1HVDA

Structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
313
structure length
313
Chain Sequence
VLRGTVTDFPGFDGRADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium/phospholipid binding
molecule keywords ANNEXIN V
publication title Structural and electrophysiological analysis of annexin V mutants. Mutagenesis of human annexin V, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
pubmed doi rcsb
source organism Homo sapiens
total genus 131
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1hvdA03
1ALAA 1AVHA 2Q4CA 1HVFA 4MDVA 2ZHIA 2H0KA 1AOWA 4X9PA 4EVFA 1HAKA 1W45A 1ANWA 1N41A 1AVCA 2H0LA 1M9IA 1I4AA 1YCNA 2RANA 2H0MA 2XO2A 1G5NA 2HYWA 1BCYA 1AXNA 1BCWA 1HVEA 1W7BA 1HM6A 1BC1A 2ZHJA 3BRXA 1DM5A 1A8AA 1SAVA 4MDUA 1AIIA 2II2A 1A8BA 2XO3A 1YJ0A 4EVHA 1BC3A 1BC0A 1AEIA 2HYUA 2IE7A 4HREA 1MCXA 2IICA 1AVRA 1YIIA 2HYVA 1HVDA 2IE6A 1N44A 1ANNA 1ANXA 1N42A 1DK5A 1BO9A 1XJLA 1W3WA 1N00A 1HVGA 1BCZA 2ZOCA
chains in the Genus database with same CATH superfamily
1AVHA 4C7PA 4EVFA 1W45A 2H0LA 1R8QE 2OY9A 3USWA 2HYWA 2K6XA 1AXNA 1C1KA 1XSZA 1HVEA 1HM6A 1BC1A 3ABRA 4KMUX 3TW5A 1SAVA 4MDUA 2II2A 1YJ0A 2IICA 3LTLA 2IE6A 1HVDA 1LKVX 1XT0B 1BO9A 4D7RA 1R8SE 4OIYA 1PBVA 1BCZA 4EVHA 2Q4CA 3ABSA 2VXGA 4KN4X 1ANWA 3SOHB 3USYA 1I4AA 1S9DE 1A8AA 4KN7X 1AIIA 1QC7A 3AJCA 3L8NA 2HYUA 2IE7A 2R09A 4A4PA 1YIIA 1ANNA 3ANYA 4Q2SA 1HVGA 3AO0A 1HVFA 4MDVA 1HAKA 1N41A 1AVCA 1M9IA 1R4AE 2R0DA 1YCNA 2RANA 1RE0B 2XO2A 1G5NA 1KU1A 2ZHJA 4Z21A 1A8BA 4HREA 1MCXA 1BC9A 1N44A 1N42A 4C0AA 4JMIA 1ALAA 4JK1X 4L5MA 2ZHIA 3SWVA 2H0KA 1AOWA 4X9PA 1UPTB 4JMOA 2H0MA 2HSNA 1BCYA 1Q8DA 1BCWA 3ABOA 1W7BA 4FHRB 3ABQA 3BRXA 1DM5A 4FQ0C 4D7QA 2QEZA 2XO3A 1BC3A 1BC0A 1AEIA 4JWLA 1R8ME 1AVRA 2HYVA 1YGMA 1ANXA 4JXHA 1DK5A 1XJLA 1W3WA 1N00A 3HJLA 2ZOCA
chains in the Genus database with same CATH topology
1ALAA 1AVHA 2Q4CA 1HVFA 4MDVA 2ZHIA 2H0KA 1AOWA 4X9PA 4EVFA 1HAKA 1W45A 1ANWA 1N41A 1AVCA 2H0LA 1M9IA 1I4AA 1YCNA 2RANA 2H0MA 2XO2A 1G5NA 2HYWA 1BCYA 1AXNA 1BCWA 1HVEA 1W7BA 1HM6A 1BC1A 2ZHJA 3BRXA 1DM5A 1A8AA 1SAVA 4MDUA 1AIIA 2II2A 1A8BA 2XO3A 1YJ0A 4EVHA 1BC3A 1BC0A 1AEIA 2HYUA 2IE7A 4HREA 1MCXA 2IICA 1AVRA 1YIIA 2HYVA 1HVDA 2IE6A 1N44A 1ANNA 1ANXA 1N42A 1DK5A 1BO9A 1XJLA 1W3WA 1N00A 1HVGA 1BCZA 2ZOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALA A;  1AVH A;  2Q4C A;  1HVF A;  4MDV A;  2ZHI A;  2H0K A;  1AOW A;  4X9P A;  4EVF A;  1HAK A;  1W45 A;  1ANW A;  1N41 A;  1AVC A;  2H0L A;  1M9I A;  1I4A A;  1YCN A;  2RAN A;  2H0M A;  2XO2 A;  1G5N A;  2HYW A;  1BCY A;  1AXN A;  1BCW A;  1HVE A;  1W7B A;  1HM6 A;  1BC1 A;  2ZHJ A;  3BRX A;  1DM5 A;  1A8A A;  1SAV A;  4MDU A;  1AII A;  2II2 A;  1A8B A;  2XO3 A;  1YJ0 A;  4EVH A;  1BC3 A;  1BC0 A;  1AEI A;  2HYU A;  2IE7 A;  4HRE A;  1MCX A;  2IIC A;  1AVR A;  1YII A;  2HYV A;  1HVD A;  2IE6 A;  1N44 A;  1ANN A;  1ANX A;  1N42 A;  1DK5 A;  1BO9 A;  1XJL A;  1W3W A;  1N00 A;  1HVG A;  1BCZ A;  2ZOC A; 
#chains in the Genus database with same CATH topology
 1AVH A;  4C7P A;  4EVF A;  1W45 A;  2H0L A;  1R8Q E;  2OY9 A;  3USW A;  2HYW A;  2K6X A;  1AXN A;  1C1K A;  1XSZ A;  1HVE A;  1HM6 A;  1BC1 A;  3ABR A;  4KMU X;  3TW5 A;  1SAV A;  4MDU A;  2II2 A;  1YJ0 A;  2IIC A;  3LTL A;  2IE6 A;  1HVD A;  1LKV X;  1XT0 B;  1BO9 A;  4D7R A;  1R8S E;  4OIY A;  1PBV A;  1BCZ A;  4EVH A;  2Q4C A;  3ABS A;  2VXG A;  4KN4 X;  1ANW A;  3SOH B;  3USY A;  1I4A A;  1S9D E;  1A8A A;  4KN7 X;  1AII A;  1QC7 A;  3AJC A;  3L8N A;  2HYU A;  2IE7 A;  2R09 A;  4A4P A;  1YII A;  1ANN A;  3ANY A;  4Q2S A;  1HVG A;  3AO0 A;  1HVF A;  4MDV A;  1HAK A;  1N41 A;  1AVC A;  1M9I A;  1R4A E;  2R0D A;  1YCN A;  2RAN A;  1RE0 B;  2XO2 A;  1G5N A;  1KU1 A;  2ZHJ A;  4Z21 A;  1A8B A;  4HRE A;  1MCX A;  1BC9 A;  1N44 A;  1N42 A;  4C0A A;  4JMI A;  1ALA A;  4JK1 X;  4L5M A;  2ZHI A;  3SWV A;  2H0K A;  1AOW A;  4X9P A;  1UPT B;  4JMO A;  2H0M A;  2HSN A;  1BCY A;  1Q8D A;  1BCW A;  3ABO A;  1W7B A;  4FHR B;  3ABQ A;  3BRX A;  1DM5 A;  4FQ0 C;  4D7Q A;  2QEZ A;  2XO3 A;  1BC3 A;  1BC0 A;  1AEI A;  4JWL A;  1R8M E;  1AVR A;  2HYV A;  1YGM A;  1ANX A;  4JXH A;  1DK5 A;  1XJL A;  1W3W A;  1N00 A;  3HJL A;  2ZOC A; 
#chains in the Genus database with same CATH homology
 1ALA A;  1AVH A;  2Q4C A;  1HVF A;  4MDV A;  2ZHI A;  2H0K A;  1AOW A;  4X9P A;  4EVF A;  1HAK A;  1W45 A;  1ANW A;  1N41 A;  1AVC A;  2H0L A;  1M9I A;  1I4A A;  1YCN A;  2RAN A;  2H0M A;  2XO2 A;  1G5N A;  2HYW A;  1BCY A;  1AXN A;  1BCW A;  1HVE A;  1W7B A;  1HM6 A;  1BC1 A;  2ZHJ A;  3BRX A;  1DM5 A;  1A8A A;  1SAV A;  4MDU A;  1AII A;  2II2 A;  1A8B A;  2XO3 A;  1YJ0 A;  4EVH A;  1BC3 A;  1BC0 A;  1AEI A;  2HYU A;  2IE7 A;  4HRE A;  1MCX A;  2IIC A;  1AVR A;  1YII A;  2HYV A;  1HVD A;  2IE6 A;  1N44 A;  1ANN A;  1ANX A;  1N42 A;  1DK5 A;  1BO9 A;  1XJL A;  1W3W A;  1N00 A;  1HVG A;  1BCZ A;  2ZOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...