1R8QE

Full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
191
structure length
191
Chain Sequence
SKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSYSVIMLNTDLHNPNVRDKMGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 72
structure length 191
sequence length 191
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 1r8qE01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 1r8qE02
3LTLA 4A4PA 4JWLA 4JXHA 2R0DA 3L8NA 4D7RA 1XT0B 4D7QA 1BC9A 1R8SE 4L5MA 4Z21A 1XSZA 1R8ME 4JMIA 1S9DE 4OIYA 4C0AA 1PBVA 1R8QE 1RE0B 4C7PA 3SWVA 1KU1A 4JMOA 2R09A
chains in the Genus database with same CATH superfamily
2XO2A 3ANYA 1HVEA 2IE7A 4JXHA 1AVRA 1ANNA 3L8NA 2H0LA 2OY9A 2II2A 1BC0A 1XT0B 2Q4CA 3BRXA 1A8BA 4Z21A 4KMUX 1XSZA 3USWA 4X9PA 4JMIA 1S9DE 4OIYA 3HJLA 4C0AA 1M9IA 1W7BA 2HYWA 1YJ0A 1AOWA 1ALAA 3ABSA 4HREA 4MDUA 4EVHA 2HYUA 2RANA 3SOHB 2R09A 2H0MA 3LTLA 4FHRB 4A4PA 3ABQA 1AVHA 3TW5A 4JWLA 3ABOA 1HAKA 4JK1X 1SAVA 1N00A 2HSNA 1R4AE 1N44A 1N42A 1ANWA 3AJCA 1RE0B 2XO3A 1N41A 1AIIA 1YIIA 1A8AA 2ZHIA 1ANXA 1HM6A 1UPTB 2ZOCA 2IE6A 4JMOA 1HVGA 1I4AA 1BCZA 1W3WA 1AEIA 2ZHJA 4D7RA 1C1KA 1R8SE 1BCYA 4L5MA 1DK5A 2IICA 1R8ME 1BCWA 1DM5A 2H0KA 4EVFA 4KN4X 1R8QE 4C7PA 1LKVX 4MDVA 1G5NA 1Q8DA 3AO0A 2R0DA 4Q2SA 1BO9A 2QEZA 1W45A 1XJLA 1BC3A 1HVFA 4D7QA 1YGMA 1BC9A 4FQ0C 1MCXA 4KN7X 2K6XA 2VXGA 1AXNA 1PBVA 1QC7A 1BC1A 2HYVA 1AVCA 3USYA 3ABRA 3SWVA 1KU1A 1YCNA 1HVDA
chains in the Genus database with same CATH topology
3LTLA 4FHRB 4A4PA 3TW5A 1Q8DA 4JWLA 4JXHA 2R0DA 3L8NA 4JK1X 4D7RA 1XT0B 2HSNA 4D7QA 1BC9A 1R8SE 4FQ0C 4L5MA 4KN7X 4KMUX 4Z21A 1XSZA 2K6XA 3USWA 1R8ME 4JMIA 1S9DE 4OIYA 4KN4X 3HJLA 4C0AA 1PBVA 3AJCA 1QC7A 1R8QE 1RE0B 4C7PA 3USYA 1LKVX 3SWVA 1KU1A 3SOHB 4JMOA 2R09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTL A;  4A4P A;  4JWL A;  4JXH A;  2R0D A;  3L8N A;  4D7R A;  1XT0 B;  4D7Q A;  1BC9 A;  1R8S E;  4L5M A;  4Z21 A;  1XSZ A;  1R8M E;  4JMI A;  1S9D E;  4OIY A;  4C0A A;  1PBV A;  1R8Q E;  1RE0 B;  4C7P A;  3SWV A;  1KU1 A;  4JMO A;  2R09 A; 
#chains in the Genus database with same CATH topology
 2XO2 A;  3ANY A;  1HVE A;  2IE7 A;  4JXH A;  1AVR A;  1ANN A;  3L8N A;  2H0L A;  2OY9 A;  2II2 A;  1BC0 A;  1XT0 B;  2Q4C A;  3BRX A;  1A8B A;  4Z21 A;  4KMU X;  1XSZ A;  3USW A;  4X9P A;  4JMI A;  1S9D E;  4OIY A;  3HJL A;  4C0A A;  1M9I A;  1W7B A;  2HYW A;  1YJ0 A;  1AOW A;  1ALA A;  3ABS A;  4HRE A;  4MDU A;  4EVH A;  2HYU A;  2RAN A;  3SOH B;  2R09 A;  2H0M A;  3LTL A;  4FHR B;  4A4P A;  3ABQ A;  1AVH A;  3TW5 A;  4JWL A;  3ABO A;  1HAK A;  4JK1 X;  1SAV A;  1N00 A;  2HSN A;  1R4A E;  1N44 A;  1N42 A;  1ANW A;  3AJC A;  1RE0 B;  2XO3 A;  1N41 A;  1AII A;  1YII A;  1A8A A;  2ZHI A;  1ANX A;  1HM6 A;  1UPT B;  2ZOC A;  2IE6 A;  4JMO A;  1HVG A;  1I4A A;  1BCZ A;  1W3W A;  1AEI A;  2ZHJ A;  4D7R A;  1C1K A;  1R8S E;  1BCY A;  4L5M A;  1DK5 A;  2IIC A;  1R8M E;  1BCW A;  1DM5 A;  2H0K A;  4EVF A;  4KN4 X;  1R8Q E;  4C7P A;  1LKV X;  4MDV A;  1G5N A;  1Q8D A;  3AO0 A;  2R0D A;  4Q2S A;  1BO9 A;  2QEZ A;  1W45 A;  1XJL A;  1BC3 A;  1HVF A;  4D7Q A;  1YGM A;  1BC9 A;  4FQ0 C;  1MCX A;  4KN7 X;  2K6X A;  2VXG A;  1AXN A;  1PBV A;  1QC7 A;  1BC1 A;  2HYV A;  1AVC A;  3USY A;  3ABR A;  3SWV A;  1KU1 A;  1YCN A;  1HVD A; 
#chains in the Genus database with same CATH homology
 3LTL A;  4FHR B;  4A4P A;  3TW5 A;  1Q8D A;  4JWL A;  4JXH A;  2R0D A;  3L8N A;  4JK1 X;  4D7R A;  1XT0 B;  2HSN A;  4D7Q A;  1BC9 A;  1R8S E;  4FQ0 C;  4L5M A;  4KN7 X;  4KMU X;  4Z21 A;  1XSZ A;  2K6X A;  3USW A;  1R8M E;  4JMI A;  1S9D E;  4OIY A;  4KN4 X;  3HJL A;  4C0A A;  1PBV A;  3AJC A;  1QC7 A;  1R8Q E;  1RE0 B;  4C7P A;  3USY A;  1LKV X;  3SWV A;  1KU1 A;  3SOH B;  4JMO A;  2R09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...