;  1R8Q E;  1YGM A;  4HRE A;  3H1Z A;  1K2Y X;  1AVR A;  4MDV A;  1QTS A;  1M9I A;  2VXG A;  4BJU A;  2G30 A;  4QG5 A;  1BC9 A;  1QN9 A;  1BO9 A;  2HSN A;  3SNS A;  1N41 A;  2XO2 A;  1C1K A;  1AOW A;  2D0B A;  2NOB A;  1TBA B;  3CW7 A;  2HKP A;  4WX8 A;  3ABQ A;  2NOL A;  2NOF A;  1AEI A;  4EVH A;  1UPT B;  4MRQ A;  1RM1 A;  3OC3 C;  4Z21 A;  3I3W A;  1AXN A;  1KU1 A;  1P5G X;  2EHB D;  4IL8 A;  2NOZ A;  2F7L A;  3DPT A;  4D7R A;  1PZD A;  2HZS A;  4EAG A;  4JMO A;  1KY7 A;  1Q9U A;  1HM6 A;  2Z0F A;  1G5N A;  1AVC A;  4JXH A;  2IE6 A;  2QRD A;  2QR1 A;  2OOY A;  1RE0 B;  2YH5 A;  4ROE B;  3ANY A;  1VKL A;  3CVT A;  3ABR A;  3OH6 A;  1N00 A;  5JN5 A;  1NH2 A;  4Q2S A;  2QEZ A;  3TE5 A;  2LAE A;  1K35 A;  2QRE A;  3F0Z A;  3BRX A;  1JFI C;  1QN8 A;  3OCI A;  4ROC B;  4EAL A;  1NGM A;  2JOI A;  1J3M A;  1MCX A;  5AN4 A;  1KO9 A;  1R4X A;  1S9D E;  1PVS A;  2H0L A;  2JHN A;  2HL8 A;  1YQM A;  1YCN A;  2OY9 A;  3ABS A;  4DUL A;  1FN7 A;  4FHR B;  4C7P A;  1TGH A;  1QNB A;  1HVE A;  2HYU A;  4A4P A;  2DKD A;  1AII A;  5IYB P;  1HVG A;  2Z8U A;  2Y8Q A;  3ENC A;  1MPG A;  1Q8D A;  1VOK A;  4EJY A;  3HS8 A;  3TW5 A;  2HYV A;  2IV8 A;  1BC3 A;  3OLP A;  2DKC A;  1HVF A;  3AO0 A;  2R5X A;  3CWA A;  4CFF A;  3AJC A;  1QN5 A;  2IE7 A;  1KYU A;  1QTP A;  3HS9 A;  5KL0 A;  2D0C A;  3KTU A;  4Q11 A;  2K6X A;  2HZM A;  5IYC P;  1V5S A;  3D7Q A;  1KYF A;  5BMN A;  1UL7 A;  2ZOC A;  2ZFD B;  1YII A;  2MJ7 A;  3OSM A;  3L8N A;  2DKA A;  1EUV A;  3F10 A;  4EJZ A;  3D4V A;  2XO3 A;  4EVF A;  2RAN A;  2NOI A;  1PCJ X;  3OSE A;  4I8O A;  2V8Q A;  4TPS A;  1CDW A;  1LKV X;  1ALA A;  2JHJ A;  4ROD B;  2HL9 A;  3KRM A;  2NWV A;  2YA3 A;  1W45 A;  4KMU X;  1QN4 A;  1P5D X;  3IH7 A;  2NLV A;  1KFQ A;  1TUO A;  1I4A A;  2OOX A;  4EAI A;  5JMV D;  3EIK A;  4JMI A;  1TBP A;  1SAV A;  3RSM A;  3HJL A;  2IV9 A;  1MP9 A;  3N89 A;  2V92 A;  1QNC A;  4JWL A;  1AVH A;  4EAJ A;  3VN5 A;  2QLV A;  1DM5 A;  3ABO A;  1LWW A;  2H0M A;  4KN7 X;  4HJH A;  4EAK A;  1QN3 A;  1YQR A;  1NVP A;  1UT7 A;  2H4L X;  2Y8L A;  1M5Q 1;  1BCY A;  2HYW A;  4OIY A;  1KY6 A;  1HU0 A;  2FGT A;  1YTB A;  4WZS D;  4B0A A;  2FKF A;  1W7B A;  1QNE A;  1W80 A;  4FQ0 C;  1DIZ A;  3ENO C;  1AIS A;  1YQL A;  1BCZ A;  1KYD A;  3TDH A;  3BKQ X;  2Q4C A;  2ZHJ A;  1M3Q A;  1N44 A;  2V9J A;  2R0D A;  3SOH B;  1R8S E;  1N42 A;  1QC7 A;  4KN4 X;  2XHI A;  1UT4 A;  5F9C A;  2I5W A;  3ULX A;  1EBM A;  1PBV A;  3OGD A;  3LTL A;  2O3O A;  1ANW A;  1N3A A;  1KFI A;  1N3C A;  1ANX A;  1YQK A;  3I0X A;  1YTF A;  1M3H A;  3USY A;  1LXT A;  3DPU A;  2H5A X;  3CVS A;  2NVM A;  3CWT A;  1XT0 B;  5IYD P;  2MZ8 A;  1LWY A;  1T6A A; 
#chains in the Genus database with same CATH homology
 3L8N A;  1S9D E;  3SWV A;  4JMI A;  3HJL A;  3TW5 A;  4OIY A;  2K6X A;  1XSZ A;  3USY A;  4D7R A;  4JWL A;  4JK1 X;  1BC9 A;  4C0A A;  4JMO A;  1LKV X;  2R0D A;  3SOH B;  4FHR B;  1R8S E;  3AJC A;  4C7P A;  1QC7 A;  4KN4 X;  2HSN A;  4FQ0 C;  1XT0 B;  4L5M A;  4JXH A;  1PBV A;  4A4P A;  4Z21 A;  4KMU X;  3LTL A;  4KN7 X;  4D7Q A;  2R09 A;  1R8Q E;  3USW A;  1R8M E;  1Q8D A;  1KU1 A;  1RE0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...