1YIIA

Crystal structures of chicken annexin v in complex with ca2+
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
316
structure length
316
Chain Sequence
AKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQANRDPDGRVDEALVEKDAQVLFRAGELKWGTDEETFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGDLEKLLLAVVKCIRSVPAYFAETLYYSMKGAGTDDDTLIRVMVSRSEIDLLDIRHEFRKNFAKSLYQMIQKDTSGDYRKALLLLCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Annexin A5
publication title Crystal Structures of Chicken Annexin A5 in Complex with Functional Modifiers Ca2+ and Zn2+ Reveal Zn2+ Induced Formation of Non-Planar Assemblies
pubmed rcsb
molecule tags Protein and metal binding protein
total genus 124
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yiiA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yiiA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yiiA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1yiiA03
1HVGA 1BCZA 1ANNA 1AVRA 1HVFA 2IE7A 1BCWA 2H0MA 1MCXA 1HAKA 2HYWA 1AOWA 1AEIA 1DK5A 1BC0A 1N42A 2II2A 1BC3A 4MDUA 2XO3A 1AVCA 1DM5A 4MDVA 1G5NA 1W3WA 3BRXA 1N44A 1HVEA 2IE6A 1M9IA 2ZHIA 2H0KA 2ZOCA 1SAVA 4EVHA 1BC1A 1HVDA 1BO9A 2IICA 1YCNA 2ZHJA 4X9PA 2RANA 1A8AA 2HYUA 1AIIA 1ANXA 1I4AA 2H0LA 4HREA 1AXNA 1AVHA 1N00A 1YJ0A 2XO2A 1W7BA 1A8BA 1ALAA 1YIIA 4EVFA 1N41A 2HYVA 2Q4CA 1ANWA 1W45A 1XJLA 1BCYA 1HM6A
chains in the Genus database with same CATH superfamily
1PBVA 4JK1X 1MCXA 2II2A 1R8SE 1BC0A 4OIYA 1AVCA 1W3WA 1N44A 4FQ0C 2IE6A 1M9IA 4Z21A 1BC9A 3SOHB 2IICA 2ZHJA 2HYUA 1AVHA 3USWA 4Q2SA 4JWLA 1ANWA 1BCYA 1HM6A 1C1KA 1BCWA 2H0MA 1HAKA 1AOWA 2K6XA 1BC3A 4MDUA 2HSNA 4C7PA 1DM5A 1G5NA 4C0AA 4FHRB 1HVEA 2ZHIA 1SAVA 1BO9A 3TW5A 1YGMA 1A8AA 1KU1A 1ANXA 4HREA 1R8QE 1AXNA 3USYA 1YJ0A 2QEZA 2HYVA 2Q4CA 3AO0A 3L8NA 4JMOA 3SWVA 4L5MA 4KN7X 1ANNA 1AVRA 1HVFA 2IE7A 1LKVX 4A4PA 3ANYA 1AEIA 1DK5A 2XO3A 2VXGA 4MDVA 1RE0B 3BRXA 1S9DE 3ABRA 2OY9A 1QC7A 1BC1A 2R0DA 1HVDA 3LTLA 1YCNA 1Q8DA 4D7QA 2RANA 4D7RA 1AIIA 1I4AA 2H0LA 3AJCA 1N00A 1YIIA 4EVFA 1N41A 1UPTB 4JXHA 1XT0B 1HVGA 1R8ME 1BCZA 2HYWA 4JMIA 1N42A 3ABQA 2ZOCA 2H0KA 4EVHA 2R09A 4KMUX 1XSZA 4X9PA 1R4AE 3HJLA 3ABSA 2XO2A 1W7BA 4KN4X 1A8BA 1ALAA 1W45A 1XJLA 3ABOA
chains in the Genus database with same CATH topology
1HVGA 1BCZA 1ANNA 1AVRA 1HVFA 2IE7A 1BCWA 2H0MA 1MCXA 1HAKA 2HYWA 1AOWA 1AEIA 1DK5A 1BC0A 1N42A 2II2A 1BC3A 4MDUA 2XO3A 1AVCA 1DM5A 4MDVA 1G5NA 1W3WA 3BRXA 1N44A 1HVEA 2IE6A 1M9IA 2ZHIA 2H0KA 2ZOCA 1SAVA 4EVHA 1BC1A 1HVDA 1BO9A 2IICA 1YCNA 2ZHJA 4X9PA 2RANA 1A8AA 2HYUA 1AIIA 1ANXA 1I4AA 2H0LA 4HREA 1AXNA 1AVHA 1N00A 1YJ0A 2XO2A 1W7BA 1A8BA 1ALAA 1YIIA 4EVFA 1N41A 2HYVA 2Q4CA 1ANWA 1W45A 1XJLA 1BCYA 1HM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HVG A;  1BCZ A;  1ANN A;  1AVR A;  1HVF A;  2IE7 A;  1BCW A;  2H0M A;  1MCX A;  1HAK A;  2HYW A;  1AOW A;  1AEI A;  1DK5 A;  1BC0 A;  1N42 A;  2II2 A;  1BC3 A;  4MDU A;  2XO3 A;  1AVC A;  1DM5 A;  4MDV A;  1G5N A;  1W3W A;  3BRX A;  1N44 A;  1HVE A;  2IE6 A;  1M9I A;  2ZHI A;  2H0K A;  2ZOC A;  1SAV A;  4EVH A;  1BC1 A;  1HVD A;  1BO9 A;  2IIC A;  1YCN A;  2ZHJ A;  4X9P A;  2RAN A;  1A8A A;  2HYU A;  1AII A;  1ANX A;  1I4A A;  2H0L A;  4HRE A;  1AXN A;  1AVH A;  1N00 A;  1YJ0 A;  2XO2 A;  1W7B A;  1A8B A;  1ALA A;  1YII A;  4EVF A;  1N41 A;  2HYV A;  2Q4C A;  1ANW A;  1W45 A;  1XJL A;  1BCY A;  1HM6 A; 
#chains in the Genus database with same CATH topology
 1PBV A;  4JK1 X;  1MCX A;  2II2 A;  1R8S E;  1BC0 A;  4OIY A;  1AVC A;  1W3W A;  1N44 A;  4FQ0 C;  2IE6 A;  1M9I A;  4Z21 A;  1BC9 A;  3SOH B;  2IIC A;  2ZHJ A;  2HYU A;  1AVH A;  3USW A;  4Q2S A;  4JWL A;  1ANW A;  1BCY A;  1HM6 A;  1C1K A;  1BCW A;  2H0M A;  1HAK A;  1AOW A;  2K6X A;  1BC3 A;  4MDU A;  2HSN A;  4C7P A;  1DM5 A;  1G5N A;  4C0A A;  4FHR B;  1HVE A;  2ZHI A;  1SAV A;  1BO9 A;  3TW5 A;  1YGM A;  1A8A A;  1KU1 A;  1ANX A;  4HRE A;  1R8Q E;  1AXN A;  3USY A;  1YJ0 A;  2QEZ A;  2HYV A;  2Q4C A;  3AO0 A;  3L8N A;  4JMO A;  3SWV A;  4L5M A;  4KN7 X;  1ANN A;  1AVR A;  1HVF A;  2IE7 A;  1LKV X;  4A4P A;  3ANY A;  1AEI A;  1DK5 A;  2XO3 A;  2VXG A;  4MDV A;  1RE0 B;  3BRX A;  1S9D E;  3ABR A;  2OY9 A;  1QC7 A;  1BC1 A;  2R0D A;  1HVD A;  3LTL A;  1YCN A;  1Q8D A;  4D7Q A;  2RAN A;  4D7R A;  1AII A;  1I4A A;  2H0L A;  3AJC A;  1N00 A;  1YII A;  4EVF A;  1N41 A;  1UPT B;  4JXH A;  1XT0 B;  1HVG A;  1R8M E;  1BCZ A;  2HYW A;  4JMI A;  1N42 A;  3ABQ A;  2ZOC A;  2H0K A;  4EVH A;  2R09 A;  4KMU X;  1XSZ A;  4X9P A;  1R4A E;  3HJL A;  3ABS A;  2XO2 A;  1W7B A;  4KN4 X;  1A8B A;  1ALA A;  1W45 A;  1XJL A;  3ABO A; 
#chains in the Genus database with same CATH homology
 1HVG A;  1BCZ A;  1ANN A;  1AVR A;  1HVF A;  2IE7 A;  1BCW A;  2H0M A;  1MCX A;  1HAK A;  2HYW A;  1AOW A;  1AEI A;  1DK5 A;  1BC0 A;  1N42 A;  2II2 A;  1BC3 A;  4MDU A;  2XO3 A;  1AVC A;  1DM5 A;  4MDV A;  1G5N A;  1W3W A;  3BRX A;  1N44 A;  1HVE A;  2IE6 A;  1M9I A;  2ZHI A;  2H0K A;  2ZOC A;  1SAV A;  4EVH A;  1BC1 A;  1HVD A;  1BO9 A;  2IIC A;  1YCN A;  2ZHJ A;  4X9P A;  2RAN A;  1A8A A;  2HYU A;  1AII A;  1ANX A;  1I4A A;  2H0L A;  4HRE A;  1AXN A;  1AVH A;  1N00 A;  1YJ0 A;  2XO2 A;  1W7B A;  1A8B A;  1ALA A;  1YII A;  4EVF A;  1N41 A;  2HYV A;  2Q4C A;  1ANW A;  1W45 A;  1XJL A;  1BCY A;  1HM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...