1HVDA

Structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
313
structure length
313
Chain Sequence
VLRGTVTDFPGFDGRADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title Structural and electrophysiological analysis of annexin V mutants. Mutagenesis of human annexin V, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding
total genus 131
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA03
1SAVA 1YIIA 1A8BA 1AVCA 1W3WA 1M9IA 2ZHIA 1A8AA 1HVGA 2II2A 4X9PA 1ANWA 1G5NA 4MDUA 1ANXA 1BC0A 2H0KA 2IICA 1AOWA 1BC1A 1YCNA 1AEIA 2XO2A 1HVFA 1YJ0A 2HYUA 1ANNA 1HAKA 1N00A 2RANA 1DM5A 1HM6A 1BCWA 1HVDA 2HYWA 2Q4CA 2HYVA 2XO3A 1N41A 1N44A 2ZHJA 1ALAA 1W7BA 1I4AA 2ZOCA 1AXNA 1DK5A 1HVEA 2H0LA 2IE7A 4HREA 1BCZA 1AIIA 1AVHA 1XJLA 1MCXA 2IE6A 4MDVA 4EVHA 1W45A 3BRXA 4EVFA 1BCYA 1N42A 1BO9A 1AVRA 2H0MA 1BC3A
chains in the Genus database with same CATH superfamily
4JWLA 3USYA 1AVCA 1M9IA 1QC7A 1HVGA 4X9PA 1ANWA 1G5NA 4MDUA 1ANXA 4Q2SA 2IICA 4KMUX 2XO2A 1UPTB 2HYUA 1R8ME 1ANNA 3ANYA 4JMIA 2HYVA 1XT0B 4HREA 1BCZA 2K6XA 1XJLA 4MDVA 1MCXA 3BRXA 1N42A 2R09A 2H0MA 4D7RA 3ABSA 1YIIA 3AJCA 3SWVA 1A8BA 4Z21A 2II2A 1S9DE 1AOWA 4JXHA 1N00A 2RANA 3LTLA 4FHRB 1DM5A 1XSZA 1HM6A 1N44A 4JK1X 1I4AA 1AXNA 3ABOA 1W45A 1BCYA 2H0LA 4C7PA 1AVRA 4L5MA 3AO0A 1W3WA 2VXGA 1A8AA 2H0KA 3ABRA 1R4AE 1YCNA 4FQ0C 1AEIA 2OY9A 3HJLA 4OIYA 4D7QA 1HAKA 2QEZA 1BCWA 1R8SE 2XO3A 2ZHJA 1N41A 1R8QE 1ALAA 1W7BA 4C0AA 3L8NA 1BC9A 2IE6A 4EVHA 1HVEA 4A4PA 1BO9A 2HYWA 3USWA 1SAVA 1C1KA 1KU1A 4KN7X 1Q8DA 1PBVA 1YGMA 1RE0B 2ZHIA 4KN4X 1BC0A 2R0DA 1BC1A 1HVFA 1YJ0A 1LKVX 3SOHB 1HVDA 2Q4CA 3ABQA 4JMOA 2ZOCA 1DK5A 2IE7A 3TW5A 1AIIA 1AVHA 4EVFA 2HSNA 1BC3A
chains in the Genus database with same CATH topology
1SAVA 1YIIA 1A8BA 1AVCA 1W3WA 1M9IA 2ZHIA 1A8AA 1HVGA 2II2A 4X9PA 1ANWA 1G5NA 4MDUA 1ANXA 1BC0A 2H0KA 2IICA 1AOWA 1BC1A 1YCNA 1AEIA 2XO2A 1HVFA 1YJ0A 2HYUA 1ANNA 1HAKA 1N00A 2RANA 1DM5A 1HM6A 1BCWA 1HVDA 2HYWA 2Q4CA 2HYVA 2XO3A 1N41A 1N44A 2ZHJA 1ALAA 1W7BA 1I4AA 2ZOCA 1AXNA 1DK5A 1HVEA 2H0LA 2IE7A 4HREA 1BCZA 1AIIA 1AVHA 1XJLA 1MCXA 2IE6A 4MDVA 4EVHA 1W45A 3BRXA 4EVFA 1BCYA 1N42A 1BO9A 1AVRA 2H0MA 1BC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAV A;  1YII A;  1A8B A;  1AVC A;  1W3W A;  1M9I A;  2ZHI A;  1A8A A;  1HVG A;  2II2 A;  4X9P A;  1ANW A;  1G5N A;  4MDU A;  1ANX A;  1BC0 A;  2H0K A;  2IIC A;  1AOW A;  1BC1 A;  1YCN A;  1AEI A;  2XO2 A;  1HVF A;  1YJ0 A;  2HYU A;  1ANN A;  1HAK A;  1N00 A;  2RAN A;  1DM5 A;  1HM6 A;  1BCW A;  1HVD A;  2HYW A;  2Q4C A;  2HYV A;  2XO3 A;  1N41 A;  1N44 A;  2ZHJ A;  1ALA A;  1W7B A;  1I4A A;  2ZOC A;  1AXN A;  1DK5 A;  1HVE A;  2H0L A;  2IE7 A;  4HRE A;  1BCZ A;  1AII A;  1AVH A;  1XJL A;  1MCX A;  2IE6 A;  4MDV A;  4EVH A;  1W45 A;  3BRX A;  4EVF A;  1BCY A;  1N42 A;  1BO9 A;  1AVR A;  2H0M A;  1BC3 A; 
#chains in the Genus database with same CATH topology
 4JWL A;  3USY A;  1AVC A;  1M9I A;  1QC7 A;  1HVG A;  4X9P A;  1ANW A;  1G5N A;  4MDU A;  1ANX A;  4Q2S A;  2IIC A;  4KMU X;  2XO2 A;  1UPT B;  2HYU A;  1R8M E;  1ANN A;  3ANY A;  4JMI A;  2HYV A;  1XT0 B;  4HRE A;  1BCZ A;  2K6X A;  1XJL A;  4MDV A;  1MCX A;  3BRX A;  1N42 A;  2R09 A;  2H0M A;  4D7R A;  3ABS A;  1YII A;  3AJC A;  3SWV A;  1A8B A;  4Z21 A;  2II2 A;  1S9D E;  1AOW A;  4JXH A;  1N00 A;  2RAN A;  3LTL A;  4FHR B;  1DM5 A;  1XSZ A;  1HM6 A;  1N44 A;  4JK1 X;  1I4A A;  1AXN A;  3ABO A;  1W45 A;  1BCY A;  2H0L A;  4C7P A;  1AVR A;  4L5M A;  3AO0 A;  1W3W A;  2VXG A;  1A8A A;  2H0K A;  3ABR A;  1R4A E;  1YCN A;  4FQ0 C;  1AEI A;  2OY9 A;  3HJL A;  4OIY A;  4D7Q A;  1HAK A;  2QEZ A;  1BCW A;  1R8S E;  2XO3 A;  2ZHJ A;  1N41 A;  1R8Q E;  1ALA A;  1W7B A;  4C0A A;  3L8N A;  1BC9 A;  2IE6 A;  4EVH A;  1HVE A;  4A4P A;  1BO9 A;  2HYW A;  3USW A;  1SAV A;  1C1K A;  1KU1 A;  4KN7 X;  1Q8D A;  1PBV A;  1YGM A;  1RE0 B;  2ZHI A;  4KN4 X;  1BC0 A;  2R0D A;  1BC1 A;  1HVF A;  1YJ0 A;  1LKV X;  3SOH B;  1HVD A;  2Q4C A;  3ABQ A;  4JMO A;  2ZOC A;  1DK5 A;  2IE7 A;  3TW5 A;  1AII A;  1AVH A;  4EVF A;  2HSN A;  1BC3 A; 
#chains in the Genus database with same CATH homology
 1SAV A;  1YII A;  1A8B A;  1AVC A;  1W3W A;  1M9I A;  2ZHI A;  1A8A A;  1HVG A;  2II2 A;  4X9P A;  1ANW A;  1G5N A;  4MDU A;  1ANX A;  1BC0 A;  2H0K A;  2IIC A;  1AOW A;  1BC1 A;  1YCN A;  1AEI A;  2XO2 A;  1HVF A;  1YJ0 A;  2HYU A;  1ANN A;  1HAK A;  1N00 A;  2RAN A;  1DM5 A;  1HM6 A;  1BCW A;  1HVD A;  2HYW A;  2Q4C A;  2HYV A;  2XO3 A;  1N41 A;  1N44 A;  2ZHJ A;  1ALA A;  1W7B A;  1I4A A;  2ZOC A;  1AXN A;  1DK5 A;  1HVE A;  2H0L A;  2IE7 A;  4HRE A;  1BCZ A;  1AII A;  1AVH A;  1XJL A;  1MCX A;  2IE6 A;  4MDV A;  4EVH A;  1W45 A;  3BRX A;  4EVF A;  1BCY A;  1N42 A;  1BO9 A;  1AVR A;  2H0M A;  1BC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...